|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR001806 | Small GTPase superfamily | PRINTS | PR00449 | RASTRNSFRMNG | coord: 67..89
score: 0.0
coord: 170..192
score: 0.0
coord: 18..39
score: 0.0
coord: 130..143
score: 0.0 |
| IPR024156 | Small GTPase superfamily, ARF type | SMART | SM00177 | ARF | coord: 1..196
e-value: 1.499996482E-34
score: 0.0 |
| IPR024156 | Small GTPase superfamily, ARF type | PROSITE | PS51417 | ARF | coord: 11..192
score: 0.0 |
| IPR005225 | Small GTP-binding protein domain | TIGRFAM | TIGR00231 | TIGR00231 | coord: 17..183
e-value: 2.5E-17
score: 0.0 |
| IPR006689 | Small GTPase superfamily, ARF/SAR type | PFAM | PF00025 | Arf | coord: 13..191
e-value: 2.1E-46
score: 0.0 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 3..192
e-value: 2.8E-50
score: 0.0 |
| None | No IPR available | PANTHER | PTHR11711 | ADP RIBOSYLATION FACTOR-RELATED | coord: 1..201 |
| None | No IPR available | PANTHER | PTHR11711:SF19 | ARF-RELATED PROTEIN 1, ARFRP1 | coord: 1..201 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 14..195 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000001132 ID=EMLSAP00000001132|Name=EMLSAP00000001132|organism=Lepeophtheirus salmonis|type=polypeptide|length=206bp
MYSLINGAYKYLTEKDEYYVLILGLDNAGKTTFLESAKAKFSLDRKKKSV
FKINPAKITTTVGLNIGRIEVNSVRLNFWDLGGQSELQSLWDKYYAECHA
IIYTIDSNDRERISESKVSFDSMISNENLKGVPLLVLANKQDLPECMGVR
EVKPIFHENDESIGSRETMVLPTSGLTGDGISEGIEWLVQCIERNSVDRP
PDGKRD back to top
|
