|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR001806 | Small GTPase superfamily | PRINTS | PR00449 | RASTRNSFRMNG | coord: 50..72
score: 0.0
coord: 112..125
score: 0.0
coord: 32..48
score: 0.0
coord: 147..169
score: 0.0
coord: 9..30
score: 0.0 |
| IPR001806 | Small GTPase superfamily | PFAM | PF00071 | Ras | coord: 10..170
e-value: 1.6E-66
score: 0.0 |
| IPR003579 | Small GTPase superfamily, Rab type | SMART | SM00175 | RAB | coord: 9..172
e-value: 1.0E-108
score: 0.0 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 2..201
e-value: 1.0E-75
score: 0.0 |
| None | No IPR available | PANTHER | PTHR24073 | FAMILY NOT NAMED | coord: 2..201 |
| None | No IPR available | PANTHER | PTHR24073:SF212 | SUBFAMILY NOT NAMED | coord: 2..201 |
| None | No IPR available | PROSITE | PS51419 | RAB | coord: 4..201
score: 0.0 |
| IPR005225 | Small GTP-binding protein domain | TIGRFAM | TIGR00231 | TIGR00231 | coord: 7..165
e-value: 6.5E-34
score: 0.0 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 4..176 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000001458 ID=EMLSAP00000001458|Name=EMLSAP00000001458|organism=Lepeophtheirus salmonis|type=polypeptide|length=201bp
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI
ELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQDSFNNLK
QWLQEIDRYACENVNKLLVGNKCDLTTKKVVDYTTAKEYADQLNMPFLEA
SAKNATNVEQAFMTMAAEIKNRVGPPAPSGPSGQVKIDSTPVSSKSGTGC
C back to top
|
