EMLSAT00000001458, EMLSAT00000001458-697305 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000001458
Unique NameEMLSAT00000001458-697305
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, no eggstrings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
AP F366 EMLSAT00000001458 EMLSAG00000001458 female
  1. PreAdult2
no eggstreng
female reproduction, no eggstrings
06.03.2018 - 09:00
10.04.2018 - 09:00
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: survival, reduced
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
EMLSAT00000001458 cop + infection RAB1A both
  1. Nauplius1
  2. Copepodid
no lice survived to the end of experiment, where control lice were mainly chalimus 2
survival, reduced
09.05.2018 - 09:00
01.06.2018 - 10:00
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1248supercontigLSalAtl2s1248:131241..136261 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000001458 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000001458EMLSAG00000001458-684224Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000006343EMLSAE00000006343-715271Lepeophtheirus salmonisexon
EMLSAE00000006344EMLSAE00000006344-715272Lepeophtheirus salmonisexon
EMLSAE00000006345EMLSAE00000006345-715273Lepeophtheirus salmonisexon
EMLSAE00000006346EMLSAE00000006346-715274Lepeophtheirus salmonisexon
EMLSAE00000006347EMLSAE00000006347-715275Lepeophtheirus salmonisexon
EMLSAE00000006348EMLSAE00000006348-715276Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto772914auto772914Lepeophtheirus salmonispolypeptide
EMLSAP00000001458EMLSAP00000001458Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000001458

>EMLSAP00000001458 ID=EMLSAP00000001458|Name=EMLSAP00000001458|organism=Lepeophtheirus salmonis|type=polypeptide|length=201bp
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI
ELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQDSFNNLK
QWLQEIDRYACENVNKLLVGNKCDLTTKKVVDYTTAKEYADQLNMPFLEA
SAKNATNVEQAFMTMAAEIKNRVGPPAPSGPSGQVKIDSTPVSSKSGTGC
C
back to top

mRNA from alignment at LSalAtl2s1248:131241..136261+

Legend: exonpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000001458-697305 ID=EMLSAT00000001458-697305|Name=EMLSAT00000001458|organism=Lepeophtheirus salmonis|type=mRNA|length=5021bp|location=Sequence derived from alignment at LSalAtl2s1248:131241..136261+ (Lepeophtheirus salmonis)
AACCTAACAATCAACGAATGAAAAGGGAGAGTTAAAAAATGATAAAAAGT AAGGTAGAAAAAGAGCTCTATTCTGGGACCTTTAGTTAAGTAGTATAGGA AGGGGAGGCAAATTCTTATTCGTCACCCACTGTAGTGGAGAAAAAGAAAG AAAAAGAGAGAGAAAGAGAAAGAAAGAAGGAGAAGGAAGACTGATCAAAG AAATAAGGGAAAAATCTGTCAAAAGTTCTTCAGGGATACATATTTGGTTG GATTTCGTACTTTTCTTCGTAGTTGTGTAAAGATTGATATAGACCATGAA TCCAGAATAGTGAGTAAACTTATTGGATAAAGCGTATTTTTTGTGTAGGA GGAGGCCCATAAACCTTCRCCATCCTCTTGTCTCATGATCCCATCCGATC CTGTCCCATTTGTACATTATGAGGTATCCAGTTGAAGAATCCCTTTTTGC ACTACTTTCGAATCTTGACCAGTTTTTCTAATTTTATTTCCTACTTAGCC ATGAGATGGGAGTCGATGTTACTAGGAAGGACCTTGTCTTGATTCACTGC AGTTGAGATCCATTTCGTATGTCGTATTGAAAAGGCATTTCTATTCCGTG AAATAGGAGCTCTAAAGATTCTAAATATCTTCTCTCTTTTCAATGTACAT TGTTCGTCAGTACAAAAGCAAGCTAGTATGAGTTTACTCAAAAAATAAGA TTAGAATACCATTGTATTCTTATACGGATTATCTCAATTTCCTTCGACAA ATTAATCTTATTCAGCTTTTGAAGGGCCTACAAATTGCACTAATTTCGTA ATTTGCATTATACMAAGTTAATCGTCATAATAATAAAAAAAATGGATAGA TTTTATTCGAAAAGCCATGTCATGGTCAAATTAAGTTTCATAAATCAAAT AAACGTTCTAAACTATAGCTATTGTTCTTCAGTATCCTAACACACCCCAC AACTTTGAATACAAAGCCTATAATTGCCTCAAATAGGGGGTGTTGACAAT AAATGAAGTAAAAAAAATAATCTGGAATTTTTCCTCTTTTTGATTGTTTT ATGTTCATACAGCACATATTTATATTAATATACGTAAATGTACCATCTTC CAGAAATAAATCTGTTTTAATACTTATTGTATCCATGAAGGGAATATCCT AAGAGGTTTGAATAATTAGTTAAATCTAACATTGAACAATTTTATATTAA GCTTATGCTCTCTCCATTGAGATAAATTCATTAAAATTCAATTTTCATGT ATTTTTTTTTCTGACATAAAATTCTTAATTTATCATTTCTAATGGTTAAT AGCTGTAAATTAATGTAAATATTAGTGAAAAGTAATGCTGGATATTAATG GGTATTTGTCTATTGTAATTTAAATTTATCTTTTCAGCGATTATTTATTC AAGCTGTTATTGATTGGCGATTCTGGTGTAGGCAAATCGTGCTTACTATT AAGATTTGCTGATGATACTTACACAGAAAGTTACATAAGTACAATTGGTG TTGACTTTAAGATTAGAACAATTGAACTCGACGGAAAGACTATCAAGTTG CAAATCTGGGATACTGCAGGCCAAGAAAGATTCAGAACTATCACATCCAG GTATTTTTCATTACTTTATATTATCATATATATTTTTAAATCATTTTGGA AGTTATACTTTAAATATTCACTTTTCAATTTGATACTTTTTTTTTAAATG AATAAAGTTACTATCGTGGTGCCCACGGAATCATCGTTGTATATGACGTT ACGGACCAGGATTCTTTTAATAACCTTAAGCAATGGCTTCAAGAAATTGA TAGATACGCATGTGAAAATGTAAACAAGCTTCTTGTGGGAAACAAATGTG ATCTGACAACAAAGAAGGTTGTAGATTATACAACTGCAAAAGTAAGTTTC GTCTGTGTATACATATATATTTCATTAAATTGTTTTTTGGAGTACCGAAT GTTTATTAGGAATTATTAATGTAGGATTTGATTTTTATCGTCATTGTTAC ATTTGAGATAAATAGTGGTACACCACATTAAATGGACTTAATTACTTTGA ATAATATATTGTATTTGTTAAAAGGAATACGCTGATCAGTTAAATATGCC GTTTTTGGAAGCCTCTGCTAAAAATGCAACCAACGTAGAGCAAGCTTTTA TGACTATGGCAGCGGAAATTAAAAACAGAGTTGGACCTCCTGCTCCCTCT GGACCATCAGGACAAGTCAAGATTGATTCGACCCCTGTTTCATCCAAATC AGGGACTGGATGTTGCTAAGAATCTAAGTCGTCTCGTTACATACCTTTCT CTAATCCTATATTCCATTTTTTTTAAAATCATCTATTAAGTTTGTTTACA GTCATCAGGTATTATGGAAATATGTAATAGAATAATTGATCTTATTTTTT ATGAAATATATTTTACAGCGATGTTTGCAACATTTCGATTGAGATTTGAT CTTGAATATAACATTTTTACCAGGATTAAAGGTCATCATCATTATATGTA ATTACGAACCACATCTTCAAATTGCCTCTGTTTTTAGCTGACATCTTTAT ACTTCGTCTTAATTAGTCTGAATTTCATTATCTAGTTGAAGAACAGAAGG AGCAAAATAAACTTGTCTAGAAATCATTGTCTATTATGTTTTGATTATTA TTATTTCTTCTGAGTAAGTTTTTGTTCATATAATTAGATTAGGTTTAATT TTATAGATCGTTTTAATTATTAAAAAGTGTTATATTGATCCAATGTTTCT TTTAAATTTTTTTTTTGGTTCATTCGTTTTACGATTATATAATATATTAT TAATTAGGAAGCAATCTAAAAAATTGCACCCTTCCTTGGATAATGCTGTG TATTGATCAGCCCTTCTCATTTGATTGTGTCTCCTTTAATATATTTGTAT TAATAAACAATAATACAGAAAAGGTATTTTAATTGCTAAAAGCTTAATTT TTGGATGCAGACGTTTAACCAACATGAATTAAATAATTATTAAGTTATGT AATGCCAACGTGTAATTATTTTTTTCTCTTTTATTCCATTCCATTAAAAT TTGTAAATAAATGATTTTTACATGAAACAGTTCTTTATTCCTTTGTGGTT TCTAAATTTTTTCAATTGGTGGTTTTTTAATAAAATTAAAATATTAAATT ATAAAGAGAATCTATTACTGTAAGAGGGAAAATTCGATATTTTCTCATAA CGCACCTCTATTTTATGAGCTATATACTCAAAAATAAAATGCATACTTTT AGACACTTATTATATTGAGATCATGTCATCAGTAAGCAGCTAAATATATT TTACTTGCTTCTCTATCCAAAATAAGAGTCTAAGCTTAATTAGTTTTTGA TAATAAGAAAAGCCATGTGAAAATAATAAAAATGTCAACAAATTTTGGTT GAAATGAAGAATAAATTAAGCCGATCACTAATTAATTGGTCAAATATATG AATCTAGAGTTATACGCTTGTATCCCAAAGAGCAAGTATTTTATTGAGGA TATGATTGGATAAAGTTGATCATCCTGAAGAAAGCATTGCCATCCATGTA GTATGTAAAATGATAAATGAATATCCAAATATGTCAACTTATATTTTTTT GAGCGTAGAACTCAACATAAAGTTAAGATCAACCCGTTTAATTCTTAATC GTAATCTAAGAACGCGTTAAGTCATGTGATTACATTTATTTGTTCATAAA AAAATATTTATTTTGATGCTTTGTCAGGTACTGTTTCGGCCATTGTACAT ATTAATCTATCTCTTTTAGTAACAAATCCTAAAGCTTCTTCTGGTAATTT GGAAGGGTCGTCTACGATGCTTGTCTTGGCGCATAGTTTGGCCAATTTTC TATACGCATCTGAAAAATAAGTATATAATAATAAGTCTTGGCTATTTATC TAAAAATTAAGACTTTTTCCAAATATTATATCCATATACAAATAGAAAAC GAATTATTTTAATAAAATTTTACCTTTTCGTAATTGGTGGAGGGACATAT TCTTAGAAATCCACATTGAGCTTTTTTTTCTTAATATGTCAATCGATGAG GCATCAACTTCCCTATCAAAACTATGAACAAAATGTCCCATTATATTAGT AAAGACCCAATATCTCCAGTCTTCAATAGTTTTTTCAACCACATGATCGT GGAATCGGTCTGCTAAACTTCGAGAAGCAAGGACTTTTGGAACTAAAACC ACTCCATTATCTGGTAACTCGCTCTGGAAATGCCTAAAAAATATGAATAT CAAGAAATATTTATGTAAACATATGATAGATCAATCTTTAGAACAATTCG TTTTTACTATAAAAAAAGTGTATAGTTACTCAATTTCTCGATTTAATTTT TCAATTTCTTCTTTAAGGGAACATATGTGGTCCGTTGTTTTGTTGTTGAA TGCTTGARTATCCTTAATGAATTTACCAGCCTCATATAATATGCTGGCTT GACTTATCTATTCAAATAAACGCATATTTAGTACTGAGTTCCTACTGTAA CAAATGTTAATAAAATTAAATAACTTAAAAATGAGGTTATCATTTATTTA AAATTAAGTATTCCTCATTTCCATGGTGAAGTTACAGTTTCAAAAAGCTA TTAGAATGTTTCTTTAACCTTTTCCTCTTCGGGTGATCCAAGATGTGGTA ATACTCTTTGCAATTCATCTAAGCCTTGCTTAATAGAGTCTCTCCTTCTA TTTTCAGTAGATGAATGGGATCCGGATATAGAGTTTGGTAAAGGTATACA CTTTTTTCGAAAGCGCTTTTCCTCTGATGTATATATTTCAAGTTCTTCAA TTGGTTCAACGACATCACTGGTAGTKCCGCCATTAGATTTACTTCGTCGA GAGCGTTTGTTTGTTTTAACTGTTCGAGCATCATCATTTTCTTGTGGTTT TTCTTGTTTTTGACTATTGTTTTGGTCAACCTAATTAGAATAATTAGGTT ACAAGCAACAAATAAAAGGCATGAAGTATAATGTAGGTCTTATTGGGTTA TCGATACAGCGAGAACGTTAG
back to top
Add to Basket