|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR000245 | V-ATPase proteolipid subunit | PRINTS | PR00122 | VACATPASE | coord: 54..78
score: 65.89
coord: 104..130
score: 81.87
coord: 131..154
score: 72.59
coord: 28..52
score: 69.79 |
| None | No IPR available | GENE3D | 1.20.120.610 | | coord: 4..153
e-value: 1.5E-60
score: 202.8 |
| None | No IPR available | PANTHER | PTHR10263 | V-TYPE PROTON ATPASE PROTEOLIPID SUBUNIT | coord: 1..154 |
| None | No IPR available | TMHMM | TMhelix | | coord: 11..33 |
| None | No IPR available | TMHMM | TMhelix | | coord: 54..76 |
| None | No IPR available | TMHMM | TMhelix | | coord: 96..118 |
| None | No IPR available | TMHMM | TMhelix | | coord: 131..153 |
| IPR011555 | V-ATPase proteolipid subunit C, eukaryotic | TIGRFAM | TIGR01100 | TIGR01100 | coord: 11..118
e-value: 9.1E-48
score: 158.8 |
| IPR002379 | V-ATPase proteolipid subunit C-like domain | PFAM | PF00137 | ATP-synt_C | coord: 91..153
e-value: 1.6E-17
score: 63.0
coord: 12..76
e-value: 6.0E-12
score: 45.1 |
| IPR002379 | V-ATPase proteolipid subunit C-like domain | SUPERFAMILY | 81333 | F1F0 ATP synthase subunit C | coord: 84..153 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000003907 ID=EMLSAP00000003907|Name=EMLSAP00000003907|organism=Lepeophtheirus salmonis|type=polypeptide|length=156bp
MTEENPIYAPFFGVMGATAAMVFSAMGAAYGTAKSGTGIAAMAXMRPEAI
VKSSIPVVMAGILAIYGLVVAVLIAGKVGKPAEYSLFLGFVHLGSGLSVG
LSGLAAGYAIGIVGXAGVRGTAQQPRLFVGMILILIFAEXLGLYGLIVAI
YMFTLG back to top
|
