hypothetical protein DAPPUDRAFT_116586, maker-scaffold10325_size2217-snap-gene-0.0 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of hypothetical protein DAPPUDRAFT_116586 vs. nr
Match: gi|321455110|gb|EFX66253.1| (hypothetical protein DAPPUDRAFT_116586 [Daphnia pulex]) HSP 1 Score: 58.151 bits (139), Expect = 1.359e-7 Identity = 41/88 (46.59%), Postives = 51/88 (57.95%), Query Frame = 0 Query: 107 AYAKSKDRYDRHARKHPI--LIEVDEVRIQDRNTKVWDKKGSIIGIREGERCYEVE-QNGRVYLRNRRYVRPTR---DQDPEDQQNEP 188 A AK+K YD HA HP+ L EVRIQD TK+W+K G I+ I + R Y V+ +G V RNRR++RP R DPE N P Sbjct: 9 ASAKAKLYYDVHA--HPLAPLKIGTEVRIQDEKTKLWEKVGVIVAIGKF-RSYRVKFASGSVLWRNRRFLRPIRAAVTPDPEGSPNTP 93 The following BLAST results are available for this feature:
BLAST of hypothetical protein DAPPUDRAFT_116586 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of hypothetical protein DAPPUDRAFT_116586 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of hypothetical protein DAPPUDRAFT_116586 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold10325_size2217:1228..2181+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold10325_size2217-snap-gene-0.0 ID=maker-scaffold10325_size2217-snap-gene-0.0|Name=hypothetical protein DAPPUDRAFT_116586|organism=Tigriopus kingsejongensis|type=gene|length=954bp|location=Sequence derived from alignment at scaffold10325_size2217:1228..2181+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'hypothetical protein DAPPUDRAFT_116586' has the following synonyms
Add to Basket
|