antho-rfamide neuropeptide, maker-scaffold12_size759060-snap-gene-4.15 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of antho-rfamide neuropeptide vs. L. salmonis genes
Match: EMLSAG00000007110 (supercontig:LSalAtl2s:LSalAtl2s400:26835:30349:-1 gene:EMLSAG00000007110 transcript:EMLSAT00000007110 description:"maker-LSalAtl2s400-augustus-gene-0.13") HSP 1 Score: 76.6406 bits (187), Expect = 1.927e-17 Identity = 48/99 (48.48%), Postives = 59/99 (59.60%), Query Frame = 0 Query: 51 YSRILRSPNTFSRILRSPSTFSRILRSPSTFSRILRSS-----FSRIHRDPSSTFSRILREASKSWDKNDLKRESFSRILRAPGFSRISKS-DPLSRIL 143 +SRILR P+ FSRILR S FS+I R P +SRI++ S F+RI RDP F+RILR + FSRILR PG+ RI +S SRIL Sbjct: 77 FSRILREPDGFSRILRKDSAFSKIARDPG-YSRIVKKSDDMNGFARIQRDPME-FARILR-----------GQTGFSRILRTPGYVRILRSPHGFSRIL 162 HSP 2 Score: 56.6102 bits (135), Expect = 1.717e-10 Identity = 32/53 (60.38%), Postives = 38/53 (71.70%), Query Frame = 0 Query: 47 KRD--EYSRILRSPNTFSRILRSPSTFSRILRSPSTFSRILR--SSFSRIHRD 95 +RD E++RILR FSRILR+P + RILRSP FSRILR + FSRI RD Sbjct: 123 QRDPMEFARILRGQTGFSRILRTPG-YVRILRSPHGFSRILRGDAEFSRIIRD 174 HSP 3 Score: 51.2174 bits (121), Expect = 1.395e-8 Identity = 31/66 (46.97%), Postives = 37/66 (56.06%), Query Frame = 0 Query: 40 EEDPNEGKR-----DEYSRILRSPNTFSRILRSPSTFSRILRSPSTFSRILRSSFSRIHRDPSSTF 100 + DP E R +SRILR+P + RILRSP FSRILR + FSRI+R F H P F Sbjct: 123 QRDPMEFARILRGQTGFSRILRTPG-YVRILRSPHGFSRILRGDAEFSRIIR-DFHPSHNTPFQDF 186
BLAST of antho-rfamide neuropeptide vs. nr
Match: gi|908419340|ref|XP_013070992.1| (PREDICTED: FMRF-amide neuropeptides-like [Biomphalaria glabrata]) HSP 1 Score: 57.3806 bits (137), Expect = 8.810e-7 Identity = 47/110 (42.73%), Postives = 64/110 (58.18%), Query Frame = 0 Query: 34 LHEFLAEEDPNEG---KRDEYSRILRSPNTFSRILRSPSTFSRILRSPSTFSRILR--SSFSRIHRDPSSTFSRILREASKSWDKNDLKRE--SFSRILRAPGFSRISKS 136 + + LAEED +E + + RI +SP++F RI ++PS+F RI +SPS+F RI + SSF RI + PSS F RI R +NDLK E +A F RI KS Sbjct: 131 IGKSLAEEDSDEDVDKRASSFVRIGKSPSSFVRIGKAPSSFVRIGKSPSSFVRIGKSPSSFVRIGKVPSS-FVRIGRSI-----ENDLKSELDDIDEEKKASSFVRIGKS 234 The following BLAST results are available for this feature:
BLAST of antho-rfamide neuropeptide vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of antho-rfamide neuropeptide vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of antho-rfamide neuropeptide vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold12_size759060:476455..478223- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold12_size759060-snap-gene-4.15 ID=maker-scaffold12_size759060-snap-gene-4.15|Name=antho-rfamide neuropeptide|organism=Tigriopus kingsejongensis|type=gene|length=1769bp|location=Sequence derived from alignment at scaffold12_size759060:476455..478223- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'antho-rfamide neuropeptide' has the following synonyms
Add to Basket
|