chitin binding peritrophin-, maker-scaffold241_size241811-snap-gene-1.14 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of chitin binding peritrophin- vs. L. salmonis genes
Match: EMLSAG00000006636 (supercontig:LSalAtl2s:LSalAtl2s365:160926:165680:1 gene:EMLSAG00000006636 transcript:EMLSAT00000006636 description:"maker-LSalAtl2s365-augustus-gene-1.9") HSP 1 Score: 132.109 bits (331), Expect = 5.489e-41 Identity = 59/125 (47.20%), Postives = 82/125 (65.60%), Query Frame = 0 Query: 6 LLLICLGGGVWSQNCNPGPCSRIPGLVYNADLDQCAWPDEIGCSLNDLGYNTDCGSLNPFELKAVDFEVLGIPSDRTSDQYFLVCVPETTEDDRVSDRAYSTGPPVPRLLGCPRGHTFNPNTKVC 130 +L++ + Q+C PG CS I G VY+ LDQCAWPDE+GC + DLG N +C N +ELKA+ ++ +P +R QYF+VC+P TE+D++ + +TGP PRLLGCP H F+PNT C Sbjct: 7 ILILFTIQATFGQSCQPGVCSSILGTVYDEVLDQCAWPDEVGCFVQDLGINENCDGYNAYELKALSSDIPNLPQNRYIQQYFVVCLPMLTEEDKLQEIPIATGPIAPRLLGCPEYHEFDPNTNTC 131 The following BLAST results are available for this feature:
BLAST of chitin binding peritrophin- vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of chitin binding peritrophin- vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of chitin binding peritrophin- vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold241_size241811:127894..128447+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold241_size241811-snap-gene-1.14 ID=maker-scaffold241_size241811-snap-gene-1.14|Name=chitin binding peritrophin-|organism=Tigriopus kingsejongensis|type=gene|length=554bp|location=Sequence derived from alignment at scaffold241_size241811:127894..128447+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'chitin binding peritrophin-' has the following synonyms
Add to Basket
|