carbamoyl phosphate synthase large subunit, maker-scaffold292_size219010-snap-gene-1.39 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of carbamoyl phosphate synthase large subunit vs. nr
Match: gi|1325326302|ref|XP_023344998.1| (transmembrane protein 223-like isoform X1 [Eurytemora affinis] >gi|1325326304|ref|XP_023345000.1| transmembrane protein 223-like isoform X2 [Eurytemora affinis]) HSP 1 Score: 133.65 bits (335), Expect = 8.876e-36 Identity = 74/214 (34.58%), Postives = 119/214 (55.61%), Query Frame = 0 Query: 12 WVGGTTGLSRLWLRRNYEYAYKPKEKNRLRENLEVLARKDLTLFYFENPKRMTLFTGMAALMTPMWLYLGYFTYTLPTQLDPYRDRLSNENRKPAWVLNNIDKASRGVALGFSLFGLILSAYWLSRSRHT----------------------------------CGAVHQNYQGKQRTYIRVKDYYFKFQLNVENGTFVNRPLFDRTVGIARRV 191 W T L L L+++ +KPK+K + +E + KD+TLF +E+ K++ L + M P+W YLGYF +TL ++L+P+R+ ++N N + ++L+N+ KAS GV GF LFG L++YW+ R+ +T C + + GK R +++V+D+ FK+ N+E+G F NRPLFDRTVGI+R + Sbjct: 3 WNCVTKPLFGLTLKQSVRRYFKPKQKEAFFD-VEGVVNKDITLFRYEDLKKVRLKNMLGMSMLPLWAYLGYFAFTLRSKLEPFREEVNN-NVRYNFLLDNVTKASVGVGAGFFLFGAGLTSYWMLRTMNTVRKLVLRKGGKYVGIQTYGLLGKNDGFMNVPVVHCSGIQHKFYGKHRFFLKVRDHSFKYSFNLEDGIFSNRPLFDRTVGISRTI 214 The following BLAST results are available for this feature:
BLAST of carbamoyl phosphate synthase large subunit vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of carbamoyl phosphate synthase large subunit vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of carbamoyl phosphate synthase large subunit vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold292_size219010:124935..127192- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold292_size219010-snap-gene-1.39 ID=maker-scaffold292_size219010-snap-gene-1.39|Name=carbamoyl phosphate synthase large subunit|organism=Tigriopus kingsejongensis|type=gene|length=2258bp|location=Sequence derived from alignment at scaffold292_size219010:124935..127192- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'carbamoyl phosphate synthase large subunit' has the following synonyms
Add to Basket
|