chitin synthase, maker-scaffold84_size396325-snap-gene-2.42 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of chitin synthase vs. nr
Match: gi|1160524469|gb|AQZ26762.1| (chitin synthase 2-1 [Tigriopus japonicus]) HSP 1 Score: 94.3597 bits (233), Expect = 3.373e-20 Identity = 50/107 (46.73%), Postives = 72/107 (67.29%), Query Frame = 0 Query: 1 LDLEMQFKRRLSSIQLDNPNNHIARRLSMRRETVDLFERRKSVSFLGQERRGSAMMERRMSQMSSMDMSLDPGVVNEGMESDDSFSDGVYASNSGSLNFETIHDEDE 107 LDL+ KRRLS+++ ++P + RRLS+ +E +FERRKS + R +M+ERR S++ MS+DPG+VN GM +DD +SDG Y SN S++FETI ED+ Sbjct: 1493 LDLQADIKRRLSAVEFNDP---VMRRLSVSKEAASVFERRKSFATEQALIRRQSMVERRNSKLR---MSMDPGIVNGGMVNDDDYSDGTYGSNP-SVHFETIPYEDD 1592 The following BLAST results are available for this feature:
BLAST of chitin synthase vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of chitin synthase vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of chitin synthase vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold84_size396325:345826..346389+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold84_size396325-snap-gene-2.42 ID=maker-scaffold84_size396325-snap-gene-2.42|Name=chitin synthase|organism=Tigriopus kingsejongensis|type=gene|length=564bp|location=Sequence derived from alignment at scaffold84_size396325:345826..346389+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'chitin synthase' has the following synonyms
Add to Basket
|