hypothetical protein DAPPUDRAFT_215551, snap_masked-scaffold1912_size25034-processed-gene-0.4 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. L. salmonis genes
Match: EMLSAG00000001138 (supercontig:LSalAtl2s:LSalAtl2s118:399399:402184:1 gene:EMLSAG00000001138 transcript:EMLSAT00000001138 description:"maker-LSalAtl2s118-augustus-gene-4.15") HSP 1 Score: 66.6254 bits (161), Expect = 9.489e-15 Identity = 38/64 (59.38%), Postives = 43/64 (67.19%), Query Frame = 0 Query: 59 AVVNQVLDELGLQLNQDLAGMAVPNGSLAVATPGGKQAVPSGAVGGATDADADLQARLDDLRRE 122 A+V+QVLDELGLQLN L VP G +A PG K+ + A GG DADADLQ RLD LRRE Sbjct: 162 AIVSQVLDELGLQLNDQLKD--VPAGXSTLAAPGAKEK-KAVAAGGVEDADADLQERLDALRRE 222
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. SwissProt
Match: gi|73917738|sp|Q7ZW25.1|CHM2A_DANRE (RecName: Full=Charged multivesicular body protein 2a; AltName: Full=Chromatin-modifying protein 2a; Short=CHMP2a) HSP 1 Score: 52.7582 bits (125), Expect = 2.975e-8 Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = 0 Query: 51 EDDEEESDAVVNQVLDELGLQLNQDLAGMAVPNGSLAVATPGGKQAVPSGAVGGATDADADLQARLDDLRR 121 EDDEEESDAVV+QVLDELGL L+ +L+ + GSL+VA GK+A P + DADADL+ RL++LRR Sbjct: 154 EDDEEESDAVVSQVLDELGLTLSDELSNLPATGGSLSVA--AGKKAEPQPTLA---DADADLEERLNNLRR 219
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. SwissProt
Match: gi|75206464|sp|Q9SKI2.2|VPS2A_ARATH (RecName: Full=Vacuolar protein sorting-associated protein 2 homolog 1; Short=AtVPS2-1; AltName: Full=Charged multivesicular body protein 2 homolog 1; AltName: Full=ESCRT-III complex subunit VPS2 homolog 1; AltName: Full=SNF7-like protein) HSP 1 Score: 52.7582 bits (125), Expect = 3.390e-8 Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 0 Query: 60 VVNQVLDELGLQLNQDLAGMAVPNGSLAVATPGGKQAVPSGAVGGATDA---DADLQARLDDLRR 121 +V+QVLDE+G+ +NQ+L P+G AVA P K V GA D+ D+DLQARLD+LR+ Sbjct: 164 LVSQVLDEIGIDINQELVN--APSG--AVAVPAAKNKVVQAEATGAEDSGGIDSDLQARLDNLRK 224
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. nr
Match: gi|915272482|ref|XP_013302763.1| (SNF7 family protein [Necator americanus] >gi|568293385|gb|ETN80536.1| SNF7 family protein [Necator americanus]) HSP 1 Score: 73.559 bits (179), Expect = 1.799e-13 Identity = 43/78 (55.13%), Postives = 55/78 (70.51%), Query Frame = 0 Query: 45 DDAMGEEDDEEESDAVVNQVLDELGLQLNQDLAGMAVPNGSLAVATPGGKQAVPSGAVGGATDADADLQARLDDLRRE 122 DDA+G+E D+ ES+ +VNQVLDELG+Q+ Q++AG+ G + V + G K P A GGA D D DLQARLD LRRE Sbjct: 148 DDALGDETDDVESEQIVNQVLDELGIQMGQEMAGLPTAGGQIGV-SAGEKTRQPVAA-GGA-DIDDDLQARLDQLRRE 222
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. nr
Match: gi|512891995|ref|XP_004922821.1| (charged multivesicular body protein 2a [Bombyx mori]) HSP 1 Score: 72.7886 bits (177), Expect = 3.987e-13 Identity = 40/66 (60.61%), Postives = 48/66 (72.73%), Query Frame = 0 Query: 59 AVVNQVLDELGLQLNQDLAGMAVPNGSLAVA--TPGGKQAVPSGAVGGATDADADLQARLDDLRRE 122 AVV+Q+LDELGLQLN L+G+ GSL+VA TP AV GA +DADA+LQARLD+LRRE Sbjct: 163 AVVSQILDELGLQLNDTLSGLPQATGSLSVAAKTPASPTAVAGGAGAPVSDADAELQARLDNLRRE 228
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. nr
Match: gi|669223711|emb|CDW54979.1| (charged multivesicular body protein 2a [Trichuris trichiura]) HSP 1 Score: 72.4034 bits (176), Expect = 4.082e-13 Identity = 39/78 (50.00%), Postives = 56/78 (71.79%), Query Frame = 0 Query: 45 DDAMGEEDDEEESDAVVNQVLDELGLQLNQDLAGMAVPNGSLAVATPGGKQAVPSGAVGGATDADADLQARLDDLRRE 122 DDAM +E DEEE+DAVV+Q+LDELG+Q+N++L + S+A+A+ + P+ V D DADLQARL++LRR+ Sbjct: 148 DDAMADEGDEEETDAVVSQILDELGIQMNEELTRLPSTADSVALASSTKQ---PTAVV----DVDADLQARLENLRRQ 218
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. nr
Match: gi|685825678|emb|CEF60728.1| (Charged multivesicular body protein 2a [Strongyloides ratti]) HSP 1 Score: 71.633 bits (174), Expect = 1.106e-12 Identity = 40/77 (51.95%), Postives = 53/77 (68.83%), Query Frame = 0 Query: 45 DDAMGEEDDEEESDAVVNQVLDELGLQLNQDLAGMAVPNGSLAVATPGGKQAVPSGAVGGATDADADLQARLDDLRR 121 DD+MGE DD+EES+ +VNQ+LDELG+Q+ +L +P GS + G QA A G +DADADL ARL++LRR Sbjct: 149 DDSMGEADDQEESEGIVNQILDELGIQMGNELN--TLPEGSQGIT--AGAQANKPVAEGVMSDADADLAARLENLRR 221
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. nr
Match: gi|669330388|gb|KFD70564.1| (hypothetical protein M514_17357 [Trichuris suis] >gi|730376401|gb|KHJ47405.1| SNF7 family protein [Trichuris suis]) HSP 1 Score: 71.2478 bits (173), Expect = 1.179e-12 Identity = 38/78 (48.72%), Postives = 56/78 (71.79%), Query Frame = 0 Query: 45 DDAMGEEDDEEESDAVVNQVLDELGLQLNQDLAGMAVPNGSLAVATPGGKQAVPSGAVGGATDADADLQARLDDLRRE 122 DDAM +E DEEE+DAVV+Q+LDELG+Q+N++L + S+++A+ + P+ V D DADLQARL++LRR+ Sbjct: 148 DDAMADEGDEEETDAVVSQILDELGIQMNEELTRLPSTADSVSLASSTKQ---PTAVV----DVDADLQARLENLRRQ 218 The following BLAST results are available for this feature:
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 2
BLAST of hypothetical protein DAPPUDRAFT_215551 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold1912_size25034:13034..17578- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>snap_masked-scaffold1912_size25034-processed-gene-0.4 ID=snap_masked-scaffold1912_size25034-processed-gene-0.4|Name=hypothetical protein DAPPUDRAFT_215551|organism=Tigriopus kingsejongensis|type=gene|length=4545bp|location=Sequence derived from alignment at scaffold1912_size25034:13034..17578- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'hypothetical protein DAPPUDRAFT_215551' has the following synonyms
Add to Basket
|