maker-scaffold9_size846264-snap-gene-0.9-mRNA-1, maker-scaffold9_size846264-snap-gene-0.9-mRNA-1 (mRNA) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of Tk08377 >Tk08377 ID=Tk08377|Name=Tk08377|organism=Tigriopus kingsejongensis|type=polypeptide|length=106bp MDQVLVAKIISMVLLGGISFLLGLLAMVLYQRLSETSRVQRSIISCLLCFback to top mRNA from alignment at scaffold9_size846264:904..1371+ Legend: exonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold9_size846264-snap-gene-0.9-mRNA-1 ID=maker-scaffold9_size846264-snap-gene-0.9-mRNA-1|Name=maker-scaffold9_size846264-snap-gene-0.9-mRNA-1|organism=Tigriopus kingsejongensis|type=mRNA|length=468bp|location=Sequence derived from alignment at scaffold9_size846264:904..1371+ (Tigriopus kingsejongensis)back to top Add to Basket
|