|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR000618 | Insect cuticle protein | PRINTS | PR00947 | CUTICLE | coord: 65..76
score: 40.44
coord: 76..87
score: 38.93
coord: 37..48
score: 30.87 |
| IPR000618 | Insect cuticle protein | PFAM | PF00379 | Chitin_bind_4 | coord: 39..87
e-value: 9.8E-9
score: 35.5 |
| IPR000618 | Insect cuticle protein | PROSITE | PS51155 | CHIT_BIND_RR_2 | coord: 36..108
score: 14.023 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 101..122 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 108..122 |
| None | No IPR available | PANTHER | PTHR12236:SF67 | SUBFAMILY NOT NAMED | coord: 3..110 |
| None | No IPR available | PANTHER | PTHR12236 | STRUCTURAL CONTITUENT OF CUTICLE | coord: 3..110 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 17..122 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 13..16 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 4..12 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..16 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..3 |
| None | No IPR available | SIGNALP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM | coord: 1..16
score: 0.582 |
| None | No IPR available | SIGNALP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | coord: 1..25
score: 0.496 |
| None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..16
score: 0.901 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk01294 ID=Tk01294|Name=Tk01294|organism=Tigriopus kingsejongensis|type=polypeptide|length=122bp
MQTFFALLALAVVVLADNPPPPSYSPYKPEPKYEEPAKYEYAYAVQDEYK
QLDFNANEERDGYVTSGSYQVLLPDGRTQTVTYTVDGYAGYVADAQYEGE
AKYEPYQPKPAPRYPPPPPKYN back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR000618 | Insect_cuticle |
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0042302 | structural constituent of cuticle |
|
