|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | COILS | Coil | Coil | coord: 423..450 |
None | No IPR available | GENE3D | 4.10.400.10 | | coord: 40..76 e-value: 1.6E-10 score: 42.4 |
None | No IPR available | PANTHER | PTHR18945:SF750 | GLUTAMATE-GATED CHLORIDE CHANNEL | coord: 169..654 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 401..424 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 425..637 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 658..669 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 336..360 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 638..657 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..335 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 361..400 |
None | No IPR available | TMHMM | TMhelix | | coord: 338..360 |
None | No IPR available | TMHMM | TMhelix | | coord: 634..656 |
None | No IPR available | TMHMM | TMhelix | | coord: 401..423 |
None | No IPR available | TMHMM | TMhelix | | coord: 367..386 |
IPR006201 | Neurotransmitter-gated ion-channel | PRINTS | PR00252 | NRIONCHANNEL | coord: 330..342 score: 28.96 coord: 209..220 score: 47.78 coord: 255..269 score: 47.9 coord: 175..191 score: 35.75 |
IPR006201 | Neurotransmitter-gated ion-channel | TIGRFAM | TIGR00860 | TIGR00860 | coord: 169..450 e-value: 5.2E-115 score: 382.7 |
IPR006201 | Neurotransmitter-gated ion-channel | PANTHER | PTHR18945 | NEUROTRANSMITTER GATED ION CHANNEL | coord: 169..654 |
IPR006028 | Gamma-aminobutyric acid A receptor/Glycine receptor alpha | PRINTS | PR00253 | GABAARECEPTR | coord: 365..386 score: 55.95 coord: 635..655 score: 50.15 coord: 399..420 score: 53.54 coord: 339..359 score: 54.61 |
IPR002172 | Low-density lipoprotein (LDL) receptor class A repeat | SMART | SM00192 | LDLa_2 | coord: 43..81 e-value: 1.5E-7 score: 41.1 |
IPR002172 | Low-density lipoprotein (LDL) receptor class A repeat | PFAM | PF00057 | Ldl_recept_a | coord: 42..79 e-value: 1.5E-7 score: 31.4 |
IPR002172 | Low-density lipoprotein (LDL) receptor class A repeat | PROSITE | PS50068 | LDLRA_2 | coord: 43..80 score: 12.262 |
IPR002172 | Low-density lipoprotein (LDL) receptor class A repeat | CDD | cd00112 | LDLa | coord: 47..79 e-value: 4.62787E-10 score: 52.9794 |
IPR006202 | Neurotransmitter-gated ion-channel ligand-binding domain | PFAM | PF02931 | Neur_chan_LBD | coord: 169..335 e-value: 3.3E-37 score: 127.9 |
IPR006029 | Neurotransmitter-gated ion-channel transmembrane domain | PFAM | PF02932 | Neur_chan_memb | coord: 343..437 e-value: 1.3E-27 score: 97.3 |
IPR036734 | Neurotransmitter-gated ion-channel ligand-binding domain superfamily | GENE3D | 2.70.170.10 | | coord: 149..333 e-value: 7.7E-60 score: 203.7 |
IPR036734 | Neurotransmitter-gated ion-channel ligand-binding domain superfamily | SUPERFAMILY | 63712 | Nicotinic receptor ligand binding domain-like | coord: 89..149 |
IPR036734 | Neurotransmitter-gated ion-channel ligand-binding domain superfamily | SUPERFAMILY | 63712 | Nicotinic receptor ligand binding domain-like | coord: 169..335 |
IPR018000 | Neurotransmitter-gated ion-channel, conserved site | PROSITE | PS00236 | NEUROTR_ION_CHANNEL | coord: 255..269 |
IPR023415 | Low-density lipoprotein (LDL) receptor class A, conserved site | PROSITE | PS01209 | LDLRA_1 | coord: 57..79 |
IPR036719 | Neurotransmitter-gated ion-channel transmembrane domain superfamily | SUPERFAMILY | 90112 | Neurotransmitter-gated ion-channel transmembrane pore | coord: 596..657 coord: 338..474 |
IPR036055 | LDL receptor-like superfamily | SUPERFAMILY | 57424 | LDL receptor-like module | coord: 43..80 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk03729 ID=Tk03729|Name=Tk03729|organism=Tigriopus kingsejongensis|type=polypeptide|length=669bp MDPFAYAFHNTTQDYPLGKRSWYFVNESCLHNRFQIRRLKLTTCQAESQF TCDDGTCIDIGGRCDQKRDCQDYSDEFDCKLVALNQFHYIKDYAPQEKGG RKTEVNYHVEILSLDDIRELGMSLNLQFRLTLSWLDPRIIYHNLKACRTP LKSVSDLKASVEEHWAAMDVDYEYSVQVTFREQWNDERLRYYDESQGRLK YLTLTDPTKVWMPDTFFRNEKEARKHEIIVPNVYVRIFPNGEILYSIRIS LTLACPMDLRLYPLDKQVCVLQIASYGWAKDDLIYQWKEKDPVQVVPGLH LPRFTLEQYKSAYCDVITNTGEYSCLKVELIFKREFSYYLITIYVPCCML VIVSWVSFWLDQNAIPARVSLGVTTLLTMSTQTSGINAQLPPVSYTKAID VWTGVCQCFVFCALLEFALVNYASRSDMQRDRARERMERARRQWELENAD MEPSPPPTGTNGPTHVMGPPGNLLRGSIGGATTLSGANSHQGMNHIGSAV DIDGIPGFPLKKRGGHNFANALREMDGGEPYRGTTTYPHQNRSNEDLSYG GMNSGYNTTQPSSLSYMLPQDMGRTCEVHMNSYPTGSGPGHGGGFAAGMT GTSSLIGHTCTYLLCCGTRGLLSKFPSRAKRIDVISRFIFPLIFAIFNMA YWLYYLFAKSKSPQLEEDN back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
Term | Definition |
GO:0016021 | integral component of membrane |
Vocabulary: Molecular Function
Term | Definition |
GO:0004888 | transmembrane signaling receptor activity |
GO:0005216 | ion channel activity |
GO:0005515 | protein binding |
GO:0005230 | extracellular ligand-gated ion channel activity |
Vocabulary: Biological Process
Term | Definition |
GO:0034220 | ion transmembrane transport |
GO:0006811 | ion transport |
|