|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR020472 | G-protein beta WD-40 repeat | PRINTS | PR00320 | GPROTEINBRPT | coord: 455..469
score: 38.08
coord: 150..164
score: 44.33
coord: 242..256
score: 38.87 |
| IPR001680 | WD40 repeat | SMART | SM00320 | WD40_4 | coord: 208..255
e-value: 2.5E-5
score: 33.7
coord: 258..296
e-value: 3.8E-7
score: 39.8
coord: 478..517
e-value: 4.3E-8
score: 42.9
coord: 299..383
e-value: 0.82
score: 17.5
coord: 166..205
e-value: 1.2E-7
score: 41.5
coord: 124..163
e-value: 9.6E-11
score: 51.7
coord: 429..468
e-value: 7.3E-10
score: 48.8
coord: 387..426
e-value: 4.2E-9
score: 46.3 |
| IPR001680 | WD40 repeat | PFAM | PF00400 | WD40 | coord: 214..255
e-value: 1.6E-5
score: 25.4
coord: 171..205
e-value: 1.3E-4
score: 22.5
coord: 262..295
e-value: 2.3E-4
score: 21.8
coord: 485..516
e-value: 4.6E-7
score: 30.3
coord: 126..163
e-value: 2.1E-8
score: 34.6
coord: 430..467
e-value: 1.5E-7
score: 31.8
coord: 391..426
e-value: 9.3E-7
score: 29.4 |
| IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 216..264
score: 11.511 |
| IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 173..214
score: 12.213 |
| IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 485..518
score: 15.989 |
| IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 131..172
score: 16.925 |
| IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 394..435
score: 16.089 |
| IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 265..305
score: 11.544 |
| IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 436..467
score: 15.12 |
| IPR015943 | WD40/YVTN repeat-like-containing domain superfamily | GENE3D | 2.130.10.10 | | coord: 127..518
e-value: 2.3E-136
score: 456.7 |
| IPR012972 | NLE | PFAM | PF08154 | NLE | coord: 32..98
e-value: 2.2E-8
score: 34.4 |
| None | No IPR available | PANTHER | PTHR19848 | WD40 REPEAT PROTEIN | coord: 23..517 |
| None | No IPR available | CDD | cd00200 | WD40 | coord: 127..467
e-value: 2.54714E-79
score: 248.019 |
| IPR019775 | WD40 repeat, conserved site | PROSITE | PS00678 | WD_REPEATS_1 | coord: 242..256 |
| IPR019775 | WD40 repeat, conserved site | PROSITE | PS00678 | WD_REPEATS_1 | coord: 150..164 |
| IPR019775 | WD40 repeat, conserved site | PROSITE | PS00678 | WD_REPEATS_1 | coord: 413..427 |
| IPR017986 | WD40-repeat-containing domain | PROSITE | PS50294 | WD_REPEATS_REGION | coord: 131..518
score: 71.949 |
| IPR036322 | WD40-repeat-containing domain superfamily | SUPERFAMILY | 50978 | WD40 repeat-like | coord: 365..517
coord: 132..319 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk05939 ID=Tk05939|Name=Tk05939|organism=Tigriopus kingsejongensis|type=polypeptide|length=518bp
MPTRAVMSEAPTALGESAAHLEKRAKMDEEHVTVQFETETGQRPFPPMSV
PVGITTDKLQVLLQALLRAEDEDSEDADRPFAFYLQDREIQVDLAECMKW
MLINQERTVPVIFKPQSVFKVKPVTRCTSSMPGHTQPVVVALFSPDGRYL
ASGSGDNTVRLWDISTETPRFECKAHRQYVLALAWSPDGSKLASGDKLGH
VVIWDPDTGKPIGRMLSGHKQFITGLAWQPLHLTNQGECRLLASSSKDGD
VRIWDTITSKFVLSLTSHAQSVTCLRWGGTNLIYSASQDRTIKVWRAEDG
VLCRTLQGHGHWVNVLALNTDYAMRTGAFEPAQAQFVNNISILSGEEKKD
RALQRYNEALAKVKGGEELMVSGSDDFTMFLWNPSKEKQSLARMTGHQQL
VNDVKFSPDCRLIASASFDKAIRLWDGQTGKYLAVLRGHVQAVYQLAWSA
DSRLLVSGSADSTLKLWTAQVRGGYDKTKFLEVDLPGHGDEVYAVDWSPD
GQRVVSGGKDTLLRIWRK back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0005515 | protein binding |
|
