|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | COILS | Coil | Coil | coord: 41..61 |
None | No IPR available | PIRSF | PIRSF002394 | GNBP_B | coord: 31..380 e-value: 1.1E-149 score: 495.9 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 1..40 |
None | No IPR available | PANTHER | PTHR19850:SF36 | GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-5 | coord: 37..380 |
None | No IPR available | CDD | cd00200 | WD40 | coord: 85..380 e-value: 3.76036E-81 score: 248.019 |
IPR020472 | G-protein beta WD-40 repeat | PRINTS | PR00320 | GPROTEINBRPT | coord: 107..121 score: 39.84 coord: 239..253 score: 35.16 coord: 195..209 score: 38.84 |
IPR001632 | G-protein, beta subunit | PRINTS | PR00319 | GPROTEINB | coord: 88..104 score: 48.31 coord: 107..121 score: 77.37 coord: 126..141 score: 53.41 coord: 144..161 score: 64.48 |
IPR001680 | WD40 repeat | SMART | SM00320 | WD40_4 | coord: 169..208 e-value: 0.033 score: 23.3 coord: 341..380 e-value: 4.2E-7 score: 39.6 coord: 123..162 e-value: 0.19 score: 20.8 coord: 81..120 e-value: 9.7E-10 score: 48.4 coord: 211..252 e-value: 8.0E-7 score: 38.7 coord: 303..338 e-value: 0.49 score: 18.9 coord: 255..294 e-value: 8.8E-8 score: 41.9 |
IPR001680 | WD40 repeat | PFAM | PF00400 | WD40 | coord: 347..379 e-value: 3.2E-6 score: 27.7 coord: 212..252 e-value: 0.002 score: 18.8 coord: 85..120 e-value: 1.8E-6 score: 28.5 coord: 312..338 e-value: 0.14 score: 13.0 coord: 257..294 e-value: 2.1E-5 score: 25.1 |
IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 176..217 score: 10.943 |
IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 218..261 score: 11.945 |
IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 88..129 score: 13.583 |
IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 348..380 score: 14.92 |
IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 313..338 score: 8.938 |
IPR001680 | WD40 repeat | PROSITE | PS50082 | WD_REPEATS_2 | coord: 262..303 score: 13.316 |
IPR015943 | WD40/YVTN repeat-like-containing domain superfamily | GENE3D | 2.130.10.10 | | coord: 33..380 e-value: 5.5E-132 score: 441.7 |
IPR016346 | Guanine nucleotide-binding protein, beta subunit | PANTHER | PTHR19850 | GUANINE NUCLEOTIDE-BINDING PROTEIN BETA G PROTEIN BETA | coord: 37..380 |
IPR019775 | WD40 repeat, conserved site | PROSITE | PS00678 | WD_REPEATS_1 | coord: 107..121 |
IPR019775 | WD40 repeat, conserved site | PROSITE | PS00678 | WD_REPEATS_1 | coord: 195..209 |
IPR019775 | WD40 repeat, conserved site | PROSITE | PS00678 | WD_REPEATS_1 | coord: 325..339 |
IPR017986 | WD40-repeat-containing domain | PROSITE | PS50294 | WD_REPEATS_REGION | coord: 88..380 score: 56.579 |
IPR036322 | WD40-repeat-containing domain superfamily | SUPERFAMILY | 50978 | WD40 repeat-like | coord: 42..379 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk06171 ID=Tk06171|Name=Tk06171|organism=Tigriopus kingsejongensis|type=polypeptide|length=380bp MSSSAGAHGGGGGGGGGDHANANSGGGGGGGAQPPTEEPSIEDLQREIEH LKRKIAEERAKLCDKTTAQVADGLEPIQGLNIKVRRSLKGHNAKVLCLDW CSDKRHLVSSSQDGKLIVWDAFTTNKEHAVTMPTTWVMACAYGPSGNVVA CGGLDNKVTVYPLTLDEDVATKKKTVGTHTSYMSCCLFPGSDNQVLTGSG DATCALWDVESGQVLQSFHGHSADVMSVDLAPGPNPNTFVSGSCDKMAFV WDMRTGNYVQYFEGHESDINAVKFHPSGDAIGTGSDDATCRLFDLRADRE VAKYTKESILFGVNAIDFSTSGRILFAGYNDYAVNMWDTLKTHRIAMLYG HENRVSSLKCSPDGTAIATGSWDYSLKIWA back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term | Definition |
GO:0005515 | protein binding |
Vocabulary: Biological Process
Term | Definition |
GO:0007165 | signal transduction |
|