Tk08230, Tk08230 (polypeptide) Tigriopus kingsejongensis

Overview
NameTk08230
Unique NameTk08230
Typepolypeptide
OrganismTigriopus kingsejongensis (Tigriopus kingsejongensis)
Sequence length1808
Associated RNAi Experiments

Nothing found

InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 281..300
score: 29.42
coord: 239..255
score: 18.72
coord: 109..126
score: 35.22
coord: 189..200
score: 51.73
coord: 302..319
score: 28.29
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 109..256
e-value: 1.3E-21
score: 76.8
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 834..883
e-value: 7.9E-13
score: 58.6
coord: 1545..1601
e-value: 2.3E-11
score: 53.7
coord: 1220..1275
e-value: 4.3E-9
score: 46.2
coord: 1109..1160
e-value: 3.6E-9
score: 46.5
coord: 1380..1432
e-value: 3.4E-11
score: 53.2
coord: 995..1054
e-value: 4.6E-7
score: 39.5
coord: 1330..1378
e-value: 2.6E-11
score: 53.6
coord: 1277..1328
e-value: 9.3E-14
score: 61.7
coord: 511..606
e-value: 1.9E-4
score: 30.8
coord: 1718..1778
e-value: 3.9E-8
score: 43.0
coord: 1489..1543
e-value: 5.7E-9
score: 45.8
coord: 772..832
e-value: 1.8E-8
score: 44.1
coord: 941..993
e-value: 1.5E-9
score: 47.7
coord: 885..939
e-value: 1.2E-11
score: 54.7
coord: 1056..1107
e-value: 4.2E-13
score: 59.5
coord: 608..658
e-value: 6.8E-12
score: 55.5
coord: 1162..1218
e-value: 3.1E-9
score: 46.7
coord: 1434..1487
e-value: 2.4E-9
score: 47.1
coord: 715..770
e-value: 2.4E-9
score: 47.1
coord: 1660..1716
e-value: 4.5E-7
score: 39.5
coord: 1606..1655
e-value: 1.0E-7
score: 41.7
coord: 660..713
e-value: 9.9E-12
score: 55.0
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 1222..1274
e-value: 9.3E-7
score: 28.9
coord: 1382..1431
e-value: 3.3E-9
score: 36.7
coord: 717..768
e-value: 6.1E-5
score: 23.1
coord: 662..712
e-value: 9.7E-10
score: 38.4
coord: 512..538
e-value: 8.3E-6
score: 25.8
coord: 942..992
e-value: 3.1E-9
score: 36.8
coord: 887..938
e-value: 1.0E-6
score: 28.7
coord: 836..882
e-value: 5.2E-9
score: 36.1
coord: 1662..1715
e-value: 4.1E-9
score: 36.4
coord: 1607..1654
e-value: 3.3E-8
score: 33.5
coord: 1163..1217
e-value: 9.6E-6
score: 25.6
coord: 1111..1159
e-value: 8.7E-7
score: 29.0
coord: 773..831
e-value: 1.2E-6
score: 28.6
coord: 997..1053
e-value: 3.4E-7
score: 30.3
coord: 1491..1537
e-value: 4.8E-9
score: 36.2
coord: 1436..1486
e-value: 6.3E-6
score: 26.2
coord: 1332..1377
e-value: 1.0E-8
score: 35.1
coord: 1719..1777
e-value: 1.8E-6
score: 28.0
coord: 1546..1597
e-value: 1.1E-5
score: 25.5
coord: 609..657
e-value: 6.1E-12
score: 45.5
coord: 1057..1106
e-value: 9.0E-10
score: 38.5
coord: 1279..1327
e-value: 1.9E-11
score: 43.9
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 995..1052
score: 9.813
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1486..1543
score: 11.867
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1603..1655
score: 11.894
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1109..1158
score: 9.995
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 508..546
score: 9.039
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 657..713
score: 12.661
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1434..1484
score: 9.218
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1220..1273
score: 9.17
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1330..1376
score: 10.458
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 885..937
score: 10.406
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1545..1601
score: 9.647
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1715..1778
score: 12.881
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 715..767
score: 9.652
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 769..830
score: 11.297
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1377..1432
score: 12.649
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1657..1714
score: 11.149
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1053..1107
score: 13.923
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1159..1218
score: 12.538
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 831..883
score: 12.937
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 1274..1328
score: 13.725
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 938..993
score: 12.229
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 605..656
score: 11.613
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3D2.20.100.10coord: 1487..1539
e-value: 6.2E-12
score: 47.6
coord: 1544..1600
e-value: 2.6E-9
score: 39.1
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3D2.20.100.10coord: 994..1054
e-value: 6.2E-11
score: 44.6
coord: 884..939
e-value: 1.5E-11
score: 46.6
coord: 1108..1160
e-value: 1.0E-10
score: 43.9
coord: 1161..1218
e-value: 7.6E-11
score: 44.3
coord: 714..768
e-value: 6.2E-9
score: 38.2
coord: 1055..1107
e-value: 2.4E-13
score: 52.3
coord: 1276..1328
e-value: 9.4E-13
score: 50.4
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3D2.20.100.10coord: 1378..1431
e-value: 1.2E-11
score: 46.7
coord: 833..882
e-value: 5.7E-12
score: 47.8
coord: 1329..1377
e-value: 2.3E-9
score: 39.4
coord: 1432..1486
e-value: 3.0E-10
score: 42.3
coord: 1656..1715
e-value: 4.8E-11
score: 44.8
coord: 1716..1777
e-value: 1.5E-11
score: 46.4
coord: 1219..1274
e-value: 4.9E-11
score: 44.8
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3D2.20.100.10coord: 604..658
e-value: 3.7E-11
score: 45.0
coord: 940..993
e-value: 1.9E-10
score: 42.8
coord: 659..713
e-value: 2.4E-11
score: 45.7
coord: 769..832
e-value: 3.8E-11
score: 45.0
coord: 1603..1655
e-value: 7.5E-11
score: 44.0
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3D2.20.100.10coord: 492..554
e-value: 3.3E-7
score: 31.9
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 660..712
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 941..992
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1717..1777
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1377..1426
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1329..1377
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 607..657
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1600..1654
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 714..765
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1277..1327
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 510..539
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 995..1053
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1653..1715
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 769..827
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1161..1217
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1542..1595
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 833..882
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1108..1159
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 884..938
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1486..1535
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1431..1481
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1219..1274
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILY82895TSP-1 type 1 repeatcoord: 1055..1106
NoneNo IPR availableGENE3D3.40.50.720coord: 99..400
e-value: 8.3E-71
score: 240.4
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 660..766
coord: 1162..1275
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 1488..1600
coord: 1434..1537
coord: 1381..1486
coord: 834..939
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 1330..1432
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 1606..1715
coord: 996..1107
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 489..538
coord: 942..1054
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 1657..1778
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 1488..1600
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 1109..1218
coord: 773..883
coord: 1434..1537
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 1278..1378
coord: 1220..1328
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 1109..1218
coord: 773..883
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 660..766
coord: 884..993
coord: 1278..1378
coord: 1220..1328
coord: 1162..1275
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 489..538
coord: 996..1107
coord: 1545..1655
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 1606..1715
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 591..658
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 591..658
coord: 1657..1778
coord: 1330..1432
coord: 834..939
coord: 942..1054
NoneNo IPR availablePANTHERPTHR44043:SF3SUBFAMILY NOT NAMEDcoord: 1545..1655
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 884..993
NoneNo IPR availablePANTHERPTHR44043FAMILY NOT NAMEDcoord: 1381..1486
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 91..1808
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 71..90
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..70
NoneNo IPR availableCDDcd05327retinol-DH_like_SDR_c_likecoord: 107..385
e-value: 8.02807E-92
score: 296.828
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
IPR035940CAP superfamilySUPERFAMILY55797PR-1-likecoord: 400..482
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 105..379

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Tigriopus kinsejongensis Genome annotation2018-02-12
InterProScan T. kingsejongensis2018-08-30
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
snap_masked-scaffold591_size129331-processed-gene-0.4-mRNA-1snap_masked-scaffold591_size129331-processed-gene-0.4-mRNA-1Tigriopus kingsejongensismRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Tk08230 ID=Tk08230|Name=Tk08230|organism=Tigriopus kingsejongensis|type=polypeptide|length=1808bp
MANEIMQALEECNKFRPSQQRETLGPHPRPGRPFEAVSTDLFEYSCHTFM
FQAEGLEVLNRFQHLEAVESLNMLLAIGFGLLLVTAYFILKRHIQGPIFQ
SRKRLDGQTIAITGANTGIGLETGKDFYRRGGHVICLCRNVDKGKAAIQS
IKNQVKNDKNTGSIHLMPMDLSSMDSIRQAGETLLKEQTRLDILVLNAGV
MMSPMHPRTKDGFEMQMGTNHLGHYLFTRMLIPLLKKTAQDHGEARVVTL
ASMANEFANAPIRLHDLNWEKEEDFSPGQAYFHSKMANIMFSRELGKRLA
DTGVTTYSLHPGVIATELNRHASESSNILAYLFNFLCYNMASGLIKTPRH
GAQTTLYCSLAEGLKGQTGKYYMDCQERIPGKQAREDLYDRDFWELNEFS
NWQGTGQNVARDIAKGKAGQFDAHKLIGHWFNQILYFDSEGVKSFGCGWV
QFNYRGFEDYYENFLVCNYGPSANIWEQPVYDIAEETCNCPCIGCDKETG
LCPANCNYAVWSTWEEWAQCSQSCGGGVRNRERDCQESNFPPRETSSVAR
LIEAHGSLDLVPLFGNDSALNEVNTRQSALFGNLDPELCLRGDQEENGEC
NPGGCPELSEWSEWSDCTKTCESGERSRERTCDDQRNENNPCNARLTEME
TCNTQLCPLFNEWSEWSPCSATCGGGGQERERNCYDPNFRLKCDGEPRQS
RFVVRACNVDPCPSWTQWSAWSQCSASCGGGQNARSRECTLPDGAVRPNA
ECGEGESNETGNCNENVLCPVLGEWTEWSQCSVSCGGGDRSRTRTCGVPG
STQIASASTPASENPCQQPLFESEKCNDDRCPVYTPWSEWSQCSATCGGG
SQRRNRQCVPANSRLFCEGVSEEDRTCNESPCPNWTEWGEWSECSFTCGG
GTRQNTRQCELPNGEQVKGSQCGVGPATEEESCNTDQCPELGPWTEWGPC
TVTCGGGEKTRMRECGLPKLLRDDNPCQLPLLEKMECHPEECPTLTEWAD
WSQCSHTCGGGFRQKTRECVGPNANDVSSSSNGDENACMEPLEVIEACNE
DTCPVWSVWGEWTICSKTCGGGERTRYRQCTDPVTGQEAFCPGSNEESED
CNTQDCPYFTEWTEWTDCSLTCGSGTRSKVRECIVPRDGDANICNGETRT
QESCNETPCPVWSEWTDWGQCTATCGGGTEKRIRDCLLAAARNGNGTNFY
GCDGDTWEMRGCNEHNCPTWTEWTEFTDCSKTCGGGRRVKTRECNLPPNI
PAPALALFCPGDEKVIEDCNTGTCPKPTEWTEWGECSVSCGGGTRQKTRE
CVNFRDQDGNPCNENLVDEEPCNEQPCPAWTEWTEWTSCTKTCDKGRRKR
ARDCVLFTRSDCPGEDEELEDCNPEPCPALTPWGEWTQCTLTCGGGTQRR
VRDCLSPISGFDSNGCMEPLEEIMVCSADACPAFTEWSEWTECSADCGGG
TKTHVRECTQNGEEAAQDTCLGDALEQVPCNDDVECPRWTEWNTWGDCSV
TCGEGTRQRGRECTRPVETNGKLLCNGEDLEVGPCDPSVPQCPMWSDWSE
WSDCSDECGGGSRTHVRVCSAGNEVDANGKSPCGFGDFEESEACNADIKC
PELALWSEWSEWNACSQSCGGGMKERARQCGSSDGTTGCPGPSRGIMFCN
IDPCPTDADWAEWGEWSQCSVPCGGGDRSRRRDCSSSVSTGYGPQTSPEC
PGDELEHSKCNVQACSTWSEWTMWSTCSKTCGKGAQRRSRDCQHTNLPRG
NYPRLGLLASPCPGEPQQARSCILQECPLGRRIRRLIVEIAASTFSIGKN
PPHFGPVP
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR000884TSP1_rpt
IPR036383TSP1_rpt_sf
IPR035940CAP_sf
IPR036291NAD(P)-bd_dom_sf
Add to Basket