|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | PRINTS | PR00449 | RASTRNSFRMNG | coord: 4..25
score: 49.32
coord: 106..119
score: 37.93
coord: 154..176
score: 29.37
coord: 44..66
score: 41.87
coord: 27..43
score: 30.16 |
| None | No IPR available | SMART | SM00174 | rho_sub_3 | coord: 6..179
e-value: 4.3E-127
score: 438.2 |
| None | No IPR available | SMART | SM00175 | rab_sub_5 | coord: 4..179
e-value: 5.4E-13
score: 52.5 |
| None | No IPR available | SMART | SM00173 | ras_sub_4 | coord: 1..179
e-value: 1.5E-17
score: 74.4 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 1..182
e-value: 1.2E-71
score: 241.6 |
| None | No IPR available | PANTHER | PTHR24072:SF129 | CDC42L PROTEIN | coord: 2..191 |
| None | No IPR available | PANTHER | PTHR24072 | RHO FAMILY GTPASE | coord: 2..191 |
| IPR005225 | Small GTP-binding protein domain | TIGRFAM | TIGR00231 | TIGR00231 | coord: 1..157
e-value: 4.5E-43
score: 144.8 |
| IPR001806 | Small GTPase superfamily | PFAM | PF00071 | Ras | coord: 5..175
e-value: 1.0E-52
score: 177.9 |
| IPR003578 | Small GTPase superfamily, Rho type | PROSITE | PS51420 | RHO | coord: 1..176
score: 27.044 |
| IPR037874 | Cdc42 | CDD | cd01874 | Cdc42 | coord: 3..177
e-value: 6.33589E-134
score: 369.973 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 3..173 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk10650 ID=Tk10650|Name=Tk10650|organism=Tigriopus kingsejongensis|type=polypeptide|length=191bp
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEP
YTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPE
ISHHCQKTPFLLVGTQIDLRDDAATIEKLAKNKQKPLSNEVGEKLSKELK
AVKYVECSALTQKGLKNVFDEAILAALEPPEPPRKRRCCLL back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
| Term | Definition |
|---|
| GO:0005622 | intracellular |
Vocabulary: Biological Process
| Term | Definition |
|---|
| GO:0007264 | small GTPase mediated signal transduction |
|
