|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR000276 | G protein-coupled receptor, rhodopsin-like | PRINTS | PR00237 | GPCRRHODOPSN | coord: 57..79 score: 31.41 coord: 11..32 score: 23.47 |
IPR000276 | G protein-coupled receptor, rhodopsin-like | PFAM | PF00001 | 7tm_1 | coord: 2..123 e-value: 1.1E-10 score: 41.1 |
IPR000276 | G protein-coupled receptor, rhodopsin-like | PROSITE | PS00237 | G_PROTEIN_RECEP_F1_1 | coord: 63..79 |
None | No IPR available | GENE3D | 1.20.1070.10 | | coord: 1..128 e-value: 4.4E-18 score: 67.2 |
None | No IPR available | PANTHER | PTHR22751 | G-PROTEIN COUPLED RECEPTOR-RELATED | coord: 2..121 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 120..128 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 12..31 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 99..119 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 79..98 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 51..78 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 32..50 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..11 |
None | No IPR available | SUPERFAMILY | 81321 | Family A G protein-coupled receptor-like | coord: 2..119 |
None | No IPR available | TMHMM | TMhelix | | coord: 94..116 |
None | No IPR available | TMHMM | TMhelix | | coord: 51..73 |
None | No IPR available | TMHMM | TMhelix | | coord: 9..31 |
IPR017452 | GPCR, rhodopsin-like, 7TM | PROSITE | PS50262 | G_PROTEIN_RECEP_F1_2 | coord: 1..128 score: 14.313 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk11111 ID=Tk11111|Name=Tk11111|organism=Tigriopus kingsejongensis|type=polypeptide|length=128bp LLTRKDLRNSFNLLLVALAFFDSCYIVGAVLETLRTSFDLASDLHLMLFP YLLYPGQNIAMTVSIFLIVAIAFERYVAVRNPIDYKQAMNDASTIRLRLI KYLIPVIVFSVLFNVPKFFESTFAKRTR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
Term | Definition |
GO:0016021 | integral component of membrane |
Vocabulary: Molecular Function
Term | Definition |
GO:0004930 | G-protein coupled receptor activity |
Vocabulary: Biological Process
Term | Definition |
GO:0007186 | G-protein coupled receptor signaling pathway |
|