|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR001388 | Synaptobrevin | PRINTS | PR00219 | SYNAPTOBREVN | coord: 71..90 score: 35.81 coord: 35..54 score: 40.81 coord: 15..34 score: 55.14 |
IPR001388 | Synaptobrevin | PFAM | PF00957 | Synaptobrevin | coord: 8..94 e-value: 1.3E-30 score: 104.9 |
IPR001388 | Synaptobrevin | PROSITE | PS50892 | V_SNARE | coord: 10..70 score: 16.726 |
None | No IPR available | GENE3D | 1.20.5.110 | | coord: 1..95 e-value: 2.8E-35 score: 122.6 |
None | No IPR available | PANTHER | PTHR21136:SF78 | VESICLE-ASSOCIATED MEMBRANE PROTEIN 3 | coord: 6..92 |
None | No IPR available | PANTHER | PTHR21136 | SNARE PROTEINS | coord: 6..92 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 74..94 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..73 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 95..96 |
None | No IPR available | CDD | cd15870 | R-SNARE_VAMP2 | coord: 10..71 e-value: 3.38147E-28 score: 94.7597 |
None | No IPR available | SUPERFAMILY | 58038 | SNARE fusion complex | coord: 7..72 |
None | No IPR available | TMHMM | TMhelix | | coord: 76..95 |
IPR016444 | Synaptobrevin/Vesicle-associated membrane protein | PIRSF | PIRSF005409 | VAMP-5_synaptobrevin | coord: 1..95 e-value: 1.6E-31 score: 106.4 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk12536 ID=Tk12536|Name=Tk12536|organism=Tigriopus kingsejongensis|type=polypeptide|length=96bp MATQSGDSNRLEETRRQVDEVQNIMKANVDKVLERDGKLGQLEERADRLQ EGTEQFHRSAVRIKRKQFWENMKMKIIIGVVISVIVLAILIWLFSG back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
Term | Definition |
GO:0016192 | vesicle-mediated transport |
Vocabulary: Cellular Component
Term | Definition |
GO:0016021 | integral component of membrane |
|