EMLSAG00000000376, EMLSAG00000000376-683142 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592933879|gb|GAXK01024674.1| (TSA: Calanus finmarchicus comp6686493_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 2.555e+0 Identity = 10/21 (47.62%), Postives = 12/21 (57.14%), Query Frame = 0 Query: 8 GCLYSRKKCNSAWRIEQELTR 28 GC Y CN +R E+EL R Sbjct: 171 GCAYYCDPCNETFRYEEELKR 233
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592852217|gb|GAXK01105327.1| (TSA: Calanus finmarchicus comp185866_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 4.924e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 2 LLAMYYGCLYSRKKCNSAWRIEQELTR 28 LL + GCL + +KC ++W Q L R Sbjct: 457 LLVLPTGCLKANQKC*NSWIQSQHLPR 537
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592765275|gb|GAXK01189293.1| (TSA: Calanus finmarchicus comp857185_c0_seq6 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 5.775e+0 Identity = 9/26 (34.62%), Postives = 15/26 (57.69%), Query Frame = 0 Query: 1 MLLAMYYGCLYSRKKCNSAWRIEQEL 26 M L + +G L++ CN+ WR+ L Sbjct: 489 MQLMVNFGILFNNVNCNTNWRVSTGL 566
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592765276|gb|GAXK01189292.1| (TSA: Calanus finmarchicus comp857185_c0_seq5 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 6.180e+0 Identity = 9/26 (34.62%), Postives = 15/26 (57.69%), Query Frame = 0 Query: 1 MLLAMYYGCLYSRKKCNSAWRIEQEL 26 M L + +G L++ CN+ WR+ L Sbjct: 489 MQLMVNFGILFNNVNCNTNWRVSTGL 566
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592887786|gb|GAXK01070589.1| (TSA: Calanus finmarchicus comp215363_c5_seq13 transcribed RNA sequence) HSP 1 Score: 25.0238 bits (53), Expect = 6.366e+0 Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 0 Query: 3 LAMYYGCLYSRKKCNSAWRIEQ 24 + Y+GC YS + CN W Q Sbjct: 234 VPWYFGCRYSCQICNKVWHYPQ 299
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592887787|gb|GAXK01070588.1| (TSA: Calanus finmarchicus comp215363_c5_seq12 transcribed RNA sequence) HSP 1 Score: 25.0238 bits (53), Expect = 6.366e+0 Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 0 Query: 3 LAMYYGCLYSRKKCNSAWRIEQ 24 + Y+GC YS + CN W Q Sbjct: 234 VPWYFGCRYSCQICNKVWHYPQ 299
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592887785|gb|GAXK01070590.1| (TSA: Calanus finmarchicus comp215363_c5_seq14 transcribed RNA sequence) HSP 1 Score: 25.0238 bits (53), Expect = 6.627e+0 Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 0 Query: 3 LAMYYGCLYSRKKCNSAWRIEQ 24 + Y+GC YS + CN W Q Sbjct: 235 VPWYFGCRYSCQICNKVWHYPQ 300
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592887800|gb|GAXK01070575.1| (TSA: Calanus finmarchicus comp215363_c3_seq11 transcribed RNA sequence) HSP 1 Score: 25.0238 bits (53), Expect = 6.627e+0 Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 0 Query: 3 LAMYYGCLYSRKKCNSAWRIEQ 24 + Y+GC YS + CN W Q Sbjct: 31 VPWYFGCRYSCQICNKVWHYPQ 96
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592887790|gb|GAXK01070585.1| (TSA: Calanus finmarchicus comp215363_c5_seq9 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 7.257e+0 Identity = 9/19 (47.37%), Postives = 11/19 (57.89%), Query Frame = 0 Query: 6 YYGCLYSRKKCNSAWRIEQ 24 Y+GC YS + CN W Q Sbjct: 462 YFGCRYSCQICNKVWHYPQ 518
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Match: gi|592887791|gb|GAXK01070584.1| (TSA: Calanus finmarchicus comp215363_c5_seq8 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 7.327e+0 Identity = 9/19 (47.37%), Postives = 11/19 (57.89%), Query Frame = 0 Query: 6 YYGCLYSRKKCNSAWRIEQ 24 Y+GC YS + CN W Q Sbjct: 486 YFGCRYSCQICNKVWHYPQ 542
BLAST of EMLSAG00000000376 vs. L. salmonis peptides
Match: EMLSAP00000000376 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1057:99555:102319:-1 gene:EMLSAG00000000376 transcript:EMLSAT00000000376 description:"maker-LSalAtl2s1057-augustus-gene-1.5") HSP 1 Score: 73.1738 bits (178), Expect = 1.764e-19 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MLLAMYYGCLYSRKKCNSAWRIEQELTRMNIRLKK 35 MLLAMYYGCLYSRKKCNSAWRIEQELTRMNIRLKK Sbjct: 1 MLLAMYYGCLYSRKKCNSAWRIEQELTRMNIRLKK 35 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000376 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000376 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 12
Pagesback to top
BLAST of EMLSAG00000000376 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000376 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000376 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000376 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000376 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1057:99555..102319- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000376-683142 ID=EMLSAG00000000376-683142|Name=EMLSAG00000000376|organism=Lepeophtheirus salmonis|type=gene|length=2765bp|location=Sequence derived from alignment at LSalAtl2s1057:99555..102319- (Lepeophtheirus salmonis)back to top Add to Basket
|