EMLSAG00000007971, EMLSAG00000007971-690737 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000007971 vs. C. finmarchicus
Match: gi|592954775|gb|GAXK01003778.1| (TSA: Calanus finmarchicus comp454941_c0_seq1 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 6.712e-2 Identity = 17/47 (36.17%), Postives = 25/47 (53.19%), Query Frame = 0 Query: 8 PMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMD 54 P + R K++ +G Y +K + N RSR FGDL+ H +V D Sbjct: 955 PHRAWFVARACLKVQAEG-YEEKDRINNKRSRAFGDLVDHYSDVTAD 1092
BLAST of EMLSAG00000007971 vs. C. finmarchicus
Match: gi|592918504|gb|GAXK01039871.1| (TSA: Calanus finmarchicus comp272829_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.9574 bits (71), Expect = 1.276e-1 Identity = 17/45 (37.78%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 7 PPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENV 51 PP + LI+RT K + S+ +LP+G R F DL HK+++ Sbjct: 963 PPAIVRLILRTCLKHKKQPDLSE--NLPDGSVRSFQDLKMHKQDI 1091
BLAST of EMLSAG00000007971 vs. C. finmarchicus
Match: gi|592868989|gb|GAXK01088573.1| (TSA: Calanus finmarchicus comp870722_c1_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.792e+0 Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 0 Query: 35 NGRSRRFGDLMSHKENVLMD 54 N R + FGDL+ ENVLMD Sbjct: 249 NKREQNFGDLIEILENVLMD 308
BLAST of EMLSAG00000007971 vs. C. finmarchicus
Match: gi|592929655|gb|GAXK01028890.1| (TSA: Calanus finmarchicus comp626703_c1_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.836e+0 Identity = 15/35 (42.86%), Postives = 20/35 (57.14%), Query Frame = 0 Query: 18 LCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVL 52 LC L+ DGG+S +V L +G R + KE VL Sbjct: 124 LCLLQPDGGHSLQVGLSHGSYRFSFSCIWEKEEVL 228
BLAST of EMLSAG00000007971 vs. C. finmarchicus
Match: gi|592881350|gb|GAXK01076551.1| (TSA: Calanus finmarchicus comp99291_c1_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.064e+0 Identity = 14/31 (45.16%), Postives = 19/31 (61.29%), Query Frame = 0 Query: 28 SKKVSLPNGRSRRFGDLMSHKENV-LMDPQL 57 SKK L G+ R DLM++K+ + LM QL Sbjct: 1356 SKKTGLEEGKKREQSDLMANKKEIALMKRQL 1448
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000007971 (pep:novel supercontig:LSalAtl2s:LSalAtl2s4712:3549:3825:1 gene:EMLSAG00000007971 transcript:EMLSAT00000007971 description:"maker-LSalAtl2s4712-snap-gene-0.4") HSP 1 Score: 134.035 bits (336), Expect = 1.891e-42 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRYN 65 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRYN Sbjct: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRYN 65
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000000651 (pep:novel supercontig:LSalAtl2s:LSalAtl2s11005:51:981:-1 gene:EMLSAG00000000651 transcript:EMLSAT00000000651 description:"maker-LSalAtl2s11005-snap-gene-0.1") HSP 1 Score: 111.309 bits (277), Expect = 2.338e-31 Identity = 52/64 (81.25%), Postives = 58/64 (90.62%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRY 64 MLD KEP + LLLIIRTLCKLRYDGGYSKKVSLPNG SRRFGDLMSHKENVLMDP+L+ +F+ + Sbjct: 73 MLDSKEPQITLLLIIRTLCKLRYDGGYSKKVSLPNGXSRRFGDLMSHKENVLMDPRLHKMFFVF 136
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000012244 (pep:novel supercontig:LSalAtl2s:LSalAtl2s8920:373:1847:1 gene:EMLSAG00000012244 transcript:EMLSAT00000012244 description:"maker-LSalAtl2s8920-snap-gene-0.2") HSP 1 Score: 109.383 bits (272), Expect = 2.283e-30 Identity = 51/64 (79.69%), Postives = 59/64 (92.19%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRY 64 +LD++EP + LLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDP+L +F+ + Sbjct: 73 ILDLQEPHITLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPKLNKMFFVF 136
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000001452 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1247:333673:334478:1 gene:EMLSAG00000001452 transcript:EMLSAT00000001452 description:"augustus_masked-LSalAtl2s1247-processed-gene-2.4") HSP 1 Score: 102.449 bits (254), Expect = 1.352e-28 Identity = 47/64 (73.44%), Postives = 56/64 (87.50%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRY 64 MLD+KEPPMDLL I+RTLCKL+YDGGYSK+VSLPNGRSR+F DL+SHKEN+LM+P+ F Y Sbjct: 73 MLDLKEPPMDLLFIVRTLCKLKYDGGYSKEVSLPNGRSRKFIDLVSHKENILMNPEHKKRFLTY 136
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000001454 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1247:336907:338618:1 gene:EMLSAG00000001454 transcript:EMLSAT00000001454 description:"augustus_masked-LSalAtl2s1247-processed-gene-2.0") HSP 1 Score: 98.5969 bits (244), Expect = 1.000e-26 Identity = 47/71 (66.20%), Postives = 58/71 (81.69%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQ--------LYTIFYR 63 MLD+KEPPMDLL I+RTLCKL+YDGGYSK+V LPNGRSR+F DL+SHKE++LM+P+ L TI Y+ Sbjct: 73 MLDLKEPPMDLLFIVRTLCKLKYDGGYSKEVYLPNGRSRKFIDLVSHKEDILMNPEHKKRLLTYLATIIYK 143
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000008836 (pep:novel supercontig:LSalAtl2s:LSalAtl2s5500:3079:4247:-1 gene:EMLSAG00000008836 transcript:EMLSAT00000008836 description:"maker-LSalAtl2s5500-snap-gene-0.4") HSP 1 Score: 81.2629 bits (199), Expect = 2.237e-20 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 0 Query: 2 LDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRY 64 LD K PP +LL I+R LCKL+Y+GGYSK+VS+PNG RRF D+ K+N+L+DP+ F+ Y Sbjct: 74 LDSKXPPQNLLFIVRILCKLKYNGGYSKEVSMPNGVYRRFDDVAYFKDNILLDPEWKNTFFEY 136
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000002794 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1613:87683:89928:-1 gene:EMLSAG00000002794 transcript:EMLSAT00000002794 description:"snap_masked-LSalAtl2s1613-processed-gene-0.6") HSP 1 Score: 65.4698 bits (158), Expect = 1.387e-14 Identity = 34/54 (62.96%), Postives = 40/54 (74.07%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMD 54 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKK + N + G + E+ ++D Sbjct: 73 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKGIIKN----KLGGALEINESEVLD 122
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Match: EMLSAP00000003104 (pep:novel supercontig:LSalAtl2s:LSalAtl2s174:364234:370462:-1 gene:EMLSAG00000003104 transcript:EMLSAT00000003104 description:"maker-LSalAtl2s174-augustus-gene-3.18") HSP 1 Score: 47.3654 bits (111), Expect = 8.350e-8 Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 0 Query: 31 VSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRY 64 ++LPNGRSRRF DL+SHK+N+LMD F+ Y Sbjct: 589 LTLPNGRSRRFVDLISHKDNILMDSARKDAFFTY 622
BLAST of EMLSAG00000007971 vs. nr
Match: gi|290562039|gb|ADD38416.1| (SET and MYND domain-containing protein 3 [Lepeophtheirus salmonis]) HSP 1 Score: 127.872 bits (320), Expect = 1.151e-34 Identity = 61/64 (95.31%), Postives = 62/64 (96.88%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRY 64 MLDIKEP MDLLLIIRTLCKLRYDGGYSKKVSLPNG SRRFGDLMSHKENVLMDPQLYT+FYRY Sbjct: 73 MLDIKEPHMDLLLIIRTLCKLRYDGGYSKKVSLPNGCSRRFGDLMSHKENVLMDPQLYTMFYRY 136
BLAST of EMLSAG00000007971 vs. nr
Match: gi|225711848|gb|ACO11770.1| (SET and MYND domain-containing protein 3 [Lepeophtheirus salmonis]) HSP 1 Score: 103.99 bits (258), Expect = 7.368e-25 Identity = 47/64 (73.44%), Postives = 56/64 (87.50%), Query Frame = 0 Query: 1 MLDIKEPPMDLLLIIRTLCKLRYDGGYSKKVSLPNGRSRRFGDLMSHKENVLMDPQLYTIFYRY 64 MLD+KEPP+DLL I+RTLCKL+YDGGYSK+VSLPNGRSR+F DLMSHKEN+LM+P+ F Y Sbjct: 73 MLDLKEPPLDLLFIVRTLCKLKYDGGYSKEVSLPNGRSRKFIDLMSHKENILMNPEHKKRFLTY 136 The following BLAST results are available for this feature:
BLAST of EMLSAG00000007971 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000007971 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 5
BLAST of EMLSAG00000007971 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 8
BLAST of EMLSAG00000007971 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000007971 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000007971 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 2
BLAST of EMLSAG00000007971 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s4712:3549..3825+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000007971-690737 ID=EMLSAG00000007971-690737|Name=EMLSAG00000007971|organism=Lepeophtheirus salmonis|type=gene|length=277bp|location=Sequence derived from alignment at LSalAtl2s4712:3549..3825+ (Lepeophtheirus salmonis)back to top Add to Basket
|