Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..18 score: 0.902 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000000147 ID=EMLSAP00000000147|Name=EMLSAP00000000147|organism=Lepeophtheirus salmonis|type=polypeptide|length=110bp MKLLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHGFWSQPRTERQARSK GYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRG ISNDLSSQPY back to top
|