hypothetical protein DAPPUDRAFT_261119, maker-scaffold1435_size41353-snap-gene-0.12 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of hypothetical protein DAPPUDRAFT_261119 vs. L. salmonis genes
Match: EMLSAG00000002862 (supercontig:LSalAtl2s:LSalAtl2s16595:2:760:1 gene:EMLSAG00000002862 transcript:EMLSAT00000002862 description:"augustus-LSalAtl2s16595-processed-gene-0.0") HSP 1 Score: 48.521 bits (114), Expect = 2.823e-7 Identity = 24/47 (51.06%), Postives = 32/47 (68.09%), Query Frame = 0 Query: 20 GQKVWVQDPISKRWTKCAKI-VEMRNRRYLLRLLSSRFLWKNRKFIR 65 G KVW+QDP SK W + A + + ++R YLL L S R L +NR+FIR Sbjct: 203 GSKVWIQDPTSKIWDRXATVQGKKQDREYLLLLPSGRTLCRNRRFIR 249
BLAST of hypothetical protein DAPPUDRAFT_261119 vs. L. salmonis genes
Match: EMLSAG00000001303 (supercontig:LSalAtl2s:LSalAtl2s1217:105115:118735:1 gene:EMLSAG00000001303 transcript:EMLSAT00000001303 description:"snap_masked-LSalAtl2s1217-processed-gene-1.8") HSP 1 Score: 47.3654 bits (111), Expect = 4.724e-7 Identity = 25/79 (31.65%), Postives = 41/79 (51.90%), Query Frame = 0 Query: 113 MRDLLQIRQDEGQDYTSLCNDLRELANYADA---------------AMANEDDRAKVTEKSVSTFEEARLYILELETSR 176 M+DLL I Q E QDY LC+ + E ++++ M NE DR K+ + + +FE+ R +I++L +R Sbjct: 1 MKDLLSIPQSESQDYRDLCHKITERGDFSNTENITKDRRHICVFIKTMKNESDRRKLITEDLKSFEDPRKFIMKLGRAR 79 The following BLAST results are available for this feature:
BLAST of hypothetical protein DAPPUDRAFT_261119 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 2
BLAST of hypothetical protein DAPPUDRAFT_261119 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of hypothetical protein DAPPUDRAFT_261119 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold1435_size41353:15213..16839- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold1435_size41353-snap-gene-0.12 ID=maker-scaffold1435_size41353-snap-gene-0.12|Name=hypothetical protein DAPPUDRAFT_261119|organism=Tigriopus kingsejongensis|type=gene|length=1627bp|location=Sequence derived from alignment at scaffold1435_size41353:15213..16839- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'hypothetical protein DAPPUDRAFT_261119' has the following synonyms
Add to Basket
|