hypothetical protein L798_04682, maker-scaffold125_size330479-snap-gene-0.12 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of hypothetical protein L798_04682 vs. L. salmonis genes
Match: EMLSAG00000011640 (supercontig:LSalAtl2s:LSalAtl2s809:40312:97371:-1 gene:EMLSAG00000011640 transcript:EMLSAT00000011640 description:"maker-LSalAtl2s809-snap-gene-0.11") HSP 1 Score: 98.5969 bits (244), Expect = 4.715e-27 Identity = 47/66 (71.21%), Postives = 56/66 (84.85%), Query Frame = 0 Query: 1 MRIISALDHGETTTLTVEREGRFDVSVHKILSEDLLKPETVFGCLVTIPGTSYSVKEETMYFPGQV 66 M+ A GETTTLTVER+G FD+SVHKIL E+ LKPETVFGC+++IP TSY+VKEETMYFPG+V Sbjct: 135 MQSHRANQRGETTTLTVERDGLFDISVHKILLEEKLKPETVFGCILSIPDTSYTVKEETMYFPGKV 200
BLAST of hypothetical protein L798_04682 vs. L. salmonis genes
Match: EMLSAG00000000652 (supercontig:LSalAtl2s:LSalAtl2s1100:82576:119003:-1 gene:EMLSAG00000000652 transcript:EMLSAT00000000652 description:"maker-LSalAtl2s1100-snap-gene-1.7") HSP 1 Score: 53.9138 bits (128), Expect = 3.253e-10 Identity = 20/48 (41.67%), Postives = 35/48 (72.92%), Query Frame = 0 Query: 15 LTVEREGRFDVSVHKILSEDLLKPETVFGCLVTIPGTSYSVKEETMYF 62 +T+E EG +D+ VH+++ + +T FGC++TIPG Y V+EE++Y+ Sbjct: 117 VTLEDEGHYDIIVHRLVDHSDIPSKTTFGCILTIPGIDYEVREESVYY 164
BLAST of hypothetical protein L798_04682 vs. nr
Match: gi|1325320057|ref|XP_023341819.1| (uncharacterized protein LOC111711657 [Eurytemora affinis]) HSP 1 Score: 63.5438 bits (153), Expect = 1.619e-9 Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 11 ETTTLTVEREGRFDVSVHKILSEDLLKPETVFGCLVTIPGTSYSVKEETMYFPGQV 66 E T TV R +DV+VH++L L PETVF C + IP T +S++EETMYFPG++ Sbjct: 182 EVTKTTVRRGLEYDVTVHRLLPPTDLPPETVFSCSMEIPSTQFSLREETMYFPGRI 237 The following BLAST results are available for this feature:
BLAST of hypothetical protein L798_04682 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 2
BLAST of hypothetical protein L798_04682 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of hypothetical protein L798_04682 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold125_size330479:45733..48382+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold125_size330479-snap-gene-0.12 ID=maker-scaffold125_size330479-snap-gene-0.12|Name=hypothetical protein L798_04682|organism=Tigriopus kingsejongensis|type=gene|length=2650bp|location=Sequence derived from alignment at scaffold125_size330479:45733..48382+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'hypothetical protein L798_04682' has the following synonyms
Add to Basket
|