|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR000504 | RNA recognition motif domain | SMART | SM00360 | rrm1_1 | coord: 17..82
e-value: 2.8E-8
score: 43.5 |
| IPR000504 | RNA recognition motif domain | PFAM | PF00076 | RRM_1 | coord: 20..80
e-value: 8.7E-11
score: 41.4 |
| IPR000504 | RNA recognition motif domain | PROSITE | PS50102 | RRM | coord: 20..86
score: 11.111 |
| IPR012677 | Nucleotide-binding alpha-beta plait domain superfamily | GENE3D | 3.30.70.330 | | coord: 18..85
e-value: 2.3E-15
score: 58.3 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 66..101 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 66..162 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 135..162 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 115..132 |
| None | No IPR available | PANTHER | PTHR44862 | FAMILY NOT NAMED | coord: 23..160 |
| IPR035979 | RNA-binding domain superfamily | SUPERFAMILY | 54928 | RNA-binding domain, RBD | coord: 20..113 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk01099 ID=Tk01099|Name=Tk01099|organism=Tigriopus kingsejongensis|type=polypeptide|length=162bp
LKKCARPGGFCLASGGSGLIPSHLDRQDLKDYFRPCGEITYTNAHKPRMG
EGIVEFGDRKGMENALDRLDNTELDGRRLRLSQEKRKDRSRSRSDSRSRS
RSRSRSRSRSRSRSASRSRTPASRSRSRSRSPPANGAAERERSRSRSRSR
SRSPSRPKEDEN back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0003676 | nucleic acid binding |
|
