EMLSAG00000001831, EMLSAG00000001831-684597 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001831 vs. GO
Match: - (symbol:iPLA2-VIA "calcium-independent phospholipase A2 VIA" species:7227 "Drosophila melanogaster" [GO:0005829 "cytosol" evidence=ISS] [GO:0047499 "calcium-independent phospholipase A2 activity" evidence=ISS] [GO:0006629 "lipid metabolic process" evidence=IEA] InterPro:IPR002110 InterPro:IPR002641 InterPro:IPR016035 Pfam:PF01734 PROSITE:PS50088 SMART:SM00248 GO:GO:0004623 EMBL:AE014296 Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796 SUPFAM:SSF48403 PROSITE:PS50297 GO:GO:0006629 SUPFAM:SSF52151 GeneTree:ENSGT00530000063645 KO:K16343 OrthoDB:EOG76T9QK RefSeq:NP_729565.2 RefSeq:NP_729566.2 RefSeq:NP_729567.2 UniGene:Dm.11227 SMR:Q7KUD4 EnsemblMetazoa:FBtr0076363 EnsemblMetazoa:FBtr0076364 EnsemblMetazoa:FBtr0076365 GeneID:39160 KEGG:dme:Dmel_CG6718 UCSC:CG6718-RB CTD:39160 FlyBase:FBgn0036053 InParanoid:Q7KUD4 OMA:LVPIVQC GenomeRNAi:39160 NextBio:812257 PRO:PR:Q7KUD4 Uniprot:Q7KUD4) HSP 1 Score: 50.0618 bits (118), Expect = 7.510e-7 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCADYN 52 LN+ NS+G+TPLH+ACL DKPE VKALL A N Sbjct: 222 LNHLNSDGYTPLHVACLADKPENVKALLLAGAN 254
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592805048|gb|GAXK01149520.1| (TSA: Calanus finmarchicus comp97791_c0_seq6 transcribed RNA sequence) HSP 1 Score: 54.299 bits (129), Expect = 1.097e-8 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 18 PLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPT-------PPLHCTL 62 PLLN CN EG+TPLH+AC DKP+ VKA+LCA + T PLH L Sbjct: 1754 PLLNQCNKEGNTPLHLACQADKPDIVKAMLCAGADVNTLGSVEQELPLHTAL 1909
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592805049|gb|GAXK01149519.1| (TSA: Calanus finmarchicus comp97791_c0_seq5 transcribed RNA sequence) HSP 1 Score: 54.299 bits (129), Expect = 1.099e-8 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 18 PLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPT-------PPLHCTL 62 PLLN CN EG+TPLH+AC DKP+ VKA+LCA + T PLH L Sbjct: 1754 PLLNQCNKEGNTPLHLACQADKPDIVKAMLCAGADVNTLGSVEQELPLHTAL 1909
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592805050|gb|GAXK01149518.1| (TSA: Calanus finmarchicus comp97791_c0_seq4 transcribed RNA sequence) HSP 1 Score: 54.299 bits (129), Expect = 1.099e-8 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 18 PLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPT-------PPLHCTL 62 PLLN CN EG+TPLH+AC DKP+ VKA+LCA + T PLH L Sbjct: 1754 PLLNQCNKEGNTPLHLACQADKPDIVKAMLCAGADVNTLGSVEQELPLHTAL 1909
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592805051|gb|GAXK01149517.1| (TSA: Calanus finmarchicus comp97791_c0_seq3 transcribed RNA sequence) HSP 1 Score: 54.299 bits (129), Expect = 1.112e-8 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 18 PLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPT-------PPLHCTL 62 PLLN CN EG+TPLH+AC DKP+ VKA+LCA + T PLH L Sbjct: 1926 PLLNQCNKEGNTPLHLACQADKPDIVKAMLCAGADVNTLGSVEQELPLHTAL 2081
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592805052|gb|GAXK01149516.1| (TSA: Calanus finmarchicus comp97791_c0_seq2 transcribed RNA sequence) HSP 1 Score: 54.299 bits (129), Expect = 1.113e-8 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 18 PLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPT-------PPLHCTL 62 PLLN CN EG+TPLH+AC DKP+ VKA+LCA + T PLH L Sbjct: 1926 PLLNQCNKEGNTPLHLACQADKPDIVKAMLCAGADVNTLGSVEQELPLHTAL 2081
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592805053|gb|GAXK01149515.1| (TSA: Calanus finmarchicus comp97791_c0_seq1 transcribed RNA sequence) HSP 1 Score: 54.299 bits (129), Expect = 1.114e-8 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 18 PLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPT-------PPLHCTL 62 PLLN CN EG+TPLH+AC DKP+ VKA+LCA + T PLH L Sbjct: 1926 PLLNQCNKEGNTPLHLACQADKPDIVKAMLCAGADVNTLGSVEQELPLHTAL 2081
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592931132|gb|GAXK01027421.1| (TSA: Calanus finmarchicus comp340349_c0_seq1 transcribed RNA sequence) HSP 1 Score: 37.3502 bits (85), Expect = 3.500e-3 Identity = 15/28 (53.57%), Postives = 21/28 (75.00%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALL 47 +N ++EG+TPLH AC D+P V+ALL Sbjct: 628 VNVSDTEGYTPLHYACQADRPYSVRALL 711
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592873098|gb|GAXK01084464.1| (TSA: Calanus finmarchicus comp7511558_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 3.962e-2 Identity = 19/52 (36.54%), Postives = 28/52 (53.85%), Query Frame = 0 Query: 2 NDQYINGTLVEDSNT----KPLLNNCNSEGHTPLHIACLKDKPECVKALLCA 49 N + L EDSN+ K +N +++G+ PLH+AC + C K LL A Sbjct: 289 NVDVVEELLQEDSNSDKSLKFFVNRASADGNFPLHVACDRGNAVCAKLLLKA 444 HSP 2 Score: 28.1054 bits (61), Expect = 2.802e+0 Identity = 17/46 (36.96%), Postives = 24/46 (52.17%), Query Frame = 0 Query: 1 MNDQYINGTLVEDSNTKPLLNNCNSEGHTPLHIACLKDKPECVKAL 46 +N+ I TLV+ + + NS+G TPLH+AC E V L Sbjct: 1 INNSRIFKTLVDKGAST---SAANSDGDTPLHVACGMGLTEFVDTL 129
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592813319|gb|GAXK01141249.1| (TSA: Calanus finmarchicus comp4016249_c0_seq1 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 4.584e-2 Identity = 16/39 (41.03%), Postives = 24/39 (61.54%), Query Frame = 0 Query: 9 TLVEDSNTKPLLNNCNSEGHTPLHIACLKDKPECVKALL 47 L+E+ N P ++ + + +TPLHIA + EC KALL Sbjct: 22 VLIEEYNATPDSSSGSKDANTPLHIAAQEGWLECCKALL 138
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Match: gi|592842685|gb|GAXK01114859.1| (TSA: Calanus finmarchicus comp748719_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 5.491e-2 Identity = 14/28 (50.00%), Postives = 18/28 (64.29%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALL 47 L+ + +G TPLH AC KD ECVK + Sbjct: 286 LDVLDGDGWTPLHFACHKDNAECVKLFV 369
BLAST of EMLSAG00000001831 vs. L. salmonis peptides
Match: EMLSAP00000001831 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1314:59240:61374:-1 gene:EMLSAG00000001831 transcript:EMLSAT00000001831 description:"snap-LSalAtl2s1314-processed-gene-0.84") HSP 1 Score: 170.629 bits (431), Expect = 3.347e-56 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0 Query: 1 MNDQYINGTLVEDSNTKPLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPTPPLHCTLNVLLAISYKYLLLISLKKNDLSR 85 MNDQYINGTLVEDSNTKPLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPTPPLHCTLNVLLAISYKYLLLISLKKNDLSR Sbjct: 1 MNDQYINGTLVEDSNTKPLLNNCNSEGHTPLHIACLKDKPECVKALLCADYNPPTPPLHCTLNVLLAISYKYLLLISLKKNDLSR 85
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Match: EAA13225.3 (AGAP004812-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 53.1434 bits (126), Expect = 6.860e-9 Identity = 22/30 (73.33%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCA 49 LN+CN++G+TPLH+ACL DKP+CVKALL A Sbjct: 223 LNHCNTDGYTPLHLACLADKPDCVKALLLA 252
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Match: XP_016771782.1 (PREDICTED: 85/88 kDa calcium-independent phospholipase A2 [Apis mellifera]) HSP 1 Score: 51.6026 bits (122), Expect = 2.205e-8 Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALL--CADYNPPT 55 LN+ NS GHTP+H+ACL +KPECVKALL AD N P Sbjct: 215 LNSRNSNGHTPMHVACLNNKPECVKALLLIGADVNIPA 252
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Match: XP_006565723.1 (PREDICTED: 85/88 kDa calcium-independent phospholipase A2 [Apis mellifera]) HSP 1 Score: 51.6026 bits (122), Expect = 2.205e-8 Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALL--CADYNPPT 55 LN+ NS GHTP+H+ACL +KPECVKALL AD N P Sbjct: 215 LNSRNSNGHTPMHVACLNNKPECVKALLLIGADVNIPA 252
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Match: AAF50194.3 (calcium-independent phospholipase A2 VIA, isoform A [Drosophila melanogaster]) HSP 1 Score: 50.0618 bits (118), Expect = 7.582e-8 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCADYN 52 LN+ NS+G+TPLH+ACL DKPE VKALL A N Sbjct: 212 LNHLNSDGYTPLHVACLADKPENVKALLLAGAN 244
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Match: AAN11938.2 (calcium-independent phospholipase A2 VIA, isoform D [Drosophila melanogaster]) HSP 1 Score: 50.0618 bits (118), Expect = 7.586e-8 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCADYN 52 LN+ NS+G+TPLH+ACL DKPE VKALL A N Sbjct: 222 LNHLNSDGYTPLHVACLADKPENVKALLLAGAN 254
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Match: AAN11937.2 (calcium-independent phospholipase A2 VIA, isoform C [Drosophila melanogaster]) HSP 1 Score: 50.0618 bits (118), Expect = 7.586e-8 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCADYN 52 LN+ NS+G+TPLH+ACL DKPE VKALL A N Sbjct: 222 LNHLNSDGYTPLHVACLADKPENVKALLLAGAN 254
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Match: AAN11936.2 (calcium-independent phospholipase A2 VIA, isoform B [Drosophila melanogaster]) HSP 1 Score: 50.0618 bits (118), Expect = 7.586e-8 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCADYN 52 LN+ NS+G+TPLH+ACL DKPE VKALL A N Sbjct: 222 LNHLNSDGYTPLHVACLADKPENVKALLLAGAN 254
BLAST of EMLSAG00000001831 vs. nr
Match: gi|1131312048|gb|JAV06384.1| (hypothetical protein [Nyssomyia neivai]) HSP 1 Score: 55.0694 bits (131), Expect = 5.835e-7 Identity = 23/30 (76.67%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCA 49 +N+CNS+G+TPLH+ACL DKPECVKALL A Sbjct: 211 MNHCNSDGYTPLHLACLADKPECVKALLLA 240
BLAST of EMLSAG00000001831 vs. nr
Match: gi|1131322785|gb|JAV11751.1| (putative 85/88 kda calcium-independent phospholipase a2 isoform x1, partial [Nyssomyia neivai]) HSP 1 Score: 54.6842 bits (130), Expect = 7.199e-7 Identity = 23/30 (76.67%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 20 LNNCNSEGHTPLHIACLKDKPECVKALLCA 49 +N+CNS+G+TPLH+ACL DKPECVKALL A Sbjct: 208 MNHCNSDGYTPLHLACLADKPECVKALLLA 237
BLAST of EMLSAG00000001831 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1346_size46090-snap-gene-0.11 (protein:Tk10769 transcript:maker-scaffold1346_size46090-snap-gene-0.11-mRNA-1 annotation:"85 88 kda calcium-independent phospholipase a2") HSP 1 Score: 52.373 bits (124), Expect = 8.056e-10 Identity = 25/45 (55.56%), Postives = 32/45 (71.11%), Query Frame = 0 Query: 7 NGTLVEDSNTKP--LLNNCNSEGHTPLHIACLKDKPECVKALLCA 49 N +++ +P LLN CN +G TPLHIAC DKP+CV+ALLCA Sbjct: 173 NADVIDAIGGEPNHLLNECNVDGDTPLHIACKNDKPDCVQALLCA 217 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001831 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 1
BLAST of EMLSAG00000001831 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001831 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001831 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001831 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 7
BLAST of EMLSAG00000001831 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 2
BLAST of EMLSAG00000001831 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1314:59240..61374- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001831-684597 ID=EMLSAG00000001831-684597|Name=EMLSAG00000001831|organism=Lepeophtheirus salmonis|type=gene|length=2135bp|location=Sequence derived from alignment at LSalAtl2s1314:59240..61374- (Lepeophtheirus salmonis)back to top Add to Basket
|