EMLSAG00000002916, EMLSAG00000002916-685682 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000002916 vs. C. finmarchicus
Match: gi|592759828|gb|GAXK01194585.1| (TSA: Calanus finmarchicus comp8362633_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.0314 bits (66), Expect = 1.657e+0 Identity = 14/31 (45.16%), Postives = 18/31 (58.06%), Query Frame = 0 Query: 85 SVPPSAPTISFSCETPFLGMKQCVNFDLALL 115 +VP S P I+ CET LGMK + + LL Sbjct: 70 TVPESCPKIALKCETGMLGMKWRIWTEKILL 162
BLAST of EMLSAG00000002916 vs. C. finmarchicus
Match: gi|592874449|gb|GAXK01083113.1| (TSA: Calanus finmarchicus comp389685_c1_seq2 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.421e+0 Identity = 17/40 (42.50%), Postives = 22/40 (55.00%), Query Frame = 0 Query: 70 TLSATSTVLSALRSSSVPPSAPTISFSCETPFLGMKQCVN 109 ++SA S +LSA+ +S VPP PT S T QC N Sbjct: 548 SMSAPSQILSAIVNSEVPPRTPTPLRSELTELEAELQCCN 667
BLAST of EMLSAG00000002916 vs. C. finmarchicus
Match: gi|592874450|gb|GAXK01083112.1| (TSA: Calanus finmarchicus comp389685_c1_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.503e+0 Identity = 17/40 (42.50%), Postives = 22/40 (55.00%), Query Frame = 0 Query: 70 TLSATSTVLSALRSSSVPPSAPTISFSCETPFLGMKQCVN 109 ++SA S +LSA+ +S VPP PT S T QC N Sbjct: 1441 SMSAPSQILSAIVNSEVPPRTPTPLRSELTELEAELQCCN 1560
BLAST of EMLSAG00000002916 vs. C. finmarchicus
Match: gi|592949463|gb|GAXK01009090.1| (TSA: Calanus finmarchicus comp1412537_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 6.260e+0 Identity = 12/35 (34.29%), Postives = 22/35 (62.86%), Query Frame = 0 Query: 132 KSRICSNHFSQACYERDISNELLGQSSRFCSRKNL 166 K +CS++ S CY+R + +++ Q+S F + NL Sbjct: 308 KHAMCSSYHSLWCYQRATTEDIIWQASSFIEKCNL 412
BLAST of EMLSAG00000002916 vs. C. finmarchicus
Match: gi|592896237|gb|GAXK01062138.1| (TSA: Calanus finmarchicus comp3490036_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 8.001e+0 Identity = 16/42 (38.10%), Postives = 20/42 (47.62%), Query Frame = 0 Query: 109 NFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDIS 150 NF LALL ++ CK+ + S H ACY DIS Sbjct: 11 NFTLALLHQFLNICKKSN----TNSLNLEFHIFPACYTNDIS 124
BLAST of EMLSAG00000002916 vs. C. finmarchicus
Match: gi|592896238|gb|GAXK01062137.1| (TSA: Calanus finmarchicus comp3490036_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 9.226e+0 Identity = 16/42 (38.10%), Postives = 20/42 (47.62%), Query Frame = 0 Query: 109 NFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDIS 150 NF LALL ++ CK+ + S H ACY DIS Sbjct: 11 NFTLALLHQFLNICKKSN----TNSLNLEFHIFPACYTNDIS 124
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Match: EMLSAP00000002916 (pep:novel supercontig:LSalAtl2s:LSalAtl2s167:96112:98024:1 gene:EMLSAG00000002916 transcript:EMLSAT00000002916 description:"snap-LSalAtl2s167-processed-gene-1.50") HSP 1 Score: 343.199 bits (879), Expect = 1.356e-121 Identity = 166/166 (100.00%), Postives = 166/166 (100.00%), Query Frame = 0 Query: 1 MMQKETENQQQSNFKNVLEKLARISCDKGVGGKGYKQLHLLRLKHGKVINVFISTRISSVFCIYFCDPITLSATSTVLSALRSSSVPPSAPTISFSCETPFLGMKQCVNFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSRFCSRKNL 166 MMQKETENQQQSNFKNVLEKLARISCDKGVGGKGYKQLHLLRLKHGKVINVFISTRISSVFCIYFCDPITLSATSTVLSALRSSSVPPSAPTISFSCETPFLGMKQCVNFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSRFCSRKNL Sbjct: 1 MMQKETENQQQSNFKNVLEKLARISCDKGVGGKGYKQLHLLRLKHGKVINVFISTRISSVFCIYFCDPITLSATSTVLSALRSSSVPPSAPTISFSCETPFLGMKQCVNFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSRFCSRKNL 166
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Match: EMLSAP00000005942 (pep:novel supercontig:LSalAtl2s:LSalAtl2s3212:29478:31623:1 gene:EMLSAG00000005942 transcript:EMLSAT00000005942 description:"maker-LSalAtl2s3212-augustus-gene-0.2") HSP 1 Score: 84.7297 bits (208), Expect = 2.012e-20 Identity = 42/69 (60.87%), Postives = 46/69 (66.67%), Query Frame = 0 Query: 96 SCETPFLGMKQCVNFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSRFCSRK 164 SC +P D ALL+NWVK CKRKD +PK SRICSNHFSQ CYERD+ NELLG SR RK Sbjct: 75 SCPSPADTSYHNFPKDPALLQNWVKACKRKDNFNPKTSRICSNHFSQDCYERDLRNELLGLVSRKLLRK 143
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Match: EMLSAP00000003902 (pep:novel supercontig:LSalAtl2s:LSalAtl2s210:661286:663673:-1 gene:EMLSAG00000003902 transcript:EMLSAT00000003902 description:"snap-LSalAtl2s210-processed-gene-5.82") HSP 1 Score: 80.1073 bits (196), Expect = 4.839e-19 Identity = 37/57 (64.91%), Postives = 40/57 (70.18%), Query Frame = 0 Query: 96 SCETPFLGMKQCVNFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNE 152 SC +P D ALLRNWVK CKRKDK +PKKSRIC NHFSQ CYERD+ NE Sbjct: 28 SCPSPADTSYHNFPKDSALLRNWVKACKRKDKFNPKKSRICXNHFSQDCYERDLRNE 84
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Match: EMLSAP00000004012 (pep:novel supercontig:LSalAtl2s:LSalAtl2s214:185584:187441:1 gene:EMLSAG00000004012 transcript:EMLSAT00000004012 description:"maker-LSalAtl2s214-snap-gene-2.56") HSP 1 Score: 71.633 bits (174), Expect = 9.681e-16 Identity = 33/49 (67.35%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 111 DLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSR 159 D LLRNWVK C+R KL+PK SRICSNHFSQ CY+ D S +LLG SR Sbjct: 101 DPTLLRNWVKACRRGYKLNPKTSRICSNHFSQDCYQSDFSFKLLGIVSR 149
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Match: EMLSAP00000008926 (pep:novel supercontig:LSalAtl2s:LSalAtl2s555:158054:228428:1 gene:EMLSAG00000008926 transcript:EMLSAT00000008926 description:"maker-LSalAtl2s555-augustus-gene-1.35") HSP 1 Score: 49.2914 bits (116), Expect = 1.026e-7 Identity = 28/98 (28.57%), Postives = 43/98 (43.88%), Query Frame = 0 Query: 71 LSATSTVLSALRSSSVPPSAPTIS---------FSCETPFLGMKQCVNFDLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSR 159 L +V AL PP + I F C++P + ++ R W CKRKD + +++CS HF+ Y RD+ +ELL + R Sbjct: 122 LGGVESVAIALSGKVEPPESNLIRKNRHKICAIFGCKSPDGVIYHNFPKNMVRQRIWKNLCKRKDTFKAENAQVCSMHFNDGSYRRDLEHELLNLTPR 219
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Match: EMLSAP00000003578 (pep:novel supercontig:LSalAtl2s:LSalAtl2s19698:24:447:-1 gene:EMLSAG00000003578 transcript:EMLSAT00000003578 description:"maker-LSalAtl2s19698-snap-gene-0.3") HSP 1 Score: 46.2098 bits (108), Expect = 1.540e-7 Identity = 20/38 (52.63%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 118 WVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLG 155 WV++C R DK++PK +RIC +HF + + RD+ NELLG Sbjct: 70 WVQSCGR-DKVNPKTARICGSHFLKDDFLRDLKNELLG 106
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Match: EMLSAP00000007000 (pep:novel supercontig:LSalAtl2s:LSalAtl2s397:1189083:1189928:1 gene:EMLSAG00000007000 transcript:EMLSAT00000007000 description:"augustus-LSalAtl2s397-processed-gene-12.7") HSP 1 Score: 47.3654 bits (111), Expect = 3.172e-7 Identity = 21/38 (55.26%), Postives = 25/38 (65.79%), Query Frame = 0 Query: 118 WVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLG 155 W + C RK +L K RIC NHF + YERD+ NELLG Sbjct: 36 WERACHRKGRLG-KTPRICENHFEENNYERDLRNELLG 72
BLAST of EMLSAG00000002916 vs. Select Arthropod Genomes
Match: gb|KFM65710.1| (hypothetical protein X975_24424, partial [Stegodyphus mimosarum]) HSP 1 Score: 51.6026 bits (122), Expect = 2.477e-8 Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 0 Query: 116 RNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSR 159 + W+ C R DK +P S ICS+HF +ERD+ NELLG S R Sbjct: 3 KKWITLCHRADKFNPNTSYICSDHFLVTDFERDMRNELLGLSVR 46
BLAST of EMLSAG00000002916 vs. Select Arthropod Genomes
Match: gb|EFA11760.1| (Transposable element P transposase-like Protein [Tribolium castaneum]) HSP 1 Score: 54.299 bits (129), Expect = 2.773e-8 Identity = 22/47 (46.81%), Postives = 31/47 (65.96%), Query Frame = 0 Query: 113 ALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLGQSSR 159 + + WV+ C+R DK +PK S+ICS H+ YERD+ +ELLG R Sbjct: 95 TIFQEWVRRCRRGDKWNPKTSQICSEHYRVNDYERDLQHELLGSPLR 141
BLAST of EMLSAG00000002916 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold745_size103310-snap-gene-0.15 (protein:Tk02581 transcript:maker-scaffold745_size103310-snap-gene-0.15-mRNA-1 annotation:"hypothetical protein L798_13354") HSP 1 Score: 49.2914 bits (116), Expect = 8.936e-8 Identity = 18/45 (40.00%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 111 DLALLRNWVKTCKRKDKLDPKKSRICSNHFSQACYERDISNELLG 155 D L++ W+ +C+ + + + +R+C NHF+ C+ERD+ NELLG Sbjct: 61 DPLLIQEWLLSCQWDVRFNIETARVCGNHFAPECFERDLRNELLG 105 The following BLAST results are available for this feature:
BLAST of EMLSAG00000002916 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000002916 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000002916 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 7
BLAST of EMLSAG00000002916 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000002916 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 2
BLAST of EMLSAG00000002916 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000002916 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s167:96112..98024+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000002916-685682 ID=EMLSAG00000002916-685682|Name=EMLSAG00000002916|organism=Lepeophtheirus salmonis|type=gene|length=1913bp|location=Sequence derived from alignment at LSalAtl2s167:96112..98024+ (Lepeophtheirus salmonis)back to top Add to Basket
|