EMLSAG00000003903, EMLSAG00000003903-686669 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003903 vs. GO
Match: - (symbol:si:ch73-382f3.1 "si:ch73-382f3.1" species:7955 "Danio rerio" [GO:0003676 "nucleic acid binding" evidence=IEA] InterPro:IPR006612 Pfam:PF05485 PROSITE:PS50950 SMART:SM00692 SMART:SM00980 ZFIN:ZDB-GENE-030131-9513 GO:GO:0003676 TreeFam:TF330127 EMBL:CU571172 Ensembl:ENSDART00000134976 GeneTree:ENSGT00510000053848 OMA:KQLFRFP OrthoDB:EOG7SN8BV Bgee:E9QCV3 InterPro:IPR021896 Pfam:PF12017 Uniprot:E9QCV3) HSP 1 Score: 44.669 bits (104), Expect = 2.053e-5 Identity = 18/37 (48.65%), Postives = 27/37 (72.97%), Query Frame = 0 Query: 24 RCPKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFNDS 60 R PK+PV +++W+VNCR +D+ T SR+C HF +S Sbjct: 21 RFPKDPVRMRKWLVNCR-RDFVPTPCSRLCQDHFEES 56
BLAST of EMLSAG00000003903 vs. GO
Match: - (symbol:zgc:163143 "zgc:163143" species:7955 "Danio rerio" [GO:0003676 "nucleic acid binding" evidence=IEA] [GO:0008150 "biological_process" evidence=ND] [GO:0005575 "cellular_component" evidence=ND] InterPro:IPR006612 InterPro:IPR012337 Pfam:PF05485 PROSITE:PS50950 SMART:SM00692 SMART:SM00980 ZFIN:ZDB-GENE-070410-143 GO:GO:0003676 SUPFAM:SSF53098 GeneTree:ENSGT00740000115568 TreeFam:TF330127 EMBL:CR339049 EMBL:CR387987 Ensembl:ENSDART00000113036 OMA:FFHGDYC OrthoDB:EOG7FXZZQ Bgee:F1QD19 Uniprot:F1QD19) HSP 1 Score: 43.1282 bits (100), Expect = 9.666e-5 Identity = 16/33 (48.48%), Postives = 23/33 (69.70%), Query Frame = 0 Query: 27 KNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFND 59 K+P LLK+W+ N RW+DWK S++C HF + Sbjct: 27 KDPSLLKKWLKNLRWKDWKPNPNSKICSAHFEE 59
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Match: gi|592813348|gb|GAXK01141220.1| (TSA: Calanus finmarchicus comp5778707_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 8.040e-1 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 40 RWQDWKQTKWSRVCFKHFNDSDIIKHKVKGTLVS 73 R D + +S +C KHFN D+I H +VS Sbjct: 312 RVPDKNRETYSLICEKHFNPEDVIDHGDGRRIVS 413
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Match: gi|592908801|gb|GAXK01049574.1| (TSA: Calanus finmarchicus comp5869326_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.809e+0 Identity = 8/16 (50.00%), Postives = 15/16 (93.75%), Query Frame = 0 Query: 26 PKNPVLLKRWIVNCRW 41 P+ PV+L++W+V+CR+ Sbjct: 318 PEMPVVLEKWLVHCRY 365
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Match: gi|592829252|gb|GAXK01128292.1| (TSA: Calanus finmarchicus comp405836_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.604e+0 Identity = 13/22 (59.09%), Postives = 13/22 (59.09%), Query Frame = 0 Query: 53 CFKHFNDSDIIKHKVKGTLVSF 74 CFK F D I HKV G L SF Sbjct: 568 CFKGFRVGDQISHKVPGRLGSF 633
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Match: gi|592807590|gb|GAXK01146978.1| (TSA: Calanus finmarchicus comp2781160_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.634e+0 Identity = 11/25 (44.00%), Postives = 14/25 (56.00%), Query Frame = 0 Query: 39 CR--WQDWKQTKWSRVCFKHFNDSD 61 CR +Q+W Q KW +C DSD Sbjct: 445 CRRPYQNWTQAKWQNMCIDRIYDSD 519
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Match: gi|592807591|gb|GAXK01146977.1| (TSA: Calanus finmarchicus comp2781160_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.710e+0 Identity = 11/25 (44.00%), Postives = 14/25 (56.00%), Query Frame = 0 Query: 39 CR--WQDWKQTKWSRVCFKHFNDSD 61 CR +Q+W Q KW +C DSD Sbjct: 445 CRRPYQNWTQAKWQNMCIDRIYDSD 519
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Match: gi|592852522|gb|GAXK01105022.1| (TSA: Calanus finmarchicus comp157664_c1_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.258e+0 Identity = 13/35 (37.14%), Postives = 18/35 (51.43%), Query Frame = 0 Query: 25 CPKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFND 59 C PV L+ + RW + T+ R CF HFN+ Sbjct: 40 CQPTPVSLRTLLSPARW-NLSLTRCLRTCFTHFNN 141
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Match: gi|592945696|gb|GAXK01012857.1| (TSA: Calanus finmarchicus comp2991107_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.588e+0 Identity = 10/20 (50.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 44 WKQTKWSRVCFKHFNDSDII 63 W+ T+WSRVC K D+D++ Sbjct: 75 WRMTRWSRVCLK---DADLV 125
BLAST of EMLSAG00000003903 vs. L. salmonis peptides
Match: EMLSAP00000003903 (pep:novel supercontig:LSalAtl2s:LSalAtl2s210:70887:73106:1 gene:EMLSAG00000003903 transcript:EMLSAT00000003903 description:"snap-LSalAtl2s210-processed-gene-0.38") HSP 1 Score: 153.295 bits (386), Expect = 9.217e-50 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0 Query: 1 MDVLMRMSSDKIAFSFLQKEFGIRCPKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFNDSDIIKHKVKGTLVSF 74 MDVLMRMSSDKIAFSFLQKEFGIRCPKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFNDSDIIKHKVKGTLVSF Sbjct: 1 MDVLMRMSSDKIAFSFLQKEFGIRCPKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFNDSDIIKHKVKGTLVSF 74
BLAST of EMLSAG00000003903 vs. L. salmonis peptides
Match: EMLSAP00000007454 (pep:novel supercontig:LSalAtl2s:LSalAtl2s4278:2558:3098:-1 gene:EMLSAG00000007454 transcript:EMLSAT00000007454 description:"augustus-LSalAtl2s4278-processed-gene-0.1") HSP 1 Score: 87.0409 bits (214), Expect = 4.212e-23 Identity = 44/66 (66.67%), Postives = 48/66 (72.73%), Query Frame = 0 Query: 7 MSSDKIAFSFLQKEFGIRCPKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFNDSDIIKHKVKGTLV 72 +S +K+ SF PKNP LLKRWIVNCR QDWK TKWSR+C KHF DSDIIKHKVK TLV Sbjct: 34 LSRNKVKISFFP------FPKNPALLKRWIVNCRRQDWKPTKWSRICSKHFKDSDIIKHKVKCTLV 93
BLAST of EMLSAG00000003903 vs. L. salmonis peptides
Match: EMLSAP00000001020 (pep:novel supercontig:LSalAtl2s:LSalAtl2s116:1964032:1966964:1 gene:EMLSAG00000001020 transcript:EMLSAT00000001020 description:"augustus-LSalAtl2s116-processed-gene-19.24") HSP 1 Score: 65.855 bits (159), Expect = 6.202e-15 Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = 0 Query: 26 PKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFNDSDIIKHKVKGTLV 72 PK P L KRW++NCR ++W +KWS++C KHF +SDIIKHKV+ LV Sbjct: 74 PKRPELRKRWLLNCRRKNWTPSKWSKLCSKHFKESDIIKHKVRYHLV 120
BLAST of EMLSAG00000003903 vs. L. salmonis peptides
Match: EMLSAP00000006575 (pep:novel supercontig:LSalAtl2s:LSalAtl2s35:814397:816004:1 gene:EMLSAG00000006575 transcript:EMLSAT00000006575 description:"snap-LSalAtl2s35-processed-gene-8.21") HSP 1 Score: 55.8398 bits (133), Expect = 1.405e-11 Identity = 25/47 (53.19%), Postives = 34/47 (72.34%), Query Frame = 0 Query: 26 PKNPVLLKRWIVNCRWQDWKQTKWSRVCFKHFNDSDIIKHKVKGTLV 72 PKNP L RW++N R ++W +KWSR+C K+F II+HKVK +LV Sbjct: 4 PKNPELHNRWLINWRRENWNPSKWSRICSKNFKKDLIIRHKVKCSLV 50 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003903 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 2
BLAST of EMLSAG00000003903 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 7
BLAST of EMLSAG00000003903 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 4
BLAST of EMLSAG00000003903 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003903 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003903 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000003903 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s210:70887..73106+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003903-686669 ID=EMLSAG00000003903-686669|Name=EMLSAG00000003903|organism=Lepeophtheirus salmonis|type=gene|length=2220bp|location=Sequence derived from alignment at LSalAtl2s210:70887..73106+ (Lepeophtheirus salmonis)back to top Add to Basket
|