EMLSAG00000009880, EMLSAG00000009880-692646 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000009880 vs. C. finmarchicus
Match: gi|592944444|gb|GAXK01014109.1| (TSA: Calanus finmarchicus comp9613_c0_seq1 transcribed RNA sequence) HSP 1 Score: 37.7354 bits (86), Expect = 1.372e-3 Identity = 17/36 (47.22%), Postives = 22/36 (61.11%), Query Frame = 0 Query: 31 EWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ 66 EW WK H ++Y S E+ R KIY ENK K++K Sbjct: 123 EWETWKLTHNQKYDSHLEEKFRLKIYMENKAKVEKH 230
BLAST of EMLSAG00000009880 vs. C. finmarchicus
Match: gi|592778932|gb|GAXK01175636.1| (TSA: Calanus finmarchicus comp3582_c0_seq1 transcribed RNA sequence) HSP 1 Score: 37.7354 bits (86), Expect = 1.542e-3 Identity = 26/79 (32.91%), Postives = 33/79 (41.77%), Query Frame = 0 Query: 10 NNMKLFFIFVSLGLVAGE-------FSREWTLWKKLHGKRYASF---------------QIEELRFKIYEENKIKIQKQ 66 N+MK+ LGL A + EW WK HGK YA Q E+ R KI+ ENK K++K Sbjct: 919 NSMKVALALCLLGLKAAQAVAPFELVVEEWETWKLRHGKTYARNYGDNMKDAGNGGNYGQEEKFRMKIWMENKAKVEKH 1155
BLAST of EMLSAG00000009880 vs. C. finmarchicus
Match: gi|592876703|gb|GAXK01080945.1| (TSA: Calanus finmarchicus comp3376309_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 1.025e-1 Identity = 16/48 (33.33%), Postives = 25/48 (52.08%), Query Frame = 0 Query: 12 MKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEEN 59 MKL F + +V ++WT + + + K+Y S E RF I+ EN Sbjct: 412 MKLIFALALVAIVLCNDVQQWTNFTQKYNKQYVSATEESSRFAIFREN 555
BLAST of EMLSAG00000009880 vs. C. finmarchicus
Match: gi|592778476|gb|GAXK01176092.1| (TSA: Calanus finmarchicus comp2124_c1_seq1 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 2.277e-1 Identity = 14/36 (38.89%), Postives = 22/36 (61.11%), Query Frame = 0 Query: 31 EWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ 66 E+ +K+ HGK Y + + E RF ++EN KI+K Sbjct: 174 EFQQFKEKHGKAYTNAREESSRFATFQENLEKIEKH 281
BLAST of EMLSAG00000009880 vs. C. finmarchicus
Match: gi|592942348|gb|GAXK01016205.1| (TSA: Calanus finmarchicus comp3288370_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.235e+0 Identity = 13/25 (52.00%), Postives = 17/25 (68.00%), Query Frame = 0 Query: 35 WKKLHGKRYASFQIEELRFKIYEEN 59 WKK HGK + +ELRFKI+ +N Sbjct: 834 WKKEHGKNTNGTE-DELRFKIFSDN 905
BLAST of EMLSAG00000009880 vs. C. finmarchicus
Match: gi|592903573|gb|GAXK01054802.1| (TSA: Calanus finmarchicus comp3333352_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.294e+0 Identity = 18/50 (36.00%), Postives = 25/50 (50.00%), Query Frame = 0 Query: 5 ELSTSNNMKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFK 54 ELS +N LF I +G+ A SR WK ++ FQI +RF+ Sbjct: 210 ELSVAN-FNLFAILKRMGMRACHVSRANRWWKVASFFTFSPFQISAVRFQ 356
BLAST of EMLSAG00000009880 vs. L. salmonis peptides
Match: EMLSAP00000009880 (pep:novel supercontig:LSalAtl2s:LSalAtl2s642:300328:300528:1 gene:EMLSAG00000009880 transcript:EMLSAT00000009880 description:"snap-LSalAtl2s642-processed-gene-2.24") HSP 1 Score: 134.42 bits (337), Expect = 1.490e-42 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0 Query: 1 MNHSELSTSNNMKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ 66 MNHSELSTSNNMKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ Sbjct: 1 MNHSELSTSNNMKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ 66
BLAST of EMLSAG00000009880 vs. L. salmonis peptides
Match: EMLSAP00000003361 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1843:25686:26905:1 gene:EMLSAG00000003361 transcript:EMLSAT00000003361 description:"augustus_masked-LSalAtl2s1843-processed-gene-0.0") HSP 1 Score: 101.293 bits (251), Expect = 4.676e-28 Identity = 48/54 (88.89%), Postives = 49/54 (90.74%), Query Frame = 0 Query: 12 MKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQK 65 MKLF IFV LGLVAGE S EWTLWKKLHGKRYASFQIEEL FKIYEEN+IKIQK Sbjct: 1 MKLFLIFVCLGLVAGELSSEWTLWKKLHGKRYASFQIEELIFKIYEENRIKIQK 54
BLAST of EMLSAG00000009880 vs. L. salmonis peptides
Match: EMLSAP00000009876 (pep:novel supercontig:LSalAtl2s:LSalAtl2s642:301507:302282:1 gene:EMLSAG00000009876 transcript:EMLSAT00000009876 description:"augustus_masked-LSalAtl2s642-processed-gene-2.3") HSP 1 Score: 97.0561 bits (240), Expect = 1.941e-26 Identity = 46/55 (83.64%), Postives = 48/55 (87.27%), Query Frame = 0 Query: 12 MKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ 66 MKLFFIFVSLG V GEFS EWTLWKKLHGKRYASFQIEEL K Y+EN+IKIQK Sbjct: 1 MKLFFIFVSLGXVVGEFSXEWTLWKKLHGKRYASFQIEELDSKCYKENRIKIQKH 55
BLAST of EMLSAG00000009880 vs. L. salmonis peptides
Match: EMLSAP00000005195 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2746:8859:10018:-1 gene:EMLSAG00000005195 transcript:EMLSAT00000005195 description:"maker-LSalAtl2s2746-snap-gene-0.2") HSP 1 Score: 96.6709 bits (239), Expect = 2.998e-26 Identity = 44/54 (81.48%), Postives = 49/54 (90.74%), Query Frame = 0 Query: 12 MKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQK 65 MKLFFIFVSLG+V GEFS +WTLWKKLHGKRY SFQIEELRFKI+EEN+I+ K Sbjct: 1 MKLFFIFVSLGVVVGEFSSZWTLWKKLHGKRYVSFQIEELRFKIFEENRIQNPK 54
BLAST of EMLSAG00000009880 vs. L. salmonis peptides
Match: EMLSAP00000009878 (pep:novel supercontig:LSalAtl2s:LSalAtl2s642:322542:323700:-1 gene:EMLSAG00000009878 transcript:EMLSAT00000009878 description:"augustus_masked-LSalAtl2s642-processed-gene-2.5") HSP 1 Score: 96.2857 bits (238), Expect = 9.510e-26 Identity = 45/55 (81.82%), Postives = 48/55 (87.27%), Query Frame = 0 Query: 12 MKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ 66 MKLF IFVSLGLVAGE S EWTLW KLHGK Y SF+IEELRFKI+EEN+IKIQK Sbjct: 1 MKLFLIFVSLGLVAGELSGEWTLWTKLHGKTYTSFEIEELRFKIFEENRIKIQKH 55
BLAST of EMLSAG00000009880 vs. nr
Match: gi|305434756|gb|ADM53740.1| (cathepsin L1 precursor [Lepeophtheirus salmonis]) HSP 1 Score: 93.9745 bits (232), Expect = 1.294e-21 Identity = 44/55 (80.00%), Postives = 47/55 (85.45%), Query Frame = 0 Query: 12 MKLFFIFVSLGLVAGEFSREWTLWKKLHGKRYASFQIEELRFKIYEENKIKIQKQ 66 MKLF IFVSLGLVAGE S EWTLW KLHGK Y SF+IEELR KI+EEN+IKIQK Sbjct: 1 MKLFLIFVSLGLVAGELSGEWTLWTKLHGKTYTSFEIEELRVKIFEENRIKIQKH 55 The following BLAST results are available for this feature:
BLAST of EMLSAG00000009880 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000009880 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000009880 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 5
BLAST of EMLSAG00000009880 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000009880 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000009880 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 1
BLAST of EMLSAG00000009880 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s642:300328..300528+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000009880-692646 ID=EMLSAG00000009880-692646|Name=EMLSAG00000009880|organism=Lepeophtheirus salmonis|type=gene|length=201bp|location=Sequence derived from alignment at LSalAtl2s642:300328..300528+ (Lepeophtheirus salmonis)back to top Add to Basket
|