EMLSAG00000011218, EMLSAG00000011218-693984 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592829400|gb|GAXK01128144.1| (TSA: Calanus finmarchicus comp5685985_c0_seq1 transcribed RNA sequence) HSP 1 Score: 53.9138 bits (128), Expect = 1.491e-9 Identity = 33/93 (35.48%), Postives = 45/93 (48.39%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLLLVHKF---------------------PSTPTSKPRTSIDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPV 72 ++YLA+ DRYSN + + K P +S + + ET+NF RWGI+ R+SS FPQSN AE +KS K V Sbjct: 270 RNYLAMADRYSNWISLFKLVKDDAYNLLQALRDYSTCFGIPRRLSSDGASIFTAAETENFCKRWGISQRISSSYFPQSNKRAEVAVKSCKRMV 548
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592935978|gb|GAXK01022575.1| (TSA: Calanus finmarchicus comp7731694_c0_seq1 transcribed RNA sequence) HSP 1 Score: 48.1358 bits (113), Expect = 1.002e-7 Identity = 30/90 (33.33%), Postives = 42/90 (46.67%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLLLVHKF---------------------PSTPTSKPRTSIDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 K YLA VDRYSN L + + P T T+ + S E +++ RWGI R+SS +P++N AE +KS K Sbjct: 10 KSYLATVDRYSNWLSIFQLARDDSANIIKTIRDFASCWGVPLTMTTDGASVFTSKEMEDWLQRWGITHRISSYYYPRANKRAEVAVKSAK 279
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592857974|gb|GAXK01099588.1| (TSA: Calanus finmarchicus comp2303658_c0_seq2 transcribed RNA sequence) HSP 1 Score: 50.0618 bits (118), Expect = 1.835e-7 Identity = 32/90 (35.56%), Postives = 42/90 (46.67%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLLLVHKFPSTPTSK---------------PRTSID------SIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 ++YLA+ DRYSN L + K P + R S D S ET F RWGI+ R+ S +P+SN AE +KS K Sbjct: 938 RNYLAMADRYSNWLSLFKLPEDDSKHLIQVIRDYSSYFGIPKRLSSDGASIFTSTETDTFCKRWGISQRIGSSYYPESNKRAEVAVKSCK 1207
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592857975|gb|GAXK01099587.1| (TSA: Calanus finmarchicus comp2303658_c0_seq1 transcribed RNA sequence) HSP 1 Score: 50.0618 bits (118), Expect = 1.843e-7 Identity = 32/90 (35.56%), Postives = 42/90 (46.67%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLLLVHKFPSTPTSK---------------PRTSID------SIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 ++YLA+ DRYSN L + K P + R S D S ET F RWGI+ R+ S +P+SN AE +KS K Sbjct: 938 RNYLAMADRYSNWLSLFKLPEDDSKHLIQVIRDYSSYFGIPKRLSSDGASIFTSTETDTFCKRWGISQRIGSSYYPESNKRAEVAVKSCK 1207
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592867352|gb|GAXK01090210.1| (TSA: Calanus finmarchicus comp4045122_c0_seq1 transcribed RNA sequence) HSP 1 Score: 45.0542 bits (105), Expect = 1.183e-6 Identity = 30/90 (33.33%), Postives = 45/90 (50.00%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLLLVHKFPSTPTSKPRTSI-----------------DSI----ETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 K YL IVDRYSN L + + P+ +S+ ++ DS+ E +++ RW + RLSS +P+SN AE +KS K Sbjct: 70 KSYLVIVDRYSNWLSLFQLPNDNSSQVIKTLRNYFTTWGVARSFSSDGDSVFTSRELRDWLQRWDVDQRLSSSYYPRSNKRAEVAVKSGK 339
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592887294|gb|GAXK01071081.1| (TSA: Calanus finmarchicus comp6475906_c0_seq1 transcribed RNA sequence) HSP 1 Score: 41.5874 bits (96), Expect = 1.751e-5 Identity = 30/94 (31.91%), Postives = 42/94 (44.68%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLL---------------LVHKFPSTPTSKPRTSID------SIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVL 73 K YL +VDRYSN L ++ + +T S D S E + + RW + RLSS FP+SN AE +KS K ++ Sbjct: 40 KSYLVVVDRYSNWLSLFQLTRDTSANVIKVLRDYFTTWGVAQSISTDGDKVFTSEELRTWLKRWDVYQRLSSAYFPRSNKRAEVAVKSGKRMIM 321
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592790961|gb|GAXK01163607.1| (TSA: Calanus finmarchicus comp6733688_c0_seq1 transcribed RNA sequence) HSP 1 Score: 41.5874 bits (96), Expect = 5.405e-5 Identity = 17/35 (48.57%), Postives = 23/35 (65.71%), Query Frame = 0 Query: 35 ETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 +T+NF WG+ RLSS+ FP SN AE +K +K Sbjct: 21 DTENFLKAWGVHHRLSSVAFPHSNCRAELAVKQVK 125
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592812664|gb|GAXK01141904.1| (TSA: Calanus finmarchicus comp2753032_c0_seq1 transcribed RNA sequence) HSP 1 Score: 39.6614 bits (91), Expect = 4.568e-4 Identity = 28/89 (31.46%), Postives = 40/89 (44.94%), Query Frame = 0 Query: 2 HYLAIVDRYSNLLLVHKFPS---------------------TPTSKPRTSIDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 +YLA+VDRYS L + + P T TS + S ++F RWGI R+++ PQ+N AE +KS K Sbjct: 1614 NYLAVVDRYSQWLSIFQLPKDDSEEVVKVLREYIGTFGIPCTLTSDGASVFTSKFMESFCDRWGIIHRVATAYNPQANKRAEVAVKSAK 1880
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592899025|gb|GAXK01059350.1| (TSA: Calanus finmarchicus comp5785857_c0_seq1 transcribed RNA sequence) HSP 1 Score: 37.7354 bits (86), Expect = 1.544e-3 Identity = 18/37 (48.65%), Postives = 21/37 (56.76%), Query Frame = 0 Query: 33 SIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 S E F RWG R+SS FP+SN AE +KS K Sbjct: 613 SAEMAEFRTRWGFKQRISSAYFPRSNKRAEVGVKSAK 723
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Match: gi|592861562|gb|GAXK01096000.1| (TSA: Calanus finmarchicus comp7493218_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.8094 bits (81), Expect = 2.529e-3 Identity = 16/34 (47.06%), Postives = 21/34 (61.76%), Query Frame = 0 Query: 36 TQNFFARWGIALRLSSLLFPQSNGLAESVIKSIK 69 T+NF R G+ RLSS+ FP SN AE + + K Sbjct: 1 TENFLVRLGVHHRLSSVGFPHSNQKAEKAVGAAK 102
BLAST of EMLSAG00000011218 vs. L. salmonis peptides
Match: EMLSAP00000011218 (pep:novel supercontig:LSalAtl2s:LSalAtl2s768:187911:188209:-1 gene:EMLSAG00000011218 transcript:EMLSAT00000011218 description:"maker-LSalAtl2s768-snap-gene-1.12") HSP 1 Score: 159.073 bits (401), Expect = 6.231e-52 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLLLVHKFPSTPTSKPRTSIDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKTWTT 78 KHYLAIVDRYSNLLLVHKFPSTPTSKPRTSIDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKTWTT Sbjct: 1 KHYLAIVDRYSNLLLVHKFPSTPTSKPRTSIDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKTWTT 78
BLAST of EMLSAG00000011218 vs. L. salmonis peptides
Match: EMLSAP00000002862 (pep:novel supercontig:LSalAtl2s:LSalAtl2s16595:2:760:1 gene:EMLSAG00000002862 transcript:EMLSAT00000002862 description:"augustus-LSalAtl2s16595-processed-gene-0.0") HSP 1 Score: 102.064 bits (253), Expect = 6.362e-28 Identity = 59/100 (59.00%), Postives = 62/100 (62.00%), Query Frame = 0 Query: 1 KHYLAIVDRYSNLLLVHKFPSTPTSKPRTS----------------------IDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKTWTT 78 KHYLAIVDRYSN LLVHKF S PTSK S + ETQNFFARWGIA RLSS FPQSNGLAES +KSIKA +LKT T Sbjct: 21 KHYLAIVDRYSNFLLVHKFSSAPTSKSLISSLLHHIATFGRPLRIFSDGGLQFTAAETQNFFARWGIAHRLSSPHFPQSNGLAESAVKSIKALLLKTGNT 120
BLAST of EMLSAG00000011218 vs. L. salmonis peptides
Match: EMLSAP00000006569 (pep:novel supercontig:LSalAtl2s:LSalAtl2s35:845590:849230:1 gene:EMLSAG00000006569 transcript:EMLSAT00000006569 description:"snap_masked-LSalAtl2s35-processed-gene-8.19") HSP 1 Score: 51.2174 bits (121), Expect = 4.881e-10 Identity = 28/51 (54.90%), Postives = 32/51 (62.75%), Query Frame = 0 Query: 28 RTSIDSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKTWTT 78 R E QN FARWGI+ R+SS F QS LAES +KSIKA +LK T Sbjct: 11 RVEFIGTEIQNLFARWGISHRVSSPHFCQSIRLAESAVKSIKARLLKAGNT 61
BLAST of EMLSAG00000011218 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold374_size191929-processed-gene-0.10 (protein:Tk01257 transcript:snap_masked-scaffold374_size191929-processed-gene-0.10-mRNA-1 annotation:"PREDICTED: uncharacterized protein K02A2.6-like") HSP 1 Score: 51.6026 bits (122), Expect = 7.348e-11 Identity = 23/41 (56.10%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 35 ETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKT 75 ETQ F WG+ RLS+ +PQSNGLAES +K++K +LKT Sbjct: 11 ETQTFLVDWGVRHRLSTAHYPQSNGLAESAVKALKHLLLKT 51
BLAST of EMLSAG00000011218 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold531_size145796-snap-gene-0.25 (protein:Tk12612 transcript:maker-scaffold531_size145796-snap-gene-0.25-mRNA-1 annotation:"poly protein") HSP 1 Score: 50.8322 bits (120), Expect = 1.096e-9 Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 40 FARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKT 75 F +WG+ RLS+ FPQSNGLAES +K+IKA +LKT Sbjct: 16 FPQWGVRHRLSTAEFPQSNGLAESAVKAIKAFLLKT 51
BLAST of EMLSAG00000011218 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold531_size145796-snap-gene-0.24 (protein:Tk12611 transcript:maker-scaffold531_size145796-snap-gene-0.24-mRNA-1 annotation:"---NA---") HSP 1 Score: 50.8322 bits (120), Expect = 1.096e-9 Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 40 FARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKT 75 F +WG+ RLS+ FPQSNGLAES +K+IKA +LKT Sbjct: 16 FPQWGVRHRLSTAEFPQSNGLAESAVKAIKAFLLKT 51
BLAST of EMLSAG00000011218 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1225_size54570-snap-gene-0.8 (protein:Tk06437 transcript:maker-scaffold1225_size54570-snap-gene-0.8-mRNA-1 annotation:"poly protein") HSP 1 Score: 45.4394 bits (106), Expect = 1.070e-7 Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 35 ETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKT 75 E Q+F G+ RLS+ +P SNGLAESV+K++K+ +LKT Sbjct: 34 EIQHFLVHLGVCHRLSTANYPLSNGLAESVVKTLKSLLLKT 74
BLAST of EMLSAG00000011218 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1752_size28949-snap-gene-0.4 (protein:Tk00995 transcript:maker-scaffold1752_size28949-snap-gene-0.4-mRNA-1 annotation:"PREDICTED: uncharacterized protein K02A2.6-like") HSP 1 Score: 44.2838 bits (103), Expect = 4.017e-7 Identity = 31/96 (32.29%), Postives = 41/96 (42.71%), Query Frame = 0 Query: 2 HYLAIVDRYSNLLLVHKFPSTPTSKPRTSI----------------------DSIETQNFFARWGIALRLSSLLFPQSNGLAESVIKSIKAPVLKT 75 HYL VDRYS +V FPS P+S T + + E + F WG+ + SS QSNG AE +K +K + KT Sbjct: 77 HYLVYVDRYSGFPMVAMFPSAPSSSDVTKVLRSLFSLMGVPQVLRSDQGPQYRTEEIRIFLKEWGVLWKPSSPYNAQSNGHAEVSVKVVKRLLQKT 172 The following BLAST results are available for this feature:
BLAST of EMLSAG00000011218 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000011218 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 19
Pagesback to top
BLAST of EMLSAG00000011218 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 3
BLAST of EMLSAG00000011218 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000011218 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000011218 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000011218 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 5
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s768:187911..188209- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000011218-693984 ID=EMLSAG00000011218-693984|Name=EMLSAG00000011218|organism=Lepeophtheirus salmonis|type=gene|length=299bp|location=Sequence derived from alignment at LSalAtl2s768:187911..188209- (Lepeophtheirus salmonis)back to top Add to Basket
|