EMLSAG00000011519, EMLSAG00000011519-694285 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592923318|gb|GAXK01035097.1| (TSA: Calanus finmarchicus comp110292_c2_seq2 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 6.666e-2 Identity = 19/66 (28.79%), Postives = 33/66 (50.00%), Query Frame = 0 Query: 1 MACMEGSGTKPKSGHSGKLS--SEENIDLLQELFPDRDVNILSSYLLKYPGKHIEGLIEIILGNDS 64 MA + GH +LS +E L+E+FP + L ++ +PG +E L+E +L ++S Sbjct: 28 MAPQNRKRPREDDGHEQELSGEAEAAYRTLREVFPTKSWRYLRDKVVNWPGGSVEQLVEQLLTSES 225
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592923319|gb|GAXK01035096.1| (TSA: Calanus finmarchicus comp110292_c2_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 7.660e-2 Identity = 19/66 (28.79%), Postives = 33/66 (50.00%), Query Frame = 0 Query: 1 MACMEGSGTKPKSGHSGKLS--SEENIDLLQELFPDRDVNILSSYLLKYPGKHIEGLIEIILGNDS 64 MA + GH +LS +E L+E+FP + L ++ +PG +E L+E +L ++S Sbjct: 28 MAPQNRKRPREDDGHEQELSGEAEAAYRTLREVFPTKSWRYLRDKVVNWPGGSVEQLVEQLLTSES 225
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592949690|gb|GAXK01008863.1| (TSA: Calanus finmarchicus comp939685_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 1.029e-1 Identity = 13/43 (30.23%), Postives = 20/43 (46.51%), Query Frame = 0 Query: 55 LIEIILGNDSQVKCEVCWEEYFLENT--VSCVNSHFFCRDCAR 95 L + + + C++C EEY E + C N H FC C + Sbjct: 1287 LCTVRFSGEGETSCDICMEEYSQERKPLLVCTNGHNFCSSCTK 1415
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592949689|gb|GAXK01008864.1| (TSA: Calanus finmarchicus comp939685_c0_seq2 transcribed RNA sequence) HSP 1 Score: 32.3426 bits (72), Expect = 1.512e-1 Identity = 13/43 (30.23%), Postives = 20/43 (46.51%), Query Frame = 0 Query: 55 LIEIILGNDSQVKCEVCWEEYFLENT--VSCVNSHFFCRDCAR 95 L + + + C++C EEY E + C N H FC C + Sbjct: 139 LCTVRFSGEGETSCDICMEEYSQERKPLLVCTNGHNFCSSCTK 267
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592888756|gb|GAXK01069619.1| (TSA: Calanus finmarchicus comp313699_c2_seq3 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 2.352e-1 Identity = 23/77 (29.87%), Postives = 33/77 (42.86%), Query Frame = 0 Query: 17 GKLSSEENIDLLQELFPDRDVNILSSYLLKYPGKHIEGLIEIILGNDSQVKCEVCWEEYFLENTVSCVNSHFFCRDC 93 GK+S E + L +E + R + L K H L ++ +++C VC E E C N HF CR C Sbjct: 678 GKVSEMEKLSL-KEKWERRKFQRENRKLTKLSANHKSFLNKL----RGKIQCPVCQEVPRAETVPVCSNGHFVCRKC 893
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592879321|gb|GAXK01078580.1| (TSA: Calanus finmarchicus comp209484_c4_seq9 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 2.665e-1 Identity = 13/29 (44.83%), Postives = 18/29 (62.07%), Query Frame = 0 Query: 66 VKCEVCWEEYFLE-NTVSCVNSHFFCRDC 93 V+CE C++ LE + V C H +CRDC Sbjct: 1021 VECECCYDPDCLEEDMVRCGGGHLYCRDC 1107
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592879320|gb|GAXK01078581.1| (TSA: Calanus finmarchicus comp209484_c4_seq10 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 2.808e-1 Identity = 13/29 (44.83%), Postives = 18/29 (62.07%), Query Frame = 0 Query: 66 VKCEVCWEEYFLE-NTVSCVNSHFFCRDC 93 V+CE C++ LE + V C H +CRDC Sbjct: 795 VECECCYDPDCLEEDMVRCGGGHLYCRDC 881
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592879326|gb|GAXK01078575.1| (TSA: Calanus finmarchicus comp209484_c4_seq4 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 2.953e-1 Identity = 13/29 (44.83%), Postives = 18/29 (62.07%), Query Frame = 0 Query: 66 VKCEVCWEEYFLE-NTVSCVNSHFFCRDC 93 V+CE C++ LE + V C H +CRDC Sbjct: 1406 VECECCYDPDCLEEDMVRCGGGHLYCRDC 1492
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592879323|gb|GAXK01078578.1| (TSA: Calanus finmarchicus comp209484_c4_seq7 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 3.127e-1 Identity = 13/29 (44.83%), Postives = 18/29 (62.07%), Query Frame = 0 Query: 66 VKCEVCWEEYFLE-NTVSCVNSHFFCRDC 93 V+CE C++ LE + V C H +CRDC Sbjct: 1247 VECECCYDPDCLEEDMVRCGGGHLYCRDC 1333
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Match: gi|592852937|gb|GAXK01104607.1| (TSA: Calanus finmarchicus comp157290_c1_seq11 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 3.763e-1 Identity = 15/38 (39.47%), Postives = 22/38 (57.89%), Query Frame = 0 Query: 9 TKPKSGHSGKLSSEENIDLLQELFPDRDVNILSSYLLK 46 +KPK KLS +E + +E FPD D +L ++ LK Sbjct: 3614 SKPKLSARRKLSKDEFESVWEEHFPDEDEKLLKTFFLK 3727
BLAST of EMLSAG00000011519 vs. L. salmonis peptides
Match: EMLSAP00000011519 (pep:novel supercontig:LSalAtl2s:LSalAtl2s799:201458:201745:-1 gene:EMLSAG00000011519 transcript:EMLSAT00000011519 description:"augustus_masked-LSalAtl2s799-processed-gene-2.1") HSP 1 Score: 198.364 bits (503), Expect = 8.180e-67 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0 Query: 1 MACMEGSGTKPKSGHSGKLSSEENIDLLQELFPDRDVNILSSYLLKYPGKHIEGLIEIILGNDSQVKCEVCWEEYFLENTVSCVNSHFFCRDCAR 95 MACMEGSGTKPKSGHSGKLSSEENIDLLQELFPDRDVNILSSYLLKYPGKHIEGLIEIILGNDSQVKCEVCWEEYFLENTVSCVNSHFFCRDCAR Sbjct: 1 MACMEGSGTKPKSGHSGKLSSEENIDLLQELFPDRDVNILSSYLLKYPGKHIEGLIEIILGNDSQVKCEVCWEEYFLENTVSCVNSHFFCRDCAR 95
BLAST of EMLSAG00000011519 vs. L. salmonis peptides
Match: EMLSAP00000000189 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1029:145437:146295:-1 gene:EMLSAG00000000189 transcript:EMLSAT00000000189 description:"maker-LSalAtl2s1029-snap-gene-1.49") HSP 1 Score: 64.6994 bits (156), Expect = 2.761e-14 Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 0 Query: 31 LFPDRDVNILSSYLLKYPGKHIEGLIEIILGNDSQVKCEVCWEEYFLENTVSCVNSHFFCRDC 93 +FP++D L+S L YPGK++EGLI+ IL QV+C +CWE+ ++E+ +SC H CR C Sbjct: 1 MFPEKDEFELTSLLKSYPGKYMEGLIDKIL-QGVQVRCLICWEDLYMEDVISCDGDHPVCRSC 62 The following BLAST results are available for this feature:
BLAST of EMLSAG00000011519 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000011519 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000011519 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000011519 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000011519 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000011519 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000011519 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s799:201458..201745- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000011519-694285 ID=EMLSAG00000011519-694285|Name=EMLSAG00000011519|organism=Lepeophtheirus salmonis|type=gene|length=288bp|location=Sequence derived from alignment at LSalAtl2s799:201458..201745- (Lepeophtheirus salmonis)back to top Add to Basket
|