EMLSAG00000000003, EMLSAG00000000003-682769 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000003
Unique NameEMLSAG00000000003-682769
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000003 vs. GO
Match: - (symbol:Sema-1a "Sema-1a" species:7227 "Drosophila melanogaster" [GO:0016021 "integral component of membrane" evidence=ISS;NAS] [GO:0007411 "axon guidance" evidence=ISS;IDA;IMP;NAS] [GO:0005886 "plasma membrane" evidence=ISS;IDA] [GO:0007416 "synapse assembly" evidence=IMP] [GO:0030215 "semaphorin receptor binding" evidence=TAS] [GO:0004872 "receptor activity" evidence=IEA] [GO:0016199 "axon midline choice point recognition" evidence=IMP] [GO:0005515 "protein binding" evidence=IPI] [GO:0008039 "synaptic target recognition" evidence=IMP] [GO:0048813 "dendrite morphogenesis" evidence=IMP] [GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP] [GO:0001964 "startle response" evidence=IMP] [GO:0048854 "brain morphogenesis" evidence=IMP] [GO:2000305 "semaphorin-plexin signaling pathway involved in regulation of photoreceptor cell axon guidance" evidence=IGI] [GO:0008201 "heparin binding" evidence=IDA] [GO:0008045 "motor neuron axon guidance" evidence=IMP] [GO:0045792 "negative regulation of cell size" evidence=IMP] InterPro:IPR001627 InterPro:IPR002165 InterPro:IPR015943 InterPro:IPR016201 Pfam:PF01403 Pfam:PF01437 PROSITE:PS51004 SMART:SM00423 SMART:SM00630 GO:GO:0016021 GO:GO:0005886 EMBL:AE014134 Gene3D:2.130.10.10 GO:GO:0004872 GO:GO:0016199 GO:GO:0008201 GO:GO:0008045 GO:GO:0048813 GO:GO:0008039 GO:GO:0007416 GO:GO:0045792 GO:GO:0048854 GO:GO:0031987 GO:GO:0001964 SUPFAM:SSF103575 SUPFAM:SSF101912 GO:GO:0030215 eggNOG:NOG293968 InterPro:IPR027231 PANTHER:PTHR11036 OrthoDB:EOG7Z3F3W EMBL:L26082 RefSeq:NP_723407.2 UniGene:Dm.13264 ProteinModelPortal:Q24322 SMR:Q24322 BioGrid:60311 IntAct:Q24322 STRING:7227.FBpp0110230 PaxDb:Q24322 GeneID:34192 KEGG:dme:Dmel_CG18405 CTD:34192 FlyBase:FBgn0011259 InParanoid:Q24322 KO:K06842 ChiTaRS:Sema-1a GenomeRNAi:34192 NextBio:787331 Bgee:Q24322 GO:GO:2000305 Uniprot:Q24322)

HSP 1 Score: 48.1358 bits (113), Expect = 9.505e-6
Identity = 29/74 (39.19%), Postives = 49/74 (66.22%), Query Frame = 0
Query:   47 RSTWSMD-QPKVFVDYVRGPLKDDVNRFEGNDTT-NNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISW 118
            +S W  + +PK++V+   GP  +DV +F GN++  ++FK++ +D N L+IGA NT++ L   DL+E   QR+ W
Sbjct:   15 QSAWQENIRPKLYVEL--GP--EDVLKFVGNESVVDHFKLVTKDGNSLLIGARNTVFNLSIHDLVE--QQRLVW 82          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592851764|gb|GAXK01105780.1| (TSA: Calanus finmarchicus comp185151_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 85.8853 bits (211), Expect = 1.211e-18
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 0
Query:   54 QPKVFVDYVRGPLKDDVNRFEGNDTT-NNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEI 127
            QPKV +DYV GPL D + RF+GN++  +NFK+++ED   L +G TNT+Y L+++DL E R  RI W PE + +E+
Sbjct:  753 QPKVTIDYVHGPLADTIKRFKGNNSQIDNFKIVVEDGTALFVGGTNTVYILNSKDLTEHRKLRIDWPPEPRDYEL 977          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592757737|gb|GAXK01196676.1| (TSA: Calanus finmarchicus comp249902_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 55.8398 bits (133), Expect = 8.893e-9
Identity = 34/102 (33.33%), Postives = 55/102 (53.92%), Query Frame = 0
Query:   48 STWSMDQPKVFVDYVRGPLKDDVNRFEGNDT-TNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEIYF----SSIFPNIYIYILGEE 144
            S W   +P++ VDY++    DDV  F GN T +++FK++ +D + L+IGA N +Y +    L E   QRI+W    +  E+      S    N YI +L ++
Sbjct:  926 SGWRDSRPRMVVDYLK-QHADDVQTFLGNQTHSDHFKLLRQDGSSLLIGARNVVYNISLNGLQENHQQRITWNSRHRDTELCLVKGKSEDDCNNYIRVLAKQ 1228          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592917871|gb|GAXK01040504.1| (TSA: Calanus finmarchicus comp147473_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 51.9878 bits (123), Expect = 1.830e-7
Identity = 37/112 (33.04%), Postives = 59/112 (52.68%), Query Frame = 0
Query:   17 KSQVIFLLLSCFYWVLALCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGNDT-TNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEI 127
            KS++  L L C      L V   SG      + W   +P++ VDY++    D+V  F GN T +++FK++ +D + L+IGA N +Y +   DL E  D RI+W    +  E+
Sbjct:  378 KSRITMLKLVC------LVVVGLSGV-----TAWRDSRPRMVVDYLK-QHTDEVLTFLGNSTHSDHFKLLQQDGSSLLIGARNVVYNISLSDLTENTDLRITWNSRTRDREL 677          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592917868|gb|GAXK01040507.1| (TSA: Calanus finmarchicus comp147473_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 51.9878 bits (123), Expect = 1.892e-7
Identity = 37/112 (33.04%), Postives = 59/112 (52.68%), Query Frame = 0
Query:   17 KSQVIFLLLSCFYWVLALCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGNDT-TNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEI 127
            KS++  L L C      L V   SG      + W   +P++ VDY++    D+V  F GN T +++FK++ +D + L+IGA N +Y +   DL E  D RI+W    +  E+
Sbjct: 2234 KSRITMLKLVC------LVVVGLSGV-----TAWRDSRPRMVVDYLK-QHTDEVLTFLGNSTHSDHFKLLQQDGSSLLIGARNVVYNISLSDLTENTDLRITWNSRTRDREL 2533          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592914369|gb|GAXK01044006.1| (TSA: Calanus finmarchicus comp130302_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 46.595 bits (109), Expect = 8.575e-6
Identity = 32/100 (32.00%), Postives = 55/100 (55.00%), Query Frame = 0
Query:   20 VIFLLLSCFYWVLALCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGNDT-TNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISW 118
            ++FLLL  F  V +L        + +T   ++ D+     D  R  L +D++ F GN + T++FK++ ED   +++GA N IY L   +L+E  ++RI W
Sbjct:  398 LVFLLL-LFSQVNSLDWLEHHRPVHETSYLYNEDELNTSSDNFRKEL-EDLSEFHGNSSHTDHFKLLKEDGTSVLVGARNVIYNLSLPNLIEYTEERIHW 691          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592764426|gb|GAXK01190142.1| (TSA: Calanus finmarchicus comp1727377_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 45.4394 bits (106), Expect = 2.182e-5
Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 0
Query:   69 DVNRFEGNDT-TNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISW--RPEKK 123
            D+  F GN++ +NNFK++ E  + +I+G  N IY L    L E++ + I W  RPE K
Sbjct:  281 DLTAFAGNNSFSNNFKLLEEGASSIIVGGRNVIYNLSLPHLQEVKQETIHWNCRPEDK 454          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592764427|gb|GAXK01190141.1| (TSA: Calanus finmarchicus comp1727377_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 45.4394 bits (106), Expect = 2.211e-5
Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 0
Query:   69 DVNRFEGNDT-TNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISW--RPEKK 123
            D+  F GN++ +NNFK++ E  + +I+G  N IY L    L E++ + I W  RPE K
Sbjct:  281 DLTAFAGNNSFSNNFKLLEEGASSIIVGGRNVIYNLSLPHLQEVKQETIHWNCRPEDK 454          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592875663|gb|GAXK01081914.1| (TSA: Calanus finmarchicus comp5002335_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 40.4318 bits (93), Expect = 2.881e-4
Identity = 20/49 (40.82%), Postives = 30/49 (61.22%), Query Frame = 0
Query:   71 NRFEGNDTTNN-FKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISW 118
            ++F GN +  N FK++ ED + ++IGA N IY L    L E  ++RI W
Sbjct:  216 SQFHGNSSEENYFKLLHEDGSYVLIGARNVIYNLSLPRLTEAEEKRIYW 362          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592890975|gb|GAXK01067400.1| (TSA: Calanus finmarchicus comp16353_c6_seq5 transcribed RNA sequence)

HSP 1 Score: 30.0314 bits (66), Expect = 2.224e+0
Identity = 13/43 (30.23%), Postives = 23/43 (53.49%), Query Frame = 0
Query:   34 LCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGN 76
            L  K+  GSL+   +TW       F+++ + PL  +  +F+GN
Sbjct:  197 LTYKNSQGSLKLILTTWYYWYSSYFLEFTKFPLFINTLKFDGN 325          
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Match: gi|592890976|gb|GAXK01067399.1| (TSA: Calanus finmarchicus comp16353_c6_seq4 transcribed RNA sequence)

HSP 1 Score: 30.0314 bits (66), Expect = 2.247e+0
Identity = 13/43 (30.23%), Postives = 23/43 (53.49%), Query Frame = 0
Query:   34 LCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGN 76
            L  K+  GSL+   +TW       F+++ + PL  +  +F+GN
Sbjct:  197 LTYKNSQGSLKLILTTWYYWYSSYFLEFTKFPLFINTLKFDGN 325          
BLAST of EMLSAG00000000003 vs. L. salmonis peptides
Match: EMLSAP00000000003 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1001:27360:90377:-1 gene:EMLSAG00000000003 transcript:EMLSAT00000000003 description:"maker-LSalAtl2s1001-snap-gene-0.4")

HSP 1 Score: 316.235 bits (809), Expect = 1.742e-111
Identity = 152/152 (100.00%), Postives = 152/152 (100.00%), Query Frame = 0
Query:    1 MATTYPHNTIKRSPSHKSQVIFLLLSCFYWVLALCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGNDTTNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEIYFSSIFPNIYIYILGEEKKKFFFFF 152
            MATTYPHNTIKRSPSHKSQVIFLLLSCFYWVLALCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGNDTTNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEIYFSSIFPNIYIYILGEEKKKFFFFF
Sbjct:    1 MATTYPHNTIKRSPSHKSQVIFLLLSCFYWVLALCVKSGSGSLRQTRSTWSMDQPKVFVDYVRGPLKDDVNRFEGNDTTNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEIYFSSIFPNIYIYILGEEKKKFFFFF 152          
BLAST of EMLSAG00000000003 vs. L. salmonis peptides
Match: EMLSAP00000000793 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1131:332688:362616:-1 gene:EMLSAG00000000793 transcript:EMLSAT00000000793 description:"maker-LSalAtl2s1131-augustus-gene-2.7")

HSP 1 Score: 54.299 bits (129), Expect = 1.934e-9
Identity = 42/113 (37.17%), Postives = 58/113 (51.33%), Query Frame = 0
Query:   17 KSQVIFLLLSCFYWVLALCVKSGSGSLRQTRSTWSMDQ-PKVFVDYVRGPLKDDVNRFEGNDTTNN-FKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEI 127
            K Q I L+L    W LA        S+  +   W  +Q  K+  DYV     + + RF GN T  + FK++  D N L+IGA N IY +   DL+E  +QRI+W P KK  +I
Sbjct:    4 KLQGISLIL----WTLA--------SVGFSHDPWGENQRAKINTDYVSS-NSNAIYRFLGNQTHKDYFKLLRRDGNSLLIGARNVIYNVSLPDLVENIEQRITWTPSKKDVDI 103          
BLAST of EMLSAG00000000003 vs. SwissProt
Match: gi|8134678|sp|Q26473.1|SEM1A_SCHAM (RecName: Full=Semaphorin-1A; AltName: Full=Fasciclin IV; AltName: Full=Fasciclin-4; AltName: Full=Semaphorin-I; Short=Sema I; Flags: Precursor)

HSP 1 Score: 50.8322 bits (120), Expect = 5.736e-7
Identity = 28/84 (33.33%), Postives = 48/84 (57.14%), Query Frame = 0
Query:   48 STWSMD-QPKVFVDYVRGPLKDDVNRFEGNDT-TNNFKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRPEKKAFEIYF 129
            + W  D  PK++V +     ++ V RF GN++  ++FK++ +D N L++GA N +Y +  RDL E  +QRI W       E+ +
Sbjct:   19 AAWVNDVSPKMYVQFG----EERVQRFLGNESHKDHFKLLEKDHNSLLVGARNIVYNISLRDLTEFTEQRIEWHSSGAHRELCY 98          
BLAST of EMLSAG00000000003 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold684_size112211-snap-gene-0.14 (protein:Tk06444 transcript:maker-scaffold684_size112211-snap-gene-0.14-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_328717")

HSP 1 Score: 50.447 bits (119), Expect = 3.246e-8
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 0
Query:   39 GSGSLRQTRSTWSMD-QPKVFVDYVRGPLKDDVNRFEGNDTTNN-FKMIIEDLNILIIGATNTIYFLDTRDLMEIRDQRISWRP 120
            G GS       W  D + K+ +DY+       V +F GN T  + FK++ +D + LIIGA N IY +  + L+E  +QRI+W P
Sbjct:   33 GEGSQSPQWDPWGEDLKEKIHIDYLNQ-YSGLVEKFLGNQTHKDYFKLLRQDGSTLIIGARNEIYNISIQGLVENVEQRITWNP 115          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000003 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 1
Match NameE-valueIdentityDescription
-9.505e-639.19symbol:Sema-1a "Sema-1a" species:7227 "Drosophila ... [more]
back to top
BLAST of EMLSAG00000000003 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 13
Match NameE-valueIdentityDescription
gi|592851764|gb|GAXK01105780.1|1.211e-1849.33TSA: Calanus finmarchicus comp185151_c0_seq1 trans... [more]
gi|592757737|gb|GAXK01196676.1|8.893e-933.33TSA: Calanus finmarchicus comp249902_c0_seq1 trans... [more]
gi|592917871|gb|GAXK01040504.1|1.830e-733.04TSA: Calanus finmarchicus comp147473_c0_seq1 trans... [more]
gi|592917868|gb|GAXK01040507.1|1.892e-733.04TSA: Calanus finmarchicus comp147473_c1_seq1 trans... [more]
gi|592914369|gb|GAXK01044006.1|8.575e-632.00TSA: Calanus finmarchicus comp130302_c0_seq1 trans... [more]
gi|592764426|gb|GAXK01190142.1|2.182e-539.66TSA: Calanus finmarchicus comp1727377_c0_seq2 tran... [more]
gi|592764427|gb|GAXK01190141.1|2.211e-539.66TSA: Calanus finmarchicus comp1727377_c0_seq1 tran... [more]
gi|592875663|gb|GAXK01081914.1|2.881e-440.82TSA: Calanus finmarchicus comp5002335_c0_seq1 tran... [more]
gi|592890975|gb|GAXK01067400.1|2.224e+030.23TSA: Calanus finmarchicus comp16353_c6_seq5 transc... [more]
gi|592890976|gb|GAXK01067399.1|2.247e+030.23TSA: Calanus finmarchicus comp16353_c6_seq4 transc... [more]

Pages

back to top
BLAST of EMLSAG00000000003 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 2
Match NameE-valueIdentityDescription
EMLSAP000000000031.742e-111100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1001:2736... [more]
EMLSAP000000007931.934e-937.17pep:novel supercontig:LSalAtl2s:LSalAtl2s1131:3326... [more]
back to top
BLAST of EMLSAG00000000003 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
gi|8134678|sp|Q26473.1|SEM1A_SCHAM5.736e-733.33RecName: Full=Semaphorin-1A; AltName: Full=Fascicl... [more]
back to top
BLAST of EMLSAG00000000003 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000003 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000003 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 1
Match NameE-valueIdentityDescription
maker-scaffold684_size112211-snap-gene-0.143.246e-836.90protein:Tk06444 transcript:maker-scaffold684_size1... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1001supercontigLSalAtl2s1001:27360..90377 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteSemaphorin-1A
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1001-snap-gene-0.4
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000003 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000003EMLSAT00000000003-695850Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1001:27360..90377-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000003-682769 ID=EMLSAG00000000003-682769|Name=EMLSAG00000000003|organism=Lepeophtheirus salmonis|type=gene|length=63018bp|location=Sequence derived from alignment at LSalAtl2s1001:27360..90377- (Lepeophtheirus salmonis)
ATGGCTACAACCTACCCCCATAACACCATAAAAAGATCCCCGTCCCACAA AAGTCAGGTCATCTTTCTCCTCCTTTCCTGCTTTTACTGGGTTCTAGCAC TCTGTGTCAAAAGTGGGAGTGGAAGCCTTCGTCAAACAAGGAGCACTTGG TCTATGGATCAGCCAAAGGTATTTGTGGACTACGTTCGAGGACCACTCAA AGGTAAATAGTAAGAGTATTTATAAAAAAGAAATTTGTGCCTTAAATACA ACACTACGGTGGAGAAAAATAAGTATTTGTGCTCTTACCCATTTTTTCCC CCCGTTTCTCCACTCATAATTTTTTTTAGATAGTCATGCCAGGCCTCTCC ATGACCTAAAGTTGATCATTTTTGAGTCACTCATTTGTTGTCATGGGCGT ATGTTTTGGGTCATTGTCATACTAGGAGATTACACGGCCATATTAGAAAA GAGTTGACGCCCAACACTTCCATTCTCCCCTTTGACGAAGTGAAAGTCAT CCTTTCCTAGTAGCATAGAAAAACCCTCTAGACATAACGGGGGGATTATG TTCTTGGGTTTATACTTAGTATTTATCTTCCTCCAAACACATTTTTGTGT TTTTTTCTAATTCTGTCTCTCACTATTAAAATAAACCTACCATTAATATT ATAGACTGTTCTTTTCTATGCCAGTTCACAAACTTACATAATCGGCAGAG GATCAAACTACTTATTTCACAACTGTTTTTTCTGCACTATAAGTAGCATC TGTGTAACATCAAATAAAAAGTATACAAGGAGGGCACGTAAAGAAATAAA TTTAAACTAGTTACATTACTCAAAACCATTGAACTTGTCATCTTCAGAAT CCCTAATGAGTACTTCCATAAAGACTTTCCAGCTTTTCACTTATTGCAAA TCTTTTTTTATTGATATATTAGCATTTTTTTAGGGATACATCAAGATTGA ATGTTGTAGTATATGCTCTTTAATTTGAAGACATGGTGTAATAATAATCT ATTCTAAGATAGGATAAACGGGGTAACTATAACTTCATATAAATTTTTTT TAACTTGAAATTTATAGTCCAAAAATATGGAATGTATATTGGGATGCCAA AACCTTTCAATATAGGGAATATTAGATTTAAATTTTTTGCTGATATTATA TTTATTCTTTATCACTTTGATGCTGTTATATGCTCCTTTGTTGATGTTTT TCCTTCTCAAGTAGTCACAAAAAGGAACCATAGRGGATTTTTTTAAACAC CTCCCGATTTCTGGCGTAGAAACTATCCTGAACGGCACCAGGGGCCTCTT GACACCCTTAAAATGACATTATCCTCATTTAAAGGACTGTTCAACCATTT CATCAATTAGTGAGCTTTACCAACGAATGTCTGAAGCACTATCAGTGGAG ACGGTTGCCACTTCTTGAAAATTAAAGGATCCTCCTCTGTGCAGTTCCCA ACCTAGAGGCATTTCAAACTTCCTAGTAACATCAATACACCTTTTTCATA GATATTGCATTCCTTTGGAGTATACTGCGAGATTCATCAGAACATTTTTA ATACTAGCATAAGAGATATGTATCTCTCTTTCAGGAAGTCATTGAGAATA AAACAACTGTCAAGGCAGCGAAGCTGCTTTCCTTCCAAACCCTCTTCAAA ACGTCAAAGTTACCATGTTGTTTATCGTGGGTCCTTTCAATTTTGTTTGT TCTTTAAAGTTTAATGCCCACTACATAAAAATCAGCACCCTAACCTCCTT AAAAAATCGTGTATTAAGTAGTAATGAACATTGTGTTGTTATTCTGTGAA GCAAGAGTATCTTTATACTTATGTATACCTTTACAAACCATTGGTTGGAA TGGTTTGTTTTTTTATTATTGTATTTTTGTTTTTGTAATTTATATTTTGG TAAATAACAATAATAATATTATAGCCAACCCTTGCTGGCTTCCAAAAGCG GAAATATCATATGTTTATAGTCATATGTACATAAATATATACAAATATAA AAAACAAAATAGTGGAGCTTTCTAAATCTTACGTTTTTTTAAATAAATAT AGAATGAAAGGAGAAGAAGCAAAAAAAAAGAATAGGTAAAATTTAAAAAA AAAATCCACATTATATATTTATTAAAAAATAAAAATTGTTAAATATTTTT TTACTATTAAACCAGGGTTGCAACTGATCAGGTGTGTTTACCTATAATCA TAAAGGACTATCTAACATTCTCTTTGTTTAATAATCCCTGCAAAATAAAT ATATATTTGATATTTGCACATAAGACATAATTAGCAAAAAGTGTAATTTA ACTAGTTATCAACATGATGGGCAATGCAATTAAGTCCCAAATGGTCAAAA GTGGAGTGATTCTCTTGTGTATATATGTAAAAAAGTTGTATAAAAAAATG TCTTGGAGGCCCTGCGTGACTGTTTTCTAGATTCAAGAAGAGAGAAAATC TAAGTATAAATAATTCCAATTGCGTGTGCTCATTGAAGACTGAGAGTAGG ACTCACGATTGTTTGGAGAGTTATAAATGTAAGTCCTTTTAGAATCGGAG TAGAATTGAGGATCCAACTCGTAGTGATTCCTTGTTAGATTCGGAGTGGA GGTTATTGTTTATTTCCTTCACCTCATAGCTTCTCACAGCTAATCTAATG TTACATCATGACAGCTAAGCTGATCTTCTCACAAAACACTCTTCATTATT TTTCAGGATGATCACGTTAAATTTCATTTACTTTTCTTTTCTATTATCTA GGCAGATCATATGTATAATTTTCAACAACACTTATCATTATTATAACTAT ACGTCCTTGTTCAATTCGAAGTAGAATTGATAATCGCCATTAGAGTCATT TCTGTCTATGTTTTTGATAGATACATAGTGGTATTAGGGTGTATCCCACT TCCAACCAGAGTTGATATAATACAACGTCATGACAGCTCTCATTTAAAAT ATTGTTCAAATTATCAAAGTAACTTTGTTATTCTTTTTAGCATACAGAAA GGTCATATTTTCAAGAGCTCTCTCCCTTGTGTTCCCTTACTTTATGTATA TAAAGGTGAGCAAAAGTATTTACAGAAGGTTTATTTTTCTGATAAATTAT TTATATAGTCTTTTGTCAACTGACTGTTGTGTTTTCTCGACAGCCAAAAT ATTTATCTACAACATTTATTCCAGAAGTTTTGTTCTCCAACAGCCGAGTA TCTCGACCTTATCGACTACTAGTTGTGATCTGAGCTGAGAAGGAAGGTTC AAATGTCTTTCTACAAAAGCCTCGCCTCCCTAAAGTGCTACACAAATGAA AGATGACCACCTTCATGCCAGTCGTAGTCATCTGGACTACGTGATTAAAC CTAATAGCGGCCATATCGAGTATAAATTGTCCCAAAGTTATATCTGCAAA TTATTATTGCTGAAAAACTTCGGCTCAATTTTGAGGATGGAAAGTTGAGT TTATGGGAATCATTTCACCCGAGTGCATTGTCCAATGAGCTACATTGCTG CATAATTTCAAATATACAATTGAACTATGTACATATATTTAACCTGGCAA TACATTGAGGGGGGTAATGAGGCGGCTTTGTCATTATACTAACAGTCACG TTGAAAACAATCGGGGGTTTCATACACATACTGTTTAATATGCGTGTACA ATGTACATGATTGGTAATACAAATATAGATAAAATGTCATATAGGCTTTG TTCCACTTTTTTGTAGTGAAATACTTATTTATTTATACATTTATTGAATG AATAAATAAATTTAGTTGACTAAAAAATATTTTTGTCACTTCCCAATGTT ATATTTGTAATGCATCAAGATAAAAGCAATTTTAAACAAAAATAAGAAAT CCCCTCTTATTTTTTTACTCCTAACACAGGGTGAAAACTTACAACTTACT GACATGTATTCTCTTGATTTGAGAGGTTCTGGATCATAAAGTTAGAACTG TATGTAATTGMATAAGTAGCCATGTATCTTAAGCACCTGCAGCTTCTTTT GAAATTCTATAATAGGGCGATAAATGTCATTGCAACGTGATTCAAGGCTT AGGGGATCAATCTTCTTCCTGCGGTTAACACTCCAACAGAAGTGCCCAGG CTGACGAGAATGGGGCTCGTAAGACCATCTACAATGCTACCAAGAGGCTA YATTACTACAAGACCATAGCAAGGAAGGAGAACTCTGGAAAGAAAAAACC ATCATTAATGCAGATGGCATCAAGGACAACATCAAAAAGGACCCAGCCAA GTCTTTGTCCATGCTAAGAATCTCGATCTTTTCAAGGAATTCCCTAGGGT CCAGGCAAATTTCCATGACGGCAATGTTGTTTTTCAGCAAAATGGGGCCC TCGCACAGACTCCGAAAATTACTCACACCTTGTCAGCTAACATCTGTGTG TCCACTAGCGGCCGAGTTGAATAAATCAATTTGACATTGGCTATATATCA GAAAAATATAAATAAATGTTATGACCCTCTAATCACAACTGTTAATTTTT CATTCTGTTACTGTGGCAATTAGTGTTTGATAATAATATTTGATTATATT ATTGGCTTTCTATTCAAATTATTGGGATGAGTTCAGATACTAAGGAATTG TGTCTATTATAGAAATTATATGTTATTCTTTTGTAAATTTGGCGCTGTTG TATATATATTTTATTTTTTATGAGGGTAGAGGGTATAATAATCAAAGAGA CTAGGCAAACCTATACTATAGTCTATAAGCATCTGTAAACGAGCAAACGC TGAAACTGCTAATTTTTTTATAATCTCCTAGAATGTGCCTTTATAGGGGA ATGGAGACTAGGGACCTTTCAGCACAAGTAATCAAAGGTTTTCATTTTTC ATAACTAAATTGATAAAGAAAAATTTATTTGTCTATCTGTCTGCAGAAAA CTCATTTTTTAGTGTGCAGCTAAGACTCAGTGTGTCATATTGACAAAGAA AAGTACATTTCCATAGTATTGAAGAAAAGTTCATCGACGGACAATAAATC CAAGCAATTTATTTCCTGCTAGTCATTGATAAATATAATGTAAACAAAGA TACATTCTCTGGAATTTATCGTTAATGTAAATCCCCTAGAAATCTCGCTA GAAAAAGTTTTCTTGTTCGAACGTTGCGACTGATCAAAATATTAACTGGA CTTATAATGTCTTGTAACATACCTTAAACCTTTTTCGATCGTCCAAAMGA GAAGGTGTAAAAGTAGCCGCATTTTATGTGTCATCCAAAAATAGGAGACA GAATGGGCTCTTATCAATTTTATGAGGGGGAAGAAAGACAGCATTAGAAA AAAAATCATAAAAATCATAAAATAAAATGTTCATATGCAGTAAAAAATAA AGAGGGACTTGATTCATTGCATACATACAGATGAATTATTCTTCTTCTCC TGCCAAGAGAATGAAAGAAGATGTTGGAATTAGTGTTGGGTTTGGGTCTG AAAATCCTATGCATGTCTGAGACTTTTATCATTTTTAGGGGATCAAAAGA ATTATGTTCTTTACATAAGTTCGGTATGAACTGGTCCCACAGTACAAATC CATCTAAATCGGTCCCAAAGAAAAATTCGGTCTTTTTGGTGATTGTTAAC TCAAACTGTTTTAAATGTGTTAATTAGTGTTGAGTTTTGGTCTAAAATCC TAGACCTGTCAAATTAATTAGCTCTTTAAAGAAGTTTGGTTTAAACTGGA CTCAAACAAATATTTGTGTTGTTTGATCTAACAAAAAAAAAAAGTATGGA TTGGTCTCATTTAAAATTCGTTCTATACGTATTCCATGGATAAATAATTG TAGACAGCGGTCCATTGTATTTCAAAATGGTGACCATTGATCTACAATGA CATGAAATATGAAGTAAAATGTGTTGAATAAATCATGTTGATACAACTCA TAAATTAGGAGTGGTGATAAAAACGGTTTATATATTTAGACAAAAAAACA ATTAAATTTCGGTCTAAATTCTTAAATCGTCGATCAGTTGAGGGAAAATC ACTTAATATCGAATGAAAAAAAGCTCGGTCTTGAATGAAGTCTCAACACC AGTAGAACTGTACTGCTAAGCGTATTATAGGCTTTAACTTCATATTTTCT TTTCTTTCTTACTTTAAAGTCTTAAATATTATTATTATTATGAAGTAGGT AACAGAAAAAGCAGGGATTTAATCTGGCAAAACTAATCAGCTTTGATAGT AGTAAATATACAAATAATAACTAAATATTATAATTATATCTTCTTTTGTG GTTTTCAAAATTCATAATGGTTTATTTGGTTAAATTTCGTGCGGATTAAT ATAAATATATGGGTTTATTATATTTTTGGGNTTTATTGGCTAAGAAGAAG CTAAGCTTAATTTTATTTTGTATCTTTAGGAAATAACAAAAATAAAAGAC GGGGAAATTTTATTATATCCTAGTTTAAAAGAAATAAGTTCTTACTTTGA ATTTCTATCACCATTTTTCAAATGTTTCTTAAACAAACTAAATAAATAAG CATGTCATATATAAATTTTATATTAAAGTCATACCAGGTCTGGCGAAATC ACCCGCTCCGCATCCTAGGGCCATATACTTTTACAAATGGGCTACAAAAA ATGTATACTCATTTCACCATGGCCTAATTAAAAGTACATACACTCGATAA CTAGGCTGTAAATCGTAAGCATCTTTTAGTATATGCGTTTGGTTGCTGTT GCCAACCAGAGCAGTGTTTTTATTTTCTGTTATAATAATTCTTCATACTT GATGAGATAACATTTAATCATAAAGTGTAGCCGTGAGGGAGTTTTGCTCA TGAAGAACGGATAATAATGCTGAGTAGCTTTTTGGGAGCTAAAAGTGGGT TCATAGTAGCATTGAGGATAGCTATCCTCAGACTAATTCCTGTTTTTGGC CTGTGTTGATACGGAGTGAGATTAGTGTCTCCTTCATTTGCCAGCTGCTC TCAGCTAATTTAATCAAACGTAATTACACCCAGGCTGCTCTCTTCAGAGA CATTCTTCCAATTGTTTAGTAACCATGTTAATTTTCATTTGTTTTTAATT TAATGGTTTACGATTTAAAAACCTACATATATATTTTCTGACTGATGACT TTTGAATGATACGTGTGCCACTAGCTACCTGTTTGCTCACTATATCTCCA ATTTCTCACAAACTGCACACACGAGCAGCCGCATGTTCACAAATAATTAA CAATATTTACAAAAGTAGTAATAAAGTTCTATTTGTAATCTCTTGTATAC AAACTTGTAAAACCAAAAATGGGGCAGTTTATTTCGTTTTGGGCAAGCAA AATTTGAAGAGTGCCTTCTGAAAGGTCTAATAAGGATTTAGTAAGCCCTA TATTCTATATCAAAACTCCGAAAACGGTATAATTGTTTATGCATAATTCG ATGACGTTAGAGTTGAGATTTTTACCTACAAACTCAAAATACATAAGTCT TTTTTCTATCAGATGATGAGTTGCCGAGAAATGCAGTCCTTTCATTGTCT GATTTTTAGCATAACATGTAGTTAATCTTCTAACTTCAGACAGTCATATT TTCTGGAGSTGTAGTTCACATGAAATATACCCTATATTATGACATTTGAC ATATAATTTGACAACGGTGGTCTAGTTGTATAATGGTCAAATTAGATTCA TTAAGTACCTTTGAATGTCATCTACAATATCTGTAAATATGGAGTGGATA AAACTTTACAGAAATAATTTAATTAGAAAATCGGAACTTTTTAATTTCAA CTTCCATTTTTTGTGACGTCATGTTTCTACCTTCATTATTTTCAAATCAG CAACGTAATATGGTGATTTTATAAACTCATTGCGCAATATTTGTTTACTT AACTCCAGTACTTATAAATTTAACAATTATCTCTGAGTATACCCATCATT TGCATTGAAGTATTTATTTTTATTTCCCAATGTATTTATGATTTTTTATG GAGAGGGTTCCCTGTATATACACACATATACATACATCCTTTTTAAATAT TATATACAGATAATGTCACTTCAAAAGTTTACATTTTAAATAAAAAACAG GGCAAGACATCATCTGTTGTCGAAATGACCTTCAGAGTGTTATAATGATA TATTTAAATACAGAGGCATTAATGTTGGGGGTTTTGATCTCAAAATAAAA TTGTAGACCCAAAGGTGTATTTTGAAATTTGTTCAAGGGGTACTCAATTT GTATTTATTTTAATATAATTAGTTTAAGTCATAAATAATTTGCAAATAGA AGAAATAAATCTTAATCAGTTTTAAAAAAATGTAATAACATTGATGAGAT GTATGACTATTGTGGTATTAGTTCTTATTTAGGACCGAAGACCACAGCAG TCCATTCCCAATTGTTGGTCCTTAAAAAATGTAAAATTATGTGGTTTTTT TCCCTTGTTTAATTATGGCGTTATATTGTAAAAAGAATATATTATACAAS TTAATAAAAATATAATGTGTTCGTGTTGTATCATAAAAAAAGGAATATTT TTTGCAAGATATGTGCAATGCTCATAATAAATATAGCTTTTTTGGCTTAA TTAACTATCTACATTTTTACTAAAAATTCCAAGGTCCAGTTCCAAAGGAC AGATGGACTTTTCTCAAAAAGATGAAATTTCCCTCCAAAGTCCAAGGCCC TGTCCATACGGGAATAATAATTATATTTTTTATTGAGATTCAAAAAGTTT TGCGTTTACAGTTCTGCTTAATCCGAGCGGATGAAGAATCCAATGGTAAT ATTATCATGAATATAGAAAAGTACAAGGATCATTGCAATGACTAGTGTGG GATTTCGATCTGGAAATCCTAGAATAGTCTGAGACTGTTATCATTTTGTT CAGATGGAACTAATTCAGTCTGGGCCAATCTCGTAGCAGTAAAAATTGGT CTAAACAAAAAAATAATGAATATGTTTGGCCTCATAGAAAAAAGTATCCT AAAAATAAATTTGATAACAAAGGAAATTGCGGTTCAGGTTTTATGACCGT AGTTTGGATCGAAATATCGGTCCTTCTCGGTCTGGAAAAATCAAAACCGA ACTTCAATACAAATAGGGGGTACATTAACACCTGCAATCTGCAATATACA TACGAATATTGGGATATTTTGGTCCAGGCCACGATCTTAGACCTTAAACA GAAATTGAATCGTTTTACATACTCTTAATACACATTTTTAATAATTTATT GGACTTGGTGAATCCTCGACATTTGTAGGAAAAAATCAAAGGACCGAAGT TTAAGGACTGATCCGAAAGACTTGCAGTACAAAGGACCGACTAGACTGGA CGAAACTGATAAAACATTATGTATGATTTTTTTAGATATGGAAATAGAAG TCTAAACAAAAAAAAATGTGTTTTATTGGTTTCTTAAAAAGTGTTGTTTT TTTTTAAATAAATCTAATAGAAATACCAATATCTCAGACTCTAGACCTAA ATTTAGTTATTTTTTTAAATCGTAAATCGATTTTTTTTTTTTGCATCAAT CTATACACGGATTTATGAATTGTATAAATATAATTTATTCAATCCATTTA ACTATATATGATTCCAGGCCGATGTTCACAATCTTGAAGCACAACTGACG TGTATATTGAATTGATCACATTCGTGTTAGCAAGGAGAGCTATCAAGACC AAATTTTTCTTTGGCACGGATTTAGAACGAACGAATAACTTCGTTGCATT AAAATTTATAACAGTCTCATACCAAAATCCATCGCCAACTAATTTTGGCC CTCCCTTCCTTCTTTATTTTTTAATATTCATAATATGACGTTATGGTAGG AATTTCTAAGTATTTCATTGTATAACTCATGTACAATGAAAGAATTCAAA ATTGGTAGATTTTTTTAAAGGGGTTATATCGGTTTTATGAATCAAATGAA AGCTTTAAAGTATAATTGACAATTTGTGGTTCTCAATATAATGAAACAAT TTGCTTTAATCAAATAGTCTTTGTGACTCATCTAGATCTCACTTCTTGAA AGGGCGTAGTTAGTTACGTCCGCTCAAAATCAATATAATCTTAGACCTCA GATTTGCGGACTGAAATTCAACACACGTATGCATACAAACAAATACGTTT TTTGAAAGGGGATATCATAATGGAATCATACATGGGATAGAAGAAGTATG TAAATATATTTATAGAAACAGAAGCTATTGCTAGGTATACAATATACATA CATATAAGTATATAAACATATGCTCTATAAATATGTGTATATTTTATTTT ATTCTTTTAACTCTCTCATTTCACAAAAAAATAAATTTATTTAAATCATA TATCATACATAGAGGAAGAAAGAACGTTTACATTTTTTTCCTTTTCTTTT TCCATTTTGTTTGTTTGTGTTTATATTCAAATAGTTTTTGGATRTTTGTA TCATAAAAATAGAAGCAGAAGAAAATGGTTGCGTCTTACTCTGCCTCCGA CTTGTATAATACACAATGAACAATAATTATATGATCATTACTTTGTTACA TACACTTAAAAGGAATTACACTTATGGGAGTCCTGAATTAAAAGTATTGC TGGGTGCCTGTCCTAAATTATAAATAAAGATGTTGGAAATGTCGAAATTC CAAGGARTGAGAAAAACTGAGCCAGATAYAATATTATTAAAATATAYAAG GTGTATGATAGTSTGCTCATTAGATTCAGCTGACAAAAGTCGACAATNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAATCCTTGA TGTACCCTTCGAATACTAACGCTGTGCTGCCTTTATTGTGGGCCTACATG ACTGCTGATATTGAGTTTACAAAGCTGTCCAAATTAACTGTTTACGATGT TGCTAAGGCTTTCAAGAAGTTTGATGGGTGGGGAAGATCGTTCTAAGAGC AAACAAAACGCACTCTTGACATCCTAAAGTTCCTACAAGGGAAATGTTGC CTCCTAGTACTCCGGATCTAGACTCCATTGGGMTACTATCTGTGGAGCGT TTCAGAGAGAGAGTCCAATAAACGTGCACATAACACTGTTAACTCCATGC AGGTTTCAATTCTCGAGGCAGTGGACAAGGAGTTTCTCATCAAGCCCTTT GCAAGACTGAGGGTCAGGTGGGAGGCTGTGATTAAGGATTAAAGAATTTT ACTTACATTTTACCACAAATTAAAAATAGTATCAAAAAGGATGCCATTCT CCTTGTAGTATAAAGCGTTTACGGATTGTTTTTTATAATGTTATGTTCCT TAAATCGGTCTGAATCAGTTGCACTGATTCAGTATAAGTAAACATTATAG TAAAGCATTTACTCCATCTGAACTAGGAATCTTCTTTGGAGTCCATATAT ATATAAAGAAATATTTTCTTCTATTGAAAGAACCAGTGCACGAACCTAGG CACATTGAATTCAAGAGAATAATTTCTCCCAAAACGCGTTGTCCATTGAG CTACGTCGTTCCATAGTGCTTAATCGGTTTCGACATTGCAGTCAGGTTTT TTAATTTTACGCTTGCCGGGATTTTGACCCTTTTCACAACTCCAATAATT ATGACAGTMCCCTCCACATACGCAGACAAAAAATATTTCAGACTCCATTG TAGGCCTTCCACAGTAACAGAACGTGTGTGGCTGTAGATCTTCAATTAGG AAAGTGTTTGTTTTATTGTTAAGACTATTATTATCATCATTTTTAAGTAT TATTATGAGTATTTAAATAGTATACATAATATACATAGAGGCAGCCAGTG GTTAAATGTACGAGTATTTCACTCCTTTTCCCCATTTATCATTTCTATTT CTTCTTTTTTTTTTCTATCTTTCCTACATTACATGTATTTCATACACTGA ATTAATGGTTCCACTTTTTTTATTTTTTTACTCTCTCTCTCTCTTGATTA AAGTTATTTCCTTGTGAGTTTAGTGTAGTAAGACTTACTAAATTACTTAC ATACATAAAGGAATTTGTACAAGTTGGAACCAAAAAATGAGCATATGTAT GCAACGAATGCTATTTCCTTGAAAGGCACACTCTTGTATTCCTATTATTT TTTGAAGCAACGAAAGGCTTTTTCTCTTATAGTTATCAAATGAAGATGAA AATTGAATTAATATAATCGTACATTATTAAGTATTTAAAGACTACGTCTT ACTAGACTAGGGGTCACACACCCTACACTCCCGGGCATCCGTTCCCCCCA TTGGCTTCTTCTTAATTGCCCTTTGGACTTGGTCTAAAAACATCGTTTCT TAATTCGTTTATACATGTTTTTTGAGCTGGTATTCCTAAAGCGTTTTGGG AATCCTAAGGTAGCCCTCTGTTTTAAAAAGTTTGATGACCCCTGATCTAG ATGAAGAAGATTATTTTTTATCATGAAGTGTTCATTTGATATGCATAAAG GACGTAAGAAATAAATAGAAGAAGAAGAATCACGGAAAAAAAAATGATAT AAATAAATATTTTAGTTAAATAATTATCCTTCTCTCTATCATTCTCAACA AAACAACAGCGTAATCATTATATACATATCCCAAAGCAAAAATAATTAAT TAAAATCCGTCAATATTCATAATTCAAATGACACAACCGAAACATTAGTG AAGAAGAACATAACAATAAACTCACCATTAAATGTACTAACAATCCCTAT ACTAATAATATTTATGATTAAAACAAGCATTGTGAGACCTTACAATCACC ACCACATCATATTTCCGTACAGTTTCAGGGTGCTCAGAATCATCAAGGAG AAGGAAGCATATCTTGCAATAGCTGAGATGGTAAAAGATCTTATCTTCTC AGCAGCTAAGGTTCATAATTGGTAGTTTTGCTGGCAATAAGAGCTATGAA ATTTAACAGCACTAATTCCAACCCATTTTTCTTTCCCCTGGGGATCCCTA TCATTTTGGAAGCTTAGAATATAACTAGTGGTTTTCTCATTTTTGATTCT GGATCATCCATTCCCTTTACGTTTATGGAAAAATTGTTTTAAAATTCGAA CATCGGGACAATCTACAAAGGCGTGTATAGAGGAGTTAAATAGTTTTCGA TAGTTCTTACATGGAGCATTAGAAAAAAAGAACAGCCAAATTGTAAATTG AGTTAAAAGAAGCGTGTAATGACTGTCTAAAAGGAATTATTGATAGTATT ATCTCTGATACCTTTTTAGGGTAAAATATTATTAATTGTATTTTGTGAAT ACACTAATATATACACACATATACTAATTATAAAGGCCTATAACAGTAAW TTTTGTAAATTATCGTTTTATATGCGTCAGTACCACAGTATTCTATAGTA CCAGTAGCCCGAAAAAAACCAATATGAACTCTTTCCTAGTTCTTTTAAGA AGTGAACGACCATGGTATTATTTTTGATAGCATTTTGACTTTGTCATAAA ATAGTACTTAATGTACAAATCCTAGCCTTTCCAAAAATCGATGTTTTAAT AAACATGTGAACACTACGTCTAGACATAATTTCGAAGCCATAAACTTTTT ATGATCCCTCAATGATTTACTACTACCTCGAAGGACGGTTGAATCCTTTA TTTACCACTCCATTTGTACTTGCTCAAAAAATATGTACGGAGTGGTCCAT TAAAATCTGAACACTTTGAATTTTAAACTTCAACAATATATAATTTATCA TTTAACTATAGAATTTCAACAAAATGAATACCATAAATAGATGTGTGACA GAGCTTTCTTAATCCTTAATGTAGAGACCCGAGATCTCTTGCATGGGCTA TCATGGACTTCAAAAAAGAATTGTCATATTTTTGAGAATGTAATTATTAA ATTTACGAAGGAATTTTTTTTTTSAAACTGCTCAAATCGATTATTCCAAA ATTGAGGTATAAAATATGAACCGTATGTCGTTATAGTGTTCATATTTAAA AAATATTTTTATTCCTAAAGACATTCATTAAATAATTGTTACCTTCGTTT ATGGTGCGTGTACATAAAAAAAATCCCAATTAATTTTTATATTTCATACT TACAACCCAATATTTTATTTGATAGGTTTAGTATTCAATTTTGCAGTACG AATTAAAATATCAAAGAGTTTTAGTTACATTTTAAAACTTTTATTTGATT TACAAAACTTATATATGCCCCGATATGGCTCTTGAACGCTAAGCTATCAA TTTATCATTATTTCATTTTGATGATGAATTGTGGTTCTTTCAATTATAGT CCACCTTGCCACACACGTGAAGGGTTATAAAGAATCACTTGTTGATAACT ATTATAGCGCACTTTTATGTTGACGGGTCATTGTTTTAATAAAGAAATAA AAAAAATAAGCTTAAGTTTGTTAAAAAAGTAGGGGTTTCGTGTATAGAGT ATTATTGATTGTAAGCAAGAGCACACAAAATAAAGAATAAAGACTGACCA TGGTATACTTCATCCTTTTATTGTTGTTGTTATTAATATTGGGGTTCAAT TGAGTTTCTGTCATTTTTGACAACCAGATGAGAACTTTGGTGAAAAGCAC AGGCTGKTATATATGAACAATCATTGTATTCAACATATATATGTTTATAA CCATACATAGTTATAAATATGATCTACCATGTACATACATAATATTTATG ACCAAAAGTCTTCTTACACTCTGAGACCAACAAGGGCTTTAATTTATAAA TCATCAACCAATCCTTGGCATTACCACCACAATATTAATTAAGTAATGAA TCAGCAATAACAATCCATTGTAGAATGGGTCTTGGGAATGAAAAAAAAAA AAAAAACCAAAAATACAACCCACATAATTTAAAGAATGTTTTGGAGGAGA AAAGGAATAATACTCATGACGTTTCATTAGATTAGCTACAATCAGCTGTG ACAAGGGAGGAAGGAGAAAAGGATATAAACAAGGACATTTGCTAGAATTA CTCGGATGTCGATCCCAATTCTACTCTGAAGCCAAAAAGGAATTAAAATT GTAACTCTGTAATAAAYCCTCAGCAGGGGCGTCCGCAGGGGGTGGGCTTG AGGGGTTGTAGCCCCCTCCCCACCCAAAAAAAAAAAACATTTTTACTTTT TACTAGAAAATTTAACTTTGAAATTTTTCCCAAAAATTTAACTTTTAGTC AAAAACGGAGAATTTTTGAAAAAAAATTCAAAAAATTTAAATTTTTGTAA ATAGCAATGGTTTTTTGGAAACTACTCAGAAATTAAATAATAATGACAAC TGCTAAGGAAAAGAAAATTCATTCTTCCTACAACATTCACCGGATTTTCA TCACTGTTTATTATTTTTACTTATTTTTAAAACGCAGTTTGACCATAATA AGCACTCATTGGACCTCAACCCTTTTCAATATCTTCTTCTTCATAATCTT TTATCTTCTTATGTCCCTCTCCGTCATTCATGAGCACGCGTACTTTATAC TTGGACGTTATCTTCTCAAAAATGAAAGGATATTAAAGACAGCTTTAGAA AAACCACTGTTCAGGGGTCAACTACAAAAAAATCAATCTCGTCTAACCTC ATATATTTAACAATTAAAAGTAAATTTGTTCTACTAAACTATTCATTTGA GCCAAAGAGAACCTCGTTATTATTTTCTTTAAAAAAATTGGTGGAATTGT ATACTTAGAAGAGAAGGAAGTCTTATTTTCAACTCTATCCCACAAATCCT GGATGAGTCTAATAGGATTAACCTACATTCTAATTTGATTTCAATCTCTG CAATGAAAGTGTATATTTTTTGTTATATAGTGGATTCATGCAACTTCTTC ATTTTCTTTCCTACAATATACTTTTATACATAATTCCACACTCTTTCCAT ACTTAGAAAGGCGTATAGAGTTTGCAAAATCCCTCACCTTCAGAGCATAA AAACAATCTTGAATAAAAATCAAGAAAATGAGAACCCCCTAATTAATTTC TTACATTAAATAATAATACACAGCCAATTATTTCATATATATATATATTT GAGTCAATAATAGGCCTTTTATGAATTAATATACTTCAGAATTTGAGCTG TAGCTTAGAACCTTGGTTTTTTTTAATTATTATTTGAGACCCGGACGATA CCTTTCAAATACATAAAATCTATTAATTTACTATTATATTATTCGTTGAT GGAAATTGAAGAATATTCACTGAAGAATACAAATATAATTCCCAGTCCAT TTGGTGTAAAATCATGTCAGCTTATTTTTATGTGGACAGATACTACATAC AGCCCAATATTGTATACACATATTTGAGTCAGTCGTAGACTTCATATTCA GTTTTGTGGGATGAGTTAAGACACTCAAGAACTGTAAGTAAATTGTATGC TCCTTATTAGAGTTAATGAACTTATATTCACCCCGATTTGACCCCTTTGA AATTTAGTCCATTAATGTATCATTCTTTAATTGTGAGGGGCAACTAAATT TAATTACATTAAGTGACATTTGCAACAAACTCAAAGGTTGTAGATAGAAT TTGATGATAATTTTTCTATATAGGTATGAATAAGTTCAAGTTGTAATCCA CACTCAATTTTGAGAAAGTTCTTTCCAGCTTGCTTTTGTATTGATGGGTC ACATTTGCAAATTATTATTTTTCTTTAATTTAAGAGAAAAAGAAAACGTC ATATTTCATTAAATTTTCTGTTAAAGATTAAATTGATTTATCAGGAGGGG AGAAAAATATATATAGTTATTTTTTTTTTACTTTTCTTGTTTATCTTCTT TTTCTTTTTTTACGTTTTATTTTTTGTTTTTTTAGTAAAACTATTATAGA GAAAATATGGTGCAGTATACAGCTTTTTCCTTATTTATTCTCTCTCTCTC TCTCTCTCTTTCTTTACTTCCCCCTTTCTCTTGATCATAGTTTGATACTG TGTTGTTTTAGTATGAAAATAATTTTTATGAATTTATAGCTTTGCATTTC TTAGAAATAAGATGAAAATATCCCGCTTAATAAAGTACATAAGTCCAACA AAACCTCTCTTTAGGAAATAAAAAAAAAGGAAAATAAATTATAAATCATT TTTCCCATATTTTCATTCACATAAAAAAAATAACATCTATTCTTTCAGAC CGTTGTAGTAAAAGGCAATCTATGTCTATTGACTACTACTAAGGAGCTTA ATTTTGACAAAAATTGTACTGTACTGCATTTAAAAAGTATTACTATGGAT AGGGTGGCCCTTACAAATCAATGTTTTAAYTAAACTTCCATCATGGTTCT CCAGTTTGTTCTTTCATTATAAAACTTTGTATTCCATCATATTTTTGACT TTAATTNNNATATAATGGTGGTCCTCACTTCTTAATGTTTTGACCTTTAT GATATCTCCAAGTTTTCAAATAACAAAGAGTTATTTGAAAACAATTTTTC TGTAAGCATAAATATATTTCTTGTCAATACCCATACGTTTACTGATTGAA GGGGCATCCAAGGGGTAAGCTGGAGGGATTGAAAGCCCCCCCCCCCCCCA AGTTAACAACTTTTTGCTTTTTACTCGATTTTTATTTGTCATTGGGCCAA ATTATGCAGCAGAGCAAAAAATTTAATATTTGAAATTTTTTTCCAGACAA TTTAATTGTTTGTGTGTCGCTATGAATTTTTGTAATTTTTTGTCAATAAC TATGGGTTTTTATAAATAATTTCCAAAGAATATAACATTTGAAAAAAAAA AATTGATTATTCTTTGTGAATAGCTGTGAATTTTAGAAATTTTTTCCAAT AAATTTAATATTTTAAAAGCTTTTTCGGATAAATTTAATATTTTAAAAGC TTTTTCGGATAAATTTAATATTTTAAAAGCTTTTTCGGATAAATTTAATA TTTTAAAAGCTTTTTCGGATAAATTTAATATTTTAAAAGCTTTTTCGGAT AAATTTAATATTTTAAAAGCTTTTTCGGATAAATTTAATATTTGAAATTT CAATTTTTGAAATTTTTTTTATCCACAAATGTAGTTTTTTGCTAATAGCA TTAGAATTTGAGATTTTTTCTAAAATATTACAAAATATTTCAAAAACCTA GCTTCCTTCCCCCNNNNNAAAGAATGTACATATATATATATNATATAATC CAGTGGACAACCCCTGAATTGTGTAGTTTATGTAGCTTCAATATTCAATC CTRTTTAATACACATTAGATGTTATATAATATTTATCATAATTCAAAGCT CTACATCTACAAAACAAAATATTCTTTGGTGCACTCTWCCCTTTCAAGTT GATASTGGATAAATTTACATTTATTCTTTGTGTTGTAAAATTAAAAAAAG TATGGAAATGTTTTGAACTTTTTAGTTCAAAGTTTAAGATCCAATGCTAC AAGTCTCTGAATGTTGTTCACATTTTATCATTTTTGGTGTATGAGTATAT CGTTTTCATATTAAAACTGATGGAGAGTGTGAGAGAATGAAAATAAAAAC ATTATTTTTTAAGTACAGGATAAGAACCACCCTAATGTGTGTACATATAT GCAAAAATAAGTCATATGGAGTTGGCACTTATCAAAAGTCATATATGTAG TAAGTTTTAAACTTTGCCAAATCTGATTAAGACAATTGATAAAGTTGACT AATACATTTTAAAGATTGAAGTATGCCAATATTAAGTAACTTATATGTCA TTGACATAAATTATGCTGACATATTTTTGCCATATATATTGTGATTTCCA CCGAAGAAAATACAACTKCTRCCGCCACAATTTTAAGATGCGGAACTACG GAAAAGAATGTTTGAGCTTATTTTGACATTGTGGACATTGCCATCAAGAA AATGTATAATTTAGTTTGGCAACGCAAATATCGGTAAAATATGGATCATT AGCAAACAAATTTTTTCTTTGATTCCAATATGGACTGAGGGCAATCTTGT CTTTCGTTGCCAGACAATATTAAGAATCTCATTACAGTCTCATACAGCCA AGAAGAACCAAAAAATCTGCAGCATCAATAATGTTGCCCCTTGGTTTGCC TCCAATTGGCCCACCTCTAGCCCTGACCTCAACCCCCTCGACCTAGCAGT TTGGGGTGTCATGGAAAAAAAGTGTCTATTGCACCTCTCCACCAAATTTG AATTCCCTCCGGACTGCCATCACGACGGCGCTGTACCTCATGTGTGCGGC CTTCATCCTGTAGAGCTACTAATCTGTTTTCTGGTGCGTTGAGGCTGTTG TTTCCTGTGATAGAAGACACATTTATATATAAAATAAGCCTAAATATACT ATTTAAACATGCCTATCACAAATTGGTTTGTAGTTATTGTTTGTTGATTC CATACAGATCCTAATTTTTGTAGTTAATTCATGCTACTGTACGTTCCTCA CTCGCTTTGCGTCATTCATGATTTGGGACTAAAGACTGTAGTCTGGTCCA GTTTATTCTTGATCCGGTGCAGTCCAGTTCTAAAACTTATAAAGTTTGGT CCTTGATGACGTCAAATAACTGTATTTCTATCCTTTTTTAATCAGTTCTA GTACTTCAGTCATAAGGACTGACAGTCTTATCGACCAGTACTAAGTAGAG GTCAAAAGAAGTGCGATTAGTTTCTGCAATACTTGCTATGAATCAGTATT AATAATTAATAACATGACAGAACCGAATAAATAAGGACCGATACAACGCT TTTTTTCCCAGTTTTTATAGGATGATCCTTAACGTCAAAAATTTCAGCAT CCCTAAGGAAGAAGAATAAATATCCATAGCTATTCTAAAAAAAAAATTGT TTTTTTCTTTTAAATAATTTCAACAATTAAATTTGAAATATGATTTTTTT TTGAATTTTTTTTTAAAAGTTCATAGTTACTCAAAGAAAATTAAATTTTT TGATACAAAAATTTGTAAAATTGATTAGAGTTTTTGATAAAAAAATTCAA ATATTAAATTTTTTGATAAAATATACATTTTTTAAACTTCCTAGTAAAAA ATAAAAGTCCTTTATGTGCGGAAGYAATGAAGCCCCTCCAGCCAACCCCA ATTTTTTTTTTGTTGCATATGANNNNNTTCATACAGTCTTTAGAACCTGT CCTAAGACCGCACTGAGCCCAATATATAAAGACTGATACAAAACTAGTCC CCACTTTGTATACCTTGATCCTTAACGTAAAAAATTTCGGCATCCCTAAC AAAGAATGTGGAAACAAACAATTTGTTTATATTCCTTGCAACATCCGTAG AGGTAGTCAATGAATTGTGTTTCAATGAAGCAATCATAACTCAAATAACT TTATAATGACAATAAAAAAGGAAACAGAAGAATAGAGTGTGAAGGAAGAA TGTGAAAGTTTATAATAAACGCACCACACACAAGAGTACAAACATAGCTG TCCGTATAAGTACATTTATATAAAATACATACATACAATGCTCAACAAAC AATGAAATTGTGAAAATAGTTATACATACACACAATATTTATGAGTTTCA TGGGAATAATAATGAAGAAAATATCCCTCTTCCCTGTATATCTTACTTAG GTCTCCTTCTATATATCTAAAAACCTACATACCAATAGGGGAGACAAGGG ACACTTTTTACTCAATTAATCCGAACTGGTTCTAAGGAAAGAGAGGTCAT GTAAAATCAATCAAGAATGTGTTTTTTTTCTATATCTCTAATAATGATTC GTCTAAAATTAGATATATGCGCAGATTTCATCTCTTGCGCAATTCATTGT TATTGCATCTTTAGACTAAGACTCGTCTAATGCAATTTAATAGAACTCAA CGTTTCGAACAGAGTTATTTATTTTTCTGTTGAATAAACTAGAAACATAA ACAATCAGTTAAAATCAGTGTTCAAAGTATTTGAAGCATGTGTATGCTCT GAAACATTTTAAAAGTTATTTTCAAACAAAAAATCCATAACCCTAATTAT CTACGTGGTGTATTTATATTCTAAATTTTTTTTTATCAAGGTTAAGTGAA TACAACCATCTTGTCTCCTCTTTCCTTTTTGGTGCGTGGACAAAACGTGG ACCAGACAAAGGTCGACCGTTGAATATAAAATAAAGGGCTACTCCAAATG GTGTTGCTATATATCCCATTCAGACATTTCCTGCCTGAAACATAACCCAG CAACACCGTTCCTATATAAACTACCATTAAGAGTCCCTCCCAATCCCCCT TATACATGTTGGGGCTGTTTTCAGTCACCGCCATGTCCAAAATAGAATGA AACCTACCAACACTGTTTAAGTAACCCTTAAGAGCTCCTCAGAACCCATA TGTACCCCCAAATGTTTGAGCTTTTTTCGGGCCCCAAAATGGGATGAAAC CCAACGTCACTATTTAAATTTACACACCGAAAGGGCCCCCACAATTCGAG ACTGGTTTGTGTTTCATCTCATTTCAGGCCTTGTGGTACCCGAAATAGCC CCAAATTTCGAGTTATAAATGGGGAAAAACAATCCAAAAAAAGTTGTTTA ATTATGTTGTCATCATTAATTTTAAATTAAGTCACAAATCACATTCGATG TGCCTCATTACAGATAATTGCATCAAATCGCCCATAACTTATATTTATAT GTAATGACATATATGTAATTAAAGAGTATTTTCTTTCTATTACGAGTTGT AAGAAAAGTAATAATATTAGCGTAATATATTACTAACCAAATTTTTCAAA AACTGATAGCAGAATCAGACGAGATTAAACTGAAAGGGACCTATTTCAAA TCCCATATTAAGACAAAATACAACTCACTCATTTATGAATTAATTACGCT CTTATTATATGATATTTGACGATAAAATAAACATTTAAAAGAATATATTT AAAAATAGGTTCGAAATTTGTCAATTAAACTCAAAGTCAATTATTGTTTT ATTTGCATTTTAATACCCTACCTTTCTCTCTCAATTAGATTATTTTCATT ATACATACATATACAAATAAAAAACTCATCACTGGCTAAAAGATATGCAT GAAACAAAAATACATTCAGCTGTTTAAAAAATTAATTTAATTCATCATTC TACGGTGTTTTTTTTTCTCTCTCTCGTATACATTCGATTATAACTTTTTG AGACAGTTGATGTGTACAACTTTTGATTAAATTAATTGGTTTGCAAACCT ATGAACATAAAAAAAAAACTACAACAAAACACAAAATGTCACTCTTGTAA ATAATATATCCATACTTTTACCTGTAAGAAGTGAACAAACACAAAAACAA TTAGAATTGTCTACTTTTCTACATTTTTGTTGAACTACAAAAAAGATGTC AGTTCTTTTGACTCTTGTAAATAATACTTATAGCTTAAAACAATATGGTA ATTGACAATTCTACTTTTTTATAATTGCAACCTGAACAAGATTTTTTTTA TTTCCAAAACTGTTCTCNATTATTAATTTCGTCTATACATTAAATGCAAA TATCTGTGTGTGTCTGCGAATCACGGCCAAATCAATGAATGGAATTTGCT GAAATTTTTTATATAGGTACTTAAGGCTCAAAAAATGGTTTTGGTACCAT TTTTTGGCCTTCAAAGCCACTGCAGCCTTAAAATAGTATTTTTCTAAAAA CTAATTTTTGGACGAACAAAAAATTATTTCATATAAAACAAAAATAAAGT CTATAAAATTTTAAAAATTGTTTTTCCTGCATGTTGGTATGTATCTTGGC ACACTTTTTAAAAAAAGGAGATTATAAGATTTAGAGAAGAAAAAAAGAGA GAATAGACAGTGGATTTTTGACAATAATATGAACAATAAGTGAAGGACAG TTCAACTTGAATATTTTTTCTTCTCTAAACATTAAAAAAAAGTRGACAAA CTGCAACTWTTTTAAGGCCATCATGGCCTTMAAGCCAAAAAAATAACACC AGAACCATTTTTTGAGCCTTAAAAGCCTACATGAAAATTTTCAGCACGGA TACGTATGGAGATTATAGTTTATTTCTTCGATTTCAAAGCTGTTTGCAGC TAATTTAAYCAACTGTCATGATAGCTAAACATTTCTCCTCTCAAACAATC TTCAAATTGTAAGGCTTAACATGTTCATTNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTATTATTTTTAACTATGGTTATAAGTGTAAGTCGTTGTTGGACT TGGAGTAGAACTAAGATATCACAAAGGAGTAATTGTATGTTCTAACTTGA TAATCTGAAGAGTGTTTTTATTGCCCAGAGCTGTTCATTATTCAATTACT CTGGAGGAGATCAGATTTAAGAATAAAGTAACTACAAGTGTTTTCACTCA TGAATAACAGAGTATATTTATGAGGATTTATAGGAAAGTTATACGTTTAA GTTTTTGGTTTATTATTTTTAACGTACCTGCCGTTGATATTATTTGAATC TATGTCTGTAACTATAGATTCGATCTATATTTAATTTTAAATGAGACGGA TCCAACTGAATTTATCTTTTGGAGAGATTTAGTGGGAATTTTTTCATCAA GACTGGTTCAAACTAAACTTATTTAAGGACCAAATTAGTTATTTCCATAA AAATCAATACGTTTTCGATTTTTTTGGCCCATCTAGATCGAATTTTTCAT GGACTGAATTAGTTTCCAAAATTATAACGGTCTCCGACCAATCTAAGATC CCAACACTAATTTGGACATTCAAAAAGTACCAGAAGAAAAAAAACCTTGG AGATCCAAGATATAATAAGGTATTGATATGATATGAAAAATAGGATATAA TAATATATACGAGACCTCAATGTTTGATAAATTATAGTCTATTACAAAAA TATTTTTGTTATCATGACTGTATTTTCGGGGATTTCAACCACTTCTCAAA CAAAAACAATTTGTTTTTTTGTTATTAATAACATAGCCTAAATTGATATG TTTACGCAAATGCTTCTGCAAGAAGCCTTCTCCAGCCTTTCACCCCTTCA TTAAAAAAAGAAGGTAAAAATAAAGGCAATGGTTTTGTATTATGTATTTT AAATGAGGCATTTCATTTATGATTGTATAATGTTAATGTACATATAAATT ACAATTTAAAGATAAGAAATTGTATTATTAAAAAAAAAAGTATTTTCAGA GAGGAGGAAACTTGCAACGCACACAAGAACCTCATTTGAGAAATCCTAAT CTTAAAGATTAATTCCGAGTGCTAAATTACTAATACTTGTAACAAAAATA GTGTGTTGTGGTTAATAAAAGTACTAGGTTGAAGAGGGGGAGAAGGGGAT TAGATGAGGTTTTCACATGAAAATGTTTAAAGGTTAGTCCAGTGTTTCTC AAAGGGGGTGCCGAGGTACATTGGGATACCCTTGATGGCTTTAAGGGTGC CGCAATTAAACATAGTTTGAAATCCAGTTAAATAAGATATTGAAATACGG TGTGTGTAACCAAAATCAGAACAAGCATACAAGGTTTCAAATGGCGAATA ATGAGTAAATTTACAAGTTTGAAATCTCTACAAATGTTTTATAATTGTAT AAAGAAAATTTGAAAGTAACTTCTTTTATAGTTTATTTTGATTTAAATCA TGGAGCAAACAAAAGTAATCAACATCCTGATTTTGCTCCGTGCTGATATA AAGCCCGGATCATTGCCAACCAGTTAGGCTGCTCCTGCACCACCGTGTAT GCGGTTAGGGGCATATTTGAAGGATCTGGTGAACTTGAAGCTTAATGTTC AAAGTTTGGCTTGTGTCAAATTAATATGATTTTTGTCATGTATCCCTGCG GCCCCATCATTACAGCCTAGGACAACATGGATGAGGCCTATATAAGGAAG ACTTCCTCTGTCTTTGAGGCTGKTGTAGCAGCTAAAGGGAATCATATTGA ACAAATTGCAACTTAAATATATTCTGATTTATCCAATAAAATTATAAGTT TCTATCTTTTATTGTTTTTGAGATATGAGATCAAATATTTTTGTACTAAC ATTCCTTCATATTTTGGTTACGTAGACTGTACATAAATACATTCTTTTTA AAAATGAAAGGATACAATTTTAAATTAGTTGTAGATAAACAACTATATGA AATTAACCCATTCCCAATAATGTGTCAAGTCAATGGCACACTTGAGTCAG TGTGACTGCAATGTGCATCACATTTTCAAAAGTAAATTTCTATTGCACAC ATTTTCGGTTCTAGCATTTTATTTAAATCATTCATTATTACTTTTGATCA TAAATCTTTAAATATAACCAAAAACTATTGGTTGGCCGCTCATTAAGAAT CATGAAGTATGTTAATATTTAGCATAATTGAATTTAAAGTCTTAACGTAT TCTTCACAAATAAACTTCAATTTAATTAATTGTTTTGAAATTGATAATTT AAGTCTCTTTAATTTTTCAACTTTCAGTTTTGCTAGCTTATAAAATAACT CAAGACTTTCTTCACATCATAATGTATAGGTATAAGCTTATAGACTCACA AAATGACATAGTAACAGCATTATAGTTTTTTGCTTCTCATCTTMTGATAG GATTTCAAAATTTGATACATGACTTAAGTGACGACATATTCCATAAGTAA TATATAATAATTTATATCGTTTATTACTTTGTTTGCAAAGTAATATCATA ATACTCTTCGTTACTGGAAAAGTAATGTTAAAAGTAATATTACTAACTAA TGAGTTACTACCTTACACTGTTGGAGAGTATCCGTTTATATCTGGACATT GGTCATATATCTTTCACTACTATTGACGATTAATTTTCGGTGCTTCCCTT ATTGTATGAGTACTTATTTACAAATGATGACTAAGCAAACAAATATGTTC ATATTTTTTGTGACGTAATTACATATCTATTTATAACCACTCAGGAAGAA ATACATACTACTTATATAATATGAAAAATATAAATAGGGACCCACTGCAA GTCTATGCCTATAATATCTTGTTATATTTAGTAGTCTATTAAAATGTGAA CACTCTGAATTTTAAAATTCAAATATATATATATATGATTTTTTGTTATA GAATTTCCTCAAAATTAATACAATTCATAGTAGTGTATCTGAGCTCTATT AATCATTCAGGTAGCCACCCTTAGCGGCAATGATGACTTCTAGACGGTGG CGGAAGGTCTGGCACTCACTGCGGTGTATTCCTCTGTCATGGAGTTCCAG TGCTGGCTAACAGTAGCTTTAAGGGCTTCGAAGTTTTGATGMCGGACACT ACAGGCCTTTCCTTCGACAKGCATCCAAAAGTTGTAGTCGAGGGGGTTGG CATTGGGGCTGTAAGGGGGAGGGAGCCAAAAGTGTCAAAAAAGTGTTCAG AAGAGTCTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNTCTTTCTCWCCKACGTTTTTTGACGGCATAGATGGT GGTCCAGTATACGTCAACAGCTTGGAGTGCTTGAATGGAAATTGGTTGAT GACGTTCAAGTCTCATTTTCTTGACCTGTGCATAAGCTAGACAGTTCTGG CTGGTTTTATTTTGATATTAATTGTTGATGATTTCTATCGAAATATGAAT AAATTTACATCACATTTTCAGATTCTTTATATTTCAATGGACCACTCAGT ATAAATTGAAGGGCAGAAAAATAATTACTGTTTAATGTAGGGAAAATGCT GTAATTATAATTAAATTCATATGATTTTATTTGTTGTACTTTTTTAAAAC AATTTACACTAAAGATGGATAATAATGCAAACTTCAGATGGAGAAGTTAA CACCCCAATAATGAATAAAAAAGAGCAKAAGCCAAAAAAAAATCCATACT TTCTAAGGTAGTACTTTAATTACAAACTACTAATCTAAGTATAAAATTAC TAAGTAGCTCATCTATATAAAATGAACAGATGGTCATTCTGTAATAACAT ATAAGTGAATGATAATTATCTCTTGATAACTATGAATTATTAATTCATTT ACAAAAAAAAAAAGATTGCAAAAACTGTGTGGTCATTATTTTTCTTTATT TTATTTTTTGTAGGATAGATATTTACCGTCTGAACAAAAGTGTTGAGAAT CAAATCTAATGCACTTAACAAATCCAATTAATCACATATTTGTATCTTAA ATTAAAGAGATTTAGTAGCAAGTTGGTCCACAAAAAAAAAGTGTTTGACG TTCTATAGAGTATACCTTGGATAATGCCATCAATTCCATGGATATTTCCA ATATCTGTGTCTCCTTTAGCTGTTGTTGTTTTTTTTCCCCGCTCACATGT ATGTTAAGTAATGACCTTTTCAAAGATAGTAGTGAAAGAGTTCATCATGC AAGGTTACCCTTACATGACCTTATATAGTACACAAAATCATCATTTATTA TTTATTTTGCATAAATAAGCATTTATATGTAATATTTCTGTAGATATCGG TAAAAGTCCATAATATTTGCAAAAGAGGCCTTTCTAATAGATAATCGTAT AAATAAACAAATATAAAACGCTGATCACAGAACCTTTTCTTCTTTATCGT AGATATCTTATAAAAAGATTTATGTTTAGWGCTGTATAAAATATGTCCTG TTGGTAAGTAAAAATAAAATGAAGGGGGCAATCGTGACCATTTGAAAAAT ATTTGGGTGGAGAGCAGAATAGGTACCGCGACGTTTTGGCCAAGAGAGAA CCCCAATAAGCGACTTGATGTATAACTCCTGAGCAACCCTTATTTTTACT CTCTGTATTTTATCTGCTCACACACTAGTTTTTACTTTATACTAAGATGT TTTCTCTTCAAGAATGAAATAGTTATGATTGCAGGCTATGAAAATAAAAA AGCTTGTTCAGACATCACTCATAAAAGTCATATTTTACGCAACTCTATGT ACTTATATTTGTTTAGTAACTACGAATTCAAAACGATTGAAAAGATTGAA TTGATTTTTGTAATATAAGTCCCAAAGGCTACTTTTTTGCAAGGTTTCTA TTAAATACAACTTTTTATTATAGTACATCAATGAATAATTTTTGCATACA AAATCATTAATAGAATAGCCAAGGGTAATATATAAAATTGTAGAAAATAA CTGAATTTGTATATTAGCCAAGGACACTCAGGTGTTTGGGGCATTAAATA AGTATTCATGTTCGGTGCATTAGTGAAAGTCATCAAATTAATCTAACAAC AAAGTTTTTAATAGTTTTTTGTATATTTAAAACAAAATACTTTCATACCA ATCTAATGAGTAAAAATTAGCTGCCCCATTCTTTTTTACTTCATATAAAC TTAAAGATAGCATTGTATAGGTCTTTATTTATTCGGTCCAGTGCAGTTTA AGGACTCTCCCTCGTCAGTTCTAAGGACTGTTAATACTAGAACTATTTCA AAAAAATAAAAATAAAGTCGAGTTACGTCATTAAGGACTTAATTTCATAG GGTTAAATGACTGATATTCAGAACAGAACAGGACCGGGACGATTCAAACT GGATGAGACTGCGGTCTAAAGTCATAATTAACTATAACACACAAATTATA TACAAACATATATTTCATAGACACATTTGAGTCAATTATAGTCTTTGTAT TCAAATTTGTGGGATGAGTTAAGACACCCAAAGAACTTTAACTGTAGTTT ATGCTCCTTATTAGAGTTAAGAACATACATTCGTCTGGGTATGACCCCTT TTAAGTTCAATCCATGTTCCTTTGGGATATAAATCATTTTAACTTGTTTT TATGTTGATGGTACAATATTTCATAGGCATATTTGATTCAATTGTAAGCT TTGTATTCAAATTTGTGGGATGAGTTAAGATACCCAAGAATTTTCTTCTA TAGTGAATAAATAACCTTTATTATAATTAGAAAACTTATATTGCCCTGAT ATGGCCTTTCAAATAATATACATATATTAATTTATTGTCACGATTAATTT TAGCTACTTAAAGAAAGGATATTTTCTACGACACACTCAAAGGCTTACAC AGAATAATTGGTTCGTAGAAATTCACGAGTACTCGTCAAAAATGCAAATG TAATCTACGCTTAATTTTGATAAGAAATATTTAGCTAGCTTCTGTGTTGA CGGGTCACATATGTATTAATACAAAGTTGGTATATAAACATGATATAAAC ATTTGACAAAAAAAAATTATTTATATATATACTTTTGTTAATTTTATGGT CATTTCCTTTAGTTGAAAATAGTTTAATTGAAATATATGTATTAAAAAAA AACTGTATACTTGCTTCGTATATTAAAATACAAAATTAGAACAGAAATTA ATTAAATAGATACAAAACTCATTAGGAGGTAGACCGTAGTGGGTATATAT CTGAGCAGATGCATAAGTAGGCATTAATATTATTATTATTATTTTTTTCA TTTTCAACTGGAGACACGATTTTTAACACATATGGTTTAGGTATTTTATA TGAACAAATCCATGCAGACTATGAATTAATGATGAAACTTGTATCTTTAT TAGAGTGGTCCTTAAATTATTCAGTTACAAAATATTGGGGAAGGACATAG TCTAAAAGGGCTTCTTTTGGATAAAAATGAAGAAATTGAAAGTTTGAGCC ATAATAAAACAATGTTTAGGGATTTATTTGTTCTGGAAGATTTTAAATTT CATAGTCAAATTAGAGCAATCCGCGAAAAATAAGGTACTAGAAAAACTAC CCTCTAGAAAATTGCCAGTATTTTGTTCAAACATTATGATATCACATTTT AAATTCGAGTTATATTATTAATGACAAATATCTAAACATGTTTGTTTGTT CCATTTTCTCAAGGAGTACCTTTAAGTATGAGTAATATTATTGCAATACA ATTTCCATACAATTTTTTAAATTCAATCCAATCTTCTAAAAAATGGATCG AGAGGATTGGTAAGGAGAGTGGGGGGATAAATAGCTTAGGGGCTCTTAAA ATGTGGTGGAATACCCTCTGTCATTGCATTGGCACTGGGGMAGTGTGGGA TTAGTAAAAACCACCGGCAATACATCCAAGGAACCCCTCTAATACCAAAA AATAATTTGAAGCTATCAGTTTGCGTGGATKCCCTGGARCCTNAATAKCC CCCGCCAATTTATCCAATTCATCCAAAGAGCCCCTTTAATACCAAAAAAA TAGTTTAAGTCCTCAGTTTGCAAATTGAAAACTGCATTTTTTATATGTTT TTAGGGCATTTAAATCTTTTTTTCTTATGGATGCTACGTTAGATGCAAAT GACATTATTTGTAATTCAATTGTCATATAAATAGTTGTTTTTTCTTTAAA TTTGTAATTTATAATGAGTTATTATTCATTATAAAAGTTTGATCAAAATA CCAGCAATTTTCCTCCAGGGAAATATTCCCCAGAGCGATTATCCAGGCGC AGAATATGGATTACAATGGTAATTCTTAGATCATATAGAGAAATCATAAT TCTATTATGCTTACTTGTACTTAATCAGTGCAACTCCATCTAATCCAATT AAGTAACATTAATTAAAAAGATGTATTGCATATAGTGCGGTCTTTTTTGG TCCTTGTTGTATTTTATGACGACATCCCATGAAGAAATAAAGGCTTAACT GTGAAAAGAATGAATGAATAACCTCATATTCAAAATTTTTACTAAAGAAA TCGCTCACACTTTAAAATTCTGCATTTTTGTGTGTTGTCGAAATTTTTGA ATATTTTCTTAATCCTTGTGAGAGTAATATTAGTTGCTAATTTTTTTCTT CTTTTTTTCCTAAAATATCTAAAATTTAAATTTTTCAGAGTAAAATTTGA AAAATCCATAACTAGTCAAAAAAAATTAATGAATGAAGTTTTTTTGAAAA AAAAATTTTAAAAATTATATTTCTTGGGAAAAAAAAACTTCAAATATTTA GTTTTTTGTACAATAAATTTAAAAATTAATAGTTATTAAAAAATTGAATT TTGTAAAAAAAAAAAATCCACAGCTGTTTACAAAAATTAAATCTATAATT TCAAATATTACATTTTTTCAAAAAAAAGATGCAAAAATGTACATTTACTA GCAAAAATTTAAATTTTTGGAAAATAATTTCAAAAATTAAATTTTTTGGG TAAAAAAATTTCAAATATCATGTGTAATGGGAAAAAAAATCAAATGTATT TTAAAAAATTGAATTTTTGAAAAAAAATCAAAAGTTGTTTCCAAAAATTA AATTTTTTTGAAAACATCAGAATTTAAATTTTTTCGAAAAAAATTTCAAA TATTAAATTTTTTCGACAAAATAATGTTCACGAACGGAGGTCCATCTATG GTTTAAAAAAAACTTAAAATTTGCTTTACTTACTTGTAATTTAATGACCA CTCTAATATTTATGTATTCGGGTATTATATGTAAGTAGTTACGAAGGTAA GGCTGAGATTCTTGTTTCCTATTCAAGCAGTAAAAAAAGCCCCCCCCCCC CCTCTCCATTMTTTGTATAMATGTATAAGTTTAATGTAAAGGTATGTTCA AAAAGAAAGGAGAAGAAGAAGAAACGAAAGAAACTAACTTCAAAGTAAGG GAATAAAAATAAAAATGAGGATATGAATTATACATTTTACCTGCAATACC TATTGGATGTACATATTTTGAAGAAGAAAATTTATGTATGTAGATATATT TTAATTGCAAACAGTTTATTTACATAAAAGACCCCATAATTACCTTGTTT TTTGGTCCAATAAACTTTTATTAAATAATTCTCTATTCCCTCACTCAATG TAAGAAAAAAGTATATATATATATTTTTTAAATCTATGTAAAAACATTGC ACTAATAAATATCAAAGTAAGAGATCGTAGATTATTTGTATTTATAACTC GTCAACACAAAAACAAGCAAGAATGATTTTTCTCAAGATTGACTGTGAAT CACATTTATATTCAACTTCTACTAATAAATATTTCTTACTAACCCTTTGG CTGTGTTGCAAATTGTGTACCCAATATGGATCGTTACATTTTTTTTTTTA AATGGTTAAGGGACCATATCTGGCCAAATCAAACCAATAAAAGGCTCTAA AATATAGCTAAAAAGTTTGGGTATCTTAAATCATACCACAAATTTAAATA CTGCAAGTATAATTGACTTGAATAAGTGTATGAAATATTTGAGATGTATT TATATATATGGCTCSTCAATACTAAATCAAACTAGAATTCTTTTTCTACA AATTTAAGGGAACATCTCTTTCAAAAATTGTGGTCAATTTTTCCAACAGC TACTTATTCATATTAACCCTTTGGGACCATATCTAAAGTACCGAAAATGG ATCGTTACATTAAAAAATAGAAATCAATGGATTTTGTTATTTAAAAGGAC CTGGGCACAATATTAGTCACTTACACCAAACCAAGACTCTAAATTATAGT TAAAACTTTTAGGTATCTTAACTAATACCACAAGTTTAAATACTCAGCAT ACAATAGACATAAATGTGTATGAAATAATTGCATTGTTTTTATATATCTG GCCCGTCAACACTAAAACAAACTAGACATTTTTCTAACAGCAAATTATTC AAATTAACTCAAAAATTAAATCAAAAATCCATAGCTATTCACAAAAAAAT GAATTTTTGGGGAAAAAAGTTCGAAAACCAAAGTTACCTACAAAAAATTA ATTTTTTTGAAAAAAGAAATTCAAAATGAAGTTTCAAATATTAAAATTTT GGAAAAAAAAAGTTCAAAAATCAATATGTATTCATGAAAAATTAAATTTT TTGGGAAAAAAAATCAAAAATTAATAGCTACTAACAAAAAAAGTGAATTT TTGGGAAAAAAAAATTGGAAAACCAAAGTTATTTACAAAAAAATAATTTT ATGGAAAAAAAATTTAAAAAATAAAGTTTCAAACATTAAATTTAAAAATA ACATCAAAAATCAATAGGTATTCACAAAAAAATAATTTTTTGTAGATAAA AAAAAATCCCAAAAATTCATTTTCTTGTGAATAGCTATTGATTTTTGAAT TTTTTTCCAACAAATTTAACCTTTTGTTAATACACATTGATTTTTGATTT TGATCAAGGATATTCAAACTGAGACCCAGGAGTATAATCTACATTTCCCT GGATAGTAAATTCTAGTATTTTTAACATATGACATATATGTAGCGAGTGG TACATTAAAGTCTGAAAACTTGATAAGATGTATTTGATACATTATACCGA GTGGTGTATTACAATCTGAACACTTTGAATTTTAAACTTTAACAAGATAT TAATATATTAATAAAGAATAGCATTTCATCAAAATTAATACTATAAATAG ATGGTTGTCCGAGCTCTCTTTATCATCAATGTTACCGCCCTTAGTGGTTA TGACGGCTTCCAGGCGATGGCAGAAGGTTTGTCACCCGCTGCAGATGTGC CCCTCTATCAAGAGCGTAAGCTGAGGTTTTTATAACTAATTGATTATGCT TTGATATATCAAAATGTGAATTAATTTCAATCACTCAACCTTCAATCATT ATTGAATTTGTATGTGTTGAGATGACAGAAATACTATTTCTTACAAAGTA TTACAAAGGTGACTGATCAAATTGTTAATATTTTCTTGTGACCGAGAGTA TTCAACTGTCCTTCTTGACCTCTCTAATAAACGTTATGGAACAAAAGAAT ACTGATAAAATACTGATAGCATTTACTACTTCCAAATCTTTAGGCTCTAT ATTAAAGACATATAAGGAGTATTTGTTCCCAACTACTTAAAAAGCCATGA TAAAGTATATTTATTTAATTTAGTTAATTGATTTTTCTTCACATTTTTTT CAAATGATTTTTATTCTGTGTACTTAAAAAGATTGAATAATAGATTATGT ACATATATAATCATTGAACCATAAGCTTTTACATTGAGGGATGATTTCAT AATAATGTATAGTAGGGTGACTCTATTTCTGATCTTAAAAAATCATTTTG CTGACGTTCATATTTTACAMCACAAAATAAACGTGGAATGAATGTAAATT TTTTCCATTAGCGAGAAGAAAAGAATGGGTCAAATAATCTTTGGTTTTGT GGATAAAGTACTTTGTAGTAGAATAAATATTAAATAACATCTAATTGACA ACAAATCTTGAGTATTACTCCCTATTTTTATAAGTAGACTCACACGTAGC TACTCAATACTTAAACGTTCTCCTCAATTTTAAAAGAATAATAAAATCAT CACGTATATTCGAAATCCAAAAAGTGGGATTTTAATAAAGGATAAATAAG TAAGGCTACCGCAGGATAGATTAAAATAGAAGTTCAATCTATCCTTTTTT GATATGAACTTCATAGGAATTCATGAGAATGAAGAACTCCCATGAGGATT TTCCATTTTTATAGCTACAAATATTAAGTTGGCGCCAACACCTTTGTTCT TTTCTTATTAAATTCATTTGACATAGTTTTTCAATCAATACGAATAGATA TCCGGAGTACCCTTGCAAAAAAAAACTTTACATAAAAGAGAAGCTAAAAA TCCTCTAGATGTCATAAAGCACTGATTACGTAGAAATTGGGATTTTTTTT TCAAATTAGGGCATAACATGAAGAAGTGAGAACCATCATTCAATATTGAT TAGGGTCAAAAATATGTGTCAGAACAAAGTAGTATTGTGAAGGGAACAAA ATAAGGAAGGATGGGACAGATGAAAAGCCAAAATACATTGCTTTTCAAGG CCCACCCTAAAGTACTTATATATTATGTAAATAAGTATTTACATAGACGG TTCATTCAAAGATGGATGGTGAACTGAGAATAATATTTTTTGATTCTTGA TAAATGGATATATATTATGTAAATAAATAAATATGTTCAATTAAAATATG GGTCAGGGAGGGATATAGACGGGAGTCTATAAATAAGACATAGTAAATAG CCCTCTTGGGTAAGGAGAAGAAGACCAAGATAGAAAAAACAAACTTAATT CCTCATATAGAATGATATTAATATGTATGTATTTTGCTAGTTACTTTTTT TTTTTTTTTTTGTGGAGGNGGGGCTCCTWTAATTKCCTTTTWTCTATTTK ATACACAGAGTAGAAGGGCTCTAAGAATGATTAATGGACAAGGGACGAAG AGAACTCCCTTATTTTAAAAAAATAAGAAAAGAGGGTGGAAGAAAGTCAA AAATACATCGTCCATAGAAGAAATTATTCGTTTCTACGTCTACATATGTA TATATTAACTCAAGGGGTAGAATTAGTCAATATAAACATATACAGGGTGC GACATTGAAAACTAGACCTTTTTGAATATGGAAGTTTAACAAGTTTAATA TCAGAAAGAGGCTCCTCTCGACCTCAATACCGTTATTCATGGCCTTCTTG ACGTTAGTAGCAAGTAAAATAGTCTGCTTGCTTACCAATGTGAAGTTTCA GATCTCTTTTTGTGTGCGTTTTACACAACGTAAAGCAGTAGTTTCGATTC TTTTGTCTATTATTGAGACCATTTTTCTATTGGTTGTTAGCTTTCTTGGA GGGGGGTGTCAAAACATTTCAGTTTATTTGGTGATGAGAGGAATCCTCAA TTTATCTCAAGTCTTTTACGTATTCCTCACCTTTATAAGTGTCCGGATTT CAACTACGCACACGGTACATATATACACCAAAATAAACGAATCCATCATT AATCGAGGGAGGGGAAAGTTTCAAATCAAAACATGGACATCACATACGAT ATATATTTTAAATTCCATGTCAAAAGGATTTTTATTTCTTCTTTTTAAAG ATATCCCATTAAGGCGTGGCAAATTTATAAAATATGTACATATTTTAAAT GAGAATGTGTTTTACATTGCATCTCTCAAACTCTTCCTTCTTTTCTAAAA GAGCAAGAAAAAAAATSCCCTACAAYCCCCTGGTGRAAATATTMCCAACT ATTTGATTAGATAGCAATAGTCATGGATGAAAATAATACCATTCACCGAT CTATTGTTTTAAAAAGAAAGCGAAAATGAAGGTACTCACTCTGACAATTT GAAGAATTTGAAAGCGAAAATGAAGGTACTCACTCTGACAATTTGAAGAA TTTGAAGTTTCGGAGGAGATTAGCTCAGCTGCCAGTATTCAATCAACTGC AAGCAGACGTGGGAGGAATGAAATACACAACGCACACTTCGTATSTGACA ATGATATAGGCAGACCTCTATTGTCAATCCTCAATTATGCTCCAACTACA ACAATGATTAACACTTATAGCTTTCATTCATTGGCAAACACATTCGAGGT TACACTTTATAGTTTAGACATATGATATGTTTTCTTCTTAGAATCAAAGA AYAATGTGAACAGCTTTGTACCATTAAAAAAAGCTATATTCAAGTACCAA CTACAAAAAGCCGGCTATTATAGTATTTATTTATTTTTTCATCTATGATA ATAACTATTCATTTAATAACACTAGAAAGGCCCTGGAGGGTATTTGATAC ATCCCAAGGTAGAATTGTGATATGATTAAAAAAAAGTTTTTTAACAAAAA AAAACAATGTTAAAGTCTTTTCTGACCAGTATAATTGCAATACAAGTATT GACTTGCTGCTAAGCATCAAAAGAATGAATTTTGATATGGTTGAGTACAA TTTGTTTGAACAAATGAAAATCCAATCATACAAAAATGATTCCACCATCC TCTGAGGTAGCATTAAATGCTTCATGGATAATAAAAAGTATATGGCTGCA AAATTTCTTCTATTCGTATAGTTTAGATGCGTAATAAAATACATTTTTTG GGTCGTAGGTTTGATAATATTATATGGCAAAGTCAAAATGTTACCAAGAA GGATACCCTCGTCACTCTATTGTTGAACCAATCAACGTTCATAAACTAAA ACAATAATGAATTAGTATCAGTCAAAAAAAATTATTTGCGGTCAAGTCCT AATAGTATATCCTTCACCCCAGAATATTACATACTTTTTSAACTACTCCT AACATCCCTGATTGATATATTTAACAAAGCATTGTCATTCATGGGTATAT TGTCTATATGCTATCAATGAATTTATTTAATGTCATGTCTCGCATATGTA CTAACCTTTATTGTATCTTGAATTCTGTATAAATATACTCACAAGGAAAA ACTGGGGGATCCTGAAGCATCAGAATCGGCGCGAATTTCCCTTTGTTACA GAATTGGTAATTGAAATCGGCTCAATAATGTCAATTCCACCGATACCTAT GCCTAGTTTGACTTATTTGAGCTCATTTTTGTAGACAAAATTACGGTTAC ACATCCAAGAATTAACGACATTGTTCAGACAAACTCAAAAAAAAGGGGGG GGGGGGATCCATAGAAAAATTTGGCATTTTTGTACAGGAAATTAACTTGA ACAATTTAGAAATAACTACATTTTTAGTCCCCGATACATTTGAATTTGTT ATATCATGAGTCGTTCAAAAAGTCCATCAAAGAGGAGCTGGGTTGAGCGG TTTACTCTGAAACCATTAAGTAACTTTTTCACTTAATATTTATTTAGTTG TATGTTTGTTGAATAATATTTTTTATAACAGAACTAAAGTCGAGCACATA TTTTCAAAGTAAAGTTCGAGTATTTGTCCCGGATGCATTAAAAAGACACA AGTCCGGACTCGAGCACTGGTTTTAACATGTTTCAATTCCTAAGACAAGC ATATATAACTTGTTAGGAACTAGAAACAGTGCAAGGCTATTTGATCTCAA GTAGGCCGAACCAGTAAAATAATAGCAAATACCATATTGTTTGTGTCGCA AGTTTTTTTTTGTTTTTTTTTTATCAGAAAGGGAATTGAAATTACATCAG AGGCTCAGGAGTGAGGAGGCCCTTTAAATATGTAAGTAACTTCACAAAAT GAGAAAACAAGAAAACAATTTACTTTTGGGCACGGTGATGAATTATTATT ATGATTTTTTTTTAATTTAAATTTATTAACAAGTAGTTATGATTTATATA TTGATGTATTTTTTTCAGATCCCTAATTAATACAAAGTGAAACATTAAAA ATGTAAACAATCTGATTATTTGTTTATGAAATTCCGTTATACAAAAGCAG TCAGCCTACATTTTTAGGCGTGTTTGTCTTTGAATAGTACATTTTGAATA ATGTGTTTATTGTTGTTGTGAATTGAGTATTAATTGACTTTAAATTATAT TTAAATCAAAATTACTACTTTGACTAAATTGCTTAATAATGACAAAGTAT ATTTTTTTATTTTGTTTAACACACTAGATAAATGAAAAATATATTTTTGT AATATAAAAAATCCGCTCTTTTTCAACTGCATTAACGATTAATCTTCATT TGTATATACATATATATATAAATTTCAGCATATGTTTCCMCTTCTTCTAT TATTTTTTATCCATTYTATATCATAAAATGACAAATGGTAGTAGTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTATAATAATAAAAAATAAAAGAACTAT ATTTTGATTCTATTTCTATAGACTGCATATGTTTCGTGTAGAGTAGGGGA TATCATGAACAGAAAATTGGGCCTTTCAAAATTTCCTTTTTGAAATAATA ATACTTTTTTGAAAATATATTTTTTCCTTCCATATTTGACAAAGTTGTTT TTTTATACAGTAACATTTTTTTGTTAGACAATATTGAGGAGGGTCAACGC TTATTACACTCTAAAAGAGTTGATCTCATATTCTTTTTATTTTTTTGTGG CCTGACAACATAAAAACAGGCTCAAAAGACTTTTTTTACAAGTATTAAAA GCTGTATTTAGTATCCAACAATAGCGTCATAGATAATTTAAGAATAATTA ACATTTCAACCAATAAAAATAGGATCACTATAAAAAATTTATAACGATAT AAAACTATAAGTTTCATACACAAATTTCAACACACACTTTTTGTTGCTCC CTCCTTTAATTCGACAGACACGTTGCCCATCAAAACTCTCCATCATTGAT ATCTTAGAATATTCTCCATCCCTTGAGGTATTACCTTTTAACTTTTCTGT GTGACTTAACGCCGTTGACGCTAACAAATCACCCTAKGTAATTCTGCAGT TTTATTGTTTCTTTCCYATCTCCTCCATTCTGTTAATTTTCTCATCATTG AGTCTGGAGTATATTTGTATTCTTCGTCGATTTATCATGGATTTTTATAA ACCCATCCTTAATATTAACCCTCGAAGTGGTCAACATTGAGCAACAGAAT AATAGAAGGATCATTTATTAGATTTTATGGTTGAACGGGGCGATATCGGA GTCGATATAAGGCTCTTAAAGCATATAATCCACAAATTTGAAAGGTGAGC CTATAATTGACTCAAATACAATGCCTTGAAAACCTTGGGCTGTATATCGT ATCTGTGGTCTGTCAACGTAAAAGCAAGCTGAAATGATTTTTCTCATAAT TGAGTATGGATAACATTTGTACTCTTCAGCGAATTRTCATTCATTTATAT CAACAAATCATTTTAATAAACCCTCAAAGTATCCCAAATTGATATCAGAA CAACAAAAGGATCAGTTTATATATTTCCTGATTGAAAAAGGCCATATGGT TAATATGTATATAAGCCTCTTAGATCAGATGAATGTTATAAACTTTAGTT TGAATCATTGAGTATCTTAACTTATCACAAAACTTTGAATACAAGGTCTA TAATAGACTCAAATATGTCCTTGAGTTATTGGAATGTATATAGTATATGT GAGTCTTCAACATAAAAACAAGTTGAAGTGATTTTTCTTTAAATGGAGTG TAGATTAAATTTGTATTCTTTGGTAAATTGTAGTCAATAAGAAATATTGG GCAGTGTGTTGTATATGTAAAGTAAGAAAATTAATTGGGTTTTTTCATTT TCTTCATTTTTGTTCAAGATTGTTTGTATGCAGAGAATTCACATTTTTAA GTGTTATAAACTTAACAAGAATACAAAAAATTACTTTCAATAACAGGAGT GAAAAAAGTTTTACTTCATGCCGAACCTTAGGGTTGGGGTAAACTGGACA AATCTGTTGTTTTATCAGTCATATATATATTTTTTTTAAATACAACTTTC GAGACCCCTAGACTTGTGACTTCCTAATATTTTGTGTTCATGACACATCT TATTATATAAATATCTAACTCATAATTAAACTCTATTATTTTCTTTCCAA GCTCTACGTGACTACTTCCCTAGGGGGTTTAGACACTCTGCATTAAAATG AATATTTGATGAATATAAAAACTTTATTTGCCATTAGTGATTTTTAATTG TATCGGTGGTTCTTAATATGCGACTTGTAGTAAGTTCCGTCCCTGTTATT GTTCTTAAAAAACATCCACATTAGTATTTTCATTAATATTATAGTCAAGT ACCTACTTCAGCTCACCAATTAGGCATGATTGTTGTGTACATACATAGGT TTGTTTAAAAAAACCAACAGAGAGAGTGGAACCGTCTTGGTACAAAATAT TACAAATTTCTGAATGTTAATATTATCTAATATAAAATATGTGTATATTT CTCACGTAGAGGGTGTTGTGAAAAACATAGTTTACGTCTACAGGCTACAG ACTGTTACACTACCTTCCGGTTTAAGTTTTGTTTTAGCTTGTGTATGCCT TATTGAGCATACTTAAATCCTTACTCAAGTATCATTCATCCAAGAAAATA GATTGCTATTATTTTTTAGTAAGTTCTTATGAAAGTTTGTATTTTTCAAA CAAATCTTGGTGAAAATTTATTGATGATGGCATCACTGACGGATATATAC ATGATTACGTCATTAAGCAAAAAAAAGGTCAAAATGTAGTGACTGGTACG TCACTACATGCGTGAGAAACCTAGTTGGACTCAACCTACCCTCAGGATAA TTATATTTGGCAGCAGGMCCGATCACCCAGCCATAAGTGTAAAAAACTCC AACAGTGGCCTTGGGAGATGTGGCCCCTTTCTCCATATAACTCGTTGCCC TAGACTATGGGATTTAAAGTGATTTAGAGACGTACAAGATCCMCCATCCA AATTTTAATATCATAAAGGCCACCGTTAAGGAGCAGTGGGTTGCTTACGC AAAGGAATGTGTGTGCCTCTTTCCGCGCCTACCTGGAATACATGCTTACT AATAGGAGTGGATATTTTGAGAATTAAATGTACATATCTATGAGAGTGTC CACCCAAAGTTTTGAATTGAAAGGGGTATAAAGCTCCAGATATATGTTTT AATGTAGTTGACCTGTTTTTTCTCACGTTTTTGTAGGCACACTCTAGATG ATATACATATGTTCAATAACAACAACAAAAAAGACAAAAACAAACCAATT CACTCCTACTCAAAGCAACCATTATTGACTTTAAAAGCTTTTTCTCTTCT TTTATATTTTTTACTGCAGATAAAAAAATGTGTGTTTTTTTTTTTTGGAT GTTGTACATATATATATTTTCTTGAGKGAGTCTTGATTGATACTAAATGA CCTCAAAGAATAATGATTTATGTACCATACACATAATTCATTGCTAGTAC TTATTGGACCATTGTATATATAAAGATTAATTCCCTCTGCAAGATTTTTC TTGGTTGGAGCAAAAATTTGTTTTACTCTTCAATGCAGTAAAACAGAAAT ATACTCAAAAAAAAATACTTTTTTTAATTCTTCTTAAAAAGAAATCAATC CATACTTGCGTATTAATCCTCTATTATTTCCTGGGGTGTATAAACACCCC AGAGATTGAAATATTCTAGCAATTTATTTAATGCATTATACTTTTATACC ACTTTTTATATTAAGTTTTTAATTTACCATATACTTCCTATGTCCCGATT TCGAAAGATGGTACTTCAGTAGTTTCTGAGTTATTCAAAAATTATATAAC TAATTATTGAAGTTTTAAGAAGGTTTTTTTTTTTTAATGTTTTCTTATTA CTGATCTACTCCTAACAATAAAAATGAAAAAAAAAAAGAAGATGGTTGGA GATAGTATTGTATCCGTCTTAATTTATTCGGTCCATTAATGGCTTAGGAC CGGTCCTTGGAACTATCAGTACTAGAACTGATTAAAAGAACAAGAAATAA GGTTGAAGTACCGATATTTATAAGTTTTAGGACTGAGCCTTCCCTCCTAA ATCAAGACCGATACTACACTAGAGGGTGATATCTCATACATTAAAGGAAG AAAGAATGCAATCTCCTTTTGTACATGTACGATCGATTTACGCTAAATGG TGTTAGAGAGATATGATTTCATACTAAAAAAAACTTCCTATACAATTTTA TGAATGTTTGACTCAGTATTGTTTTAGTGTGCGTAACAGATTGATATCAG TAAAGAGAGAATAGGCCATATTTTACAGTTTTTCTACCACAAAGGCGAAA ACGCAAGCCAAGTTGCTGAAAACGTTAATAACGTTTAACACCCCGATACT GTAAGCGCCAATAAGGCGGAATTTCTAGTAATTTTGATGTCAAATATGTA CCACAGTCTGGAAGGCTAATTGTTCAAAATGTGGATAAAATAATGAAAAT CATCAGGCCTGACAGTTTGATGGCCAAGGTAATCAACATTGATGAGAGAG AAAAAATTCAAGCTTAAGAAATCTGTTCAAAATAATTGATTTTTTCTACT TTTACACCCTAAAACGAAAAAAACGTCGAAAGTGACACCGAAAATTGGTA ATGTATACGGGGCCAATACAATTTAGGCTTGTGTTGCATAACAGTGGTTT AAGTGATTTTTGGTCGCKCAATTCTGCCCTCTACTATGCAAAACTCTACC GTATGAAGGTAGCATCGAACGGAAGCATCCAGCATTGGTGAATATGAGAC AAAGAGACATCATCAAGAGAACACCAGTTCACACACATCTTTGATTACCG CACCAGAAGTTATGGYTRCACAGATAGGAAGTTCTTATGCGTACACCCAA CAGTTCATATTTGACATCWAGTGACTACCACCTGTTACTGTATATGTCCA TCACGCTTGGGGTGCAAATTTGGCCTCAATAGAGGTGTGTGAAAATTGGC TGTCCGAGTTGTTAGCCAATAAAGATAAGGGCTTCCACGATCCAGGATAT TATGGAGTTGGAATCTCGTTGGCAACAAGTTATCCAACARAACGGGGCAT ACTTRGCTTTCATCRGATGATTGTAACACTTCTTTTAAAGCATTGAATAA AAACGAAAAATACGAAATTACTTTTTCCCCAAGCTATTATTATGTTTCAA GAACAGTAAAAAACCTAGATGTTGATGCTGAGATACCTATAAAAAACCTT GACTATGTGTTTGATTTTATATGCTATTATTAATATCTACGGGTTTTATT AGAAAAGAAAAAATAAATAAACTCAATAGTGATATTAATAATACCTAGTC ATAGTAATAATAGGTGAATGGAAAGGAATGAGTGGAATGTTTAATTAGTT TTGATAAGATCCAAATATTATCTGATAATATGAGAAGTAACAAACATAGG AGGAAGTAAGTAAGAAAGAAGGAAATCAAAAATGTAATATGTTCACTGTA CANACCTTCAGAAAACGTTTGTTTTCTCTCTCTTTAACATATATAAAAAA GCGTTTTCTGAACCATTTTGAAGTGTTAGGTCTAGTGTGGAGACTCGAGC AAGACAGATTTTTTTACCTCGTTTGGTCTTACATATTTTTTCTAAACCGA TTTGGATCGATATTTCCTGTCCAGATCTAGATCTCAGATGATAGACCGAA ATTTGGCCGTTTACAATGTGATAATCCATTTCTTCCCACTCAACGTAAGA TCAGATTGTTTCGCCTACCCTCAGTTTTAAAACTATGAATTAATCATATA TTTAATTTCATATGACCTTATTGGTGATCAATGATGACAATTTTGAAACA ATTATGACGTCATTAACAATTCATTTAGACCAAATTTTATAGGAGACAAA CTCAGACAAAAAATGTCATAGAAACTGGTTCAAACCGAGCTTTTTTAAAG GAAATAATGTGAAAATTGTAAAAATTCTCGTAAGCATACATTTAAAATAA GAAAAGTTGGCATATTATGAGTGCTCATATAAACTATTMTTTCCCATTTG ATCGTATTAGGGAGTGCTATAGTTTTTAATATGGCTGGAAAATTCCCCCT GGGAAGTTGTACCCCAAAGATCTTAAGCCCATGAATTTAAATATTAAATG CAAAATTCTGTGTGCGTGTGGGTGTATCCAAAAATCATGGCCAGACTAAT ACAAATGGATTTTACTGAATTAAAAATAAGGTAAATAAAAAAATTATCAT TGTTTTTTGCAATGTTTTGAGTATAAGAAACATGTCTAAAGAAAGAAAAA ATCTATATTTGAAAATAAAATACAAAATATTGCTCTCAAATAATAATATG AAGTTAAGGTTCATAATTGCTACAAATAAAAAGTAATTTTATTTTCACGT TCTATAATGATTATTTTATTTATTTAATATGAAATTTCATTTGATAAAAC ACAGTTTTTATTATTATTTTTGTAACTATTGAAACAGAAAGGATTGAAAC AATAGTGCAACAGGTAAACTCGGGTATTTCCGATCCTAAAATATATTAAT ATTTATACCTAATGTAATTCTTGCAAGTGTAACATTTTTTTAAATATTTT GGCAGATAAAGACTATTTTCTGAGGTATTGCTCCTGAGNTTATGAGAGAA AGGGTTAAGGATCTATACCTATATAATTATGATATCAATTGTTTTGGCCT TCAAGACTATGGCGGSCTTATAATARCCTTTACATACTATTTCCAAAGGG AATTATAAGGTTTAGAAAGCGGAAAAAAAAGATGAGAAAACAAAGGGTTT TTGACAATAAATTGAAAGTTGAGCAAACGACAGTTCAACTTGAATACTTT TTCTTCGTTAAACCTTATAATTTCCTATTACAAAATGTGTGCAAAGATAC ATACCAACATGCGGCAAGAATCATTCTTAAAATTTTACTGTCTGTATTTT TTGTTGTACCTATATTAAGCAGAAGAACTAATTAATTAATATTAAATTCT TTTTGTCCGGGGCATGTATATATTATAACAGAACTGTATCTTTGTGTTTA TTTTTCGGACTTAAAATGGGTTCTTTCTTCACTTGAAGTCCTTTCTAATT CCTTTTTTTATATGGAATTACTTGAAATAAAGGCTTTTTAATTCAATTTG GATGTATGTATATAAATCATATTAAATAAATTTTGTTTCCTATAATGATG AATTCAAACCGAGTTTTTTTTACCGCTGTACTTTAGTTGATAGAAAAGAG GAAGAAAGAACACCAACAAATACATTTGAATGGGTAGAGTCCTTGCTGCT AATACTTCAACTCTTGGGCATTTTGTGACTCCTTGTGAGGGTGAAAAGGC ACATTTTGACACCAGCAATGGAAGAAACCCATTTGCTTCATTGCAAGACT CTTTTCAGTTCTTTTGAATTCTTTTTTGACACTTTTGCCCCCCCCCCTAC AGCTTGATGCTAACCCCTTACTACAAACTTTGGGTGCATATCGAGGGGAA GTCTGCATTGTTTGTCATCCAAACACCAAGGCCTGCAATGTCACTGTCGG ACATCCCTAGTACACTATGACAGAAGAGGACTACATCCGCAGAGGGTGCC ATGCTTTCTGCCAWCACCCGGAAACCATCATTGCCGCTAAGGGACGGCTA TATTMATGATTCAGAGAGCTCAGACAACCATCTATTTAGGGTATTAATTT CGTTGAAATTATTTTCTTAATTAATAAATTATATCTTGTTGAAGTTTAAA GTTCAAATTGCTCATATTTTAATGGGCTACTCAGTAGAGGGGGATCCATT TTAAGCCTTAAAAGATATATGAGAAAATATATTTTGATATATAATATATT TATGAGTACGAATGTTCTCAGGACGAAACATCACAGAACAGCTTTTTATG GATCAGAAGATGTGTCGTCTATCAAAGTTGATGGCTAATACTTTTTTTTA TTTTTTATTTACTCTTTACAGGATTCAGACAATTTTCACAACCCTATAGA TGTGATAACACACCTTAAAGCCCCCCAAAAAAAGACGGCGTAGAGCCTAT ATTAACTTGGATAACTATTATATTTTGATATTCTTTGTTTCATAAGAATC TCGTGGGATTCTGAGTCATTTTAATGGAGGTAAGAGGGGAGCGACTCTAA TAGGAGGCTCAAATGTCTCTCCTTCTCAGGTAAAGGAGGATGTGTATAAT TATGACTTATATGTAGACTATATATATCACCCTTTCTGTACACAGAAGCA ATTGACATATAAATCATTTCCAACGCCCTCCTTTCCTCTTGATCTCTCCC CCCCTCTCACTCTTTCTGAATAAATCCATCAATTTGTAATGTATTGGACA CAGAGGAGAAGGGTTTTTTATATATAATATATAAAAAATACAAAAATAAT CGATAATCGAAAAATAACCTCTTTCTCTATCTGCTTTCTAAATAAATAAA AAGCAGTTATGTACAGCGTCATTAGAAATGACTTCCATGAAAATTTATTC AATTTTATTTTCCCGTTTTTCCCCCTTTATTATTTTTCATTAAAATAAAA TCTTAATAATAATAAAAAGTTAGTTTTTTTATTGTGTTTAACAGAAAAAA TTGTAGTTTTTTTTTTCTAACTTTCTTTAATGTTTCAGTAATTTATTTAA ACTGCTTTAATGTGTTATTAGCAAGGATAAAAAGGGTTTTATGCCTCTGT TACATATATAAAAAAAGAGAAAAGGAGAATGGAGACAATGTGTTGTTCCA AACATATGATTTGAAAAAAACAGCTATGATCGATTTTTTACATATCTATA ACAGAGTGTCTCTGGAAATTGTATTGTATCATAGCGTGCATTAATACAAG AATGACAGAGGTCTCTTAATGATGCTATCAAAAATAAATATACCTGTTTT TAAGCTATACAAATTATTAATTTCACGAACATGCCCATGATAGGGTTGAT GAGGGRCYCCTTGCTKTTTACTGTTGGAGGGGGGGGGGGGCTCTGTTTGT GTAAGTATCTTGTAGCGAATATCTTATTTCACTATTTTGTACACAAGAGT ATGAGAAACTCCCATCTCTCTTCCAATCTTTAGTAGAAGTCCCCGTAGTC TTCATCAAAAAATTCCTGGATGATGCAAACCAAATCATCGCAGTGGGAGT CACTGGGACGCTTGTGGGCCTTTATTTGGATGTCAAAGCTAGCAGTAAAC CTTCCAGACTCTATAAACTTATAGTAGACTCGTGTAAAGTTTTTTTTATT TAATAAAATGACTACCTGATAAATATTAACGGGAGGGTCATTGAAATCTG AACACTTACTAATTCAAGATTAAATTAAGTMTAATGCCAACCTCCTATAC AACACCTTTTGGGGCATGTTGAAGGGAAGGCCTACAGTGACCTTTACCTA AACACTGAGGCCCTCAAAGCCACTGTCATCCTACACTGGGACTCCAGGGA CTCCATGACAGAGGACTACACCCACAGAGGGTAGTAGGTCTTTTGTTGAC ACCTGAAATCCATCATTGCCGCTGATTAAGAGAGCTCAGACACATATCTA TTTAGGGTATTAATTTTGTTTGAATTCTTTTGTTAATTAATAAATAATCA CTTGTTGAAGTTTAAAATTCAAAGTGTTCACATTTTAATGGATCACTCGG TATGTGGAACATTATAAAGCTTAAATCTCCACAGGGATATTACTCTTAAC CAGCAGCGTTTCTAGCTTTCATTTTTTGTGGGGCTCAGCGCCAAAAATGA CCATAGCGTTATATGATTACTTAATTATATACGTTTACTTTATATATATA CTAGTAGATTTTGTCTGCGTTGAGTGGATGAATAGAGATCAATATAACCA AAGAATGAAGGCAGAAGAAAAGAGAGAGAGGGATGCAGAAAGAGATATAG GGAATAGGAGAAAGAGAGAAGGGGGAAAAGGTTTTATTTCGGTCTAAAAC AGTCACTTAATGAAAATTCATAAAAATAATCGTTAACAAAAATCAAATAA AGAAAAAAAAAACACAATTGTTCTACTTCATATATTGTACTGTTCAATAT TTTATAGACGARTCTGAGWTAATTATAGGCTTAATATTCAAATTTCTGGT AGTAGGTAAGATAGCCAAGAGTGTTGGCTATAGTTTAAAAAGCTTTATTT GATTATARATACTTATATTGGCCCCGATATGGCTCCTTTCAAATAAAATT TAATTGTGATGATCTATTTAGACTACTTGAAAGAGTGCGATTTGGATAAT AATTCATTGAAGAATACAAATATATTCTTCAGCTTTCTTTTGTGCTGACG GGGCACCAATTGAATAAGATACGCTCAAAAATAGAAAATTAACTGTGGAT ATGATTTTRCGTACTTGTACAATATATGGATGGGATTATGAAGAAAGAAA GGGAGAGAGAGGAATTATGTTGTTTACTATCCATTTACCTAATGTTTAGC GAATGTTTGTTCATCCTTCTTTCTTTTTTTGGTTGGGCCGTGGTTGTTTA CATATGTATATATAGAGTCACTCTATTAATGTGTACGTACATATATTTAC TCACTATTAAAAATAAATATACATACAAAAAATGCTCTAAGACCCCCCTT CGTCAAAAAAACACACACACACACAGAAAGAAAGAAAAGTAAATATTGTA AATTGACCTACGGTACAGAACATAGATGAAAATAATATGATAATGAAAGA GNNNNNATTTTTTGTAAGTGGTAACTGAATTAACGCTTCTTATATTCCAA AACTCATTCATATTTTATCTTTGGAGAGAGAACATATTAGTAGTATTAAG TCATCTCTAGTCCTTTGAAAGATATAAAATTGGATTTTTAAATACCGGCA GGMTATGTTWTRCTCAGAAGMGTATGAAATAKATTTTGTAGAAGTTGAAA GCGGCATTTTTTTCGGAAGAAGCTTTTTATTCTCCATTCCTGTTAGATTT TTGATTGGTTTTTTTTTCTATATTTCATCCAATGTCTAGCTACAATGTAA AATTTAACAAACAATTATCAAAAAAAAAGCAAAGAAAAAACAAGACATGT AGCACTAACGTAAAATGAAGTGTTAACACTTCCTCGATTAGGATGTCTAA AAAATACAATTGGTTCCCTATCACCCATCTTAATGGTGTCCATAGGTGTT CTCTAAAAGTTGATTTCTCAAAAGCTTCCACAATCCGACGTTCTGATTCC TTATTACCCTTAAATGTATAATTAAATGATATTTTAAGCTATGTATAGTT CACATCAATTTTTCCTTCTTGCAAATCAACAAAAACTATTTTATCAAACA CAAAATGTTCCTCACCAAAGCTGATCTGTAACTCTATTCGATTGGTACAA ACAGGAAAGTTCATGCTTTCTCCTCCAGGCCTAATTTNNNNNNNNNNNNN CCAACTCCCTAAATATTTTTGTCTTGTGAGATGAAGTAAACATATGCAAT TGGGTCTCAATATGTCTACATTCAAAGGTACAAAGCTGGTCTAATAGGGA TTTCCCTCTAAACTCGTTGCAAGCTAGAGTTCTGCTATTTATATGCGTTC ATTCCTGCTAGCATTATTATTTAATTCCTGAGAAGGTAATAGTTAAGTAT TTAGCAATAACTAGTGGGTGTGCTCATGAAATTGAGAAATGAATTGTCAG GGTGACCACTCTCATTTTTGGTTTCTTTTGGTATAATGGCAGRTCTTATT ATTTTCAAGGATACACCCTCTACCATTTATATTAGACTGTCCCTTGACAA CAAAAGTTGTGAATTATTTTTTGGTTTCATTAATACGGAAAATTAATTGC ACCATTAATTTTGCTTCTATATAGCCAACAGTACAACTATTTGTGCCATG GATTTTTGAGAAGTCGAAGCAGTGAAGAGACAAAACTACTCAGTTGACTT TGAGGATTGATTATCACGATAAAAGGGATTGATTATCGGGATAAAAGACA TATCAAGTCATTTAAGGGATGGTACAGACTAATTTTTTTTTTTAATATTT TGGGTCTAAATTAGTCATTTATAAGCCTCTTGTACGCCCGTGCTAAATAT GATACTATGACTCAAAAAATATACTTTTTATCCCTAATAGTATTACGTTT ATCAGTTTAAAATATTGTGCTGATTGTTTTAAACATAATTTTAAATGTTC CTTTAATGCGTCAGATGGAGTTGCACTGATTAATTATAAGTAAACCCTAT AGTATTACATTTTCTCTATCTGATCTAGGTATCATCTTTGAATTCAATAC ATATAATGTATATTTCCTTCACTATGAATGCCGGGGTCGCAAACCTACGC ACATTGAGTTCAAGAGAAAAAAAAAATCCTGAGTGTTTTGTCCATCAATC TAGATCAATCCATTTTAAGTAATTAGTTAAGAGTAGTGTTACGTTAGTAC TTAGTCATTTGGTCTAGACCAGTCCATTCTTAAGGACGGTCCTATTAGTT CTTGGGGCCTATCCTATTACTATTGTCCTTTAGACTGAAAGTCCCTTGGA CGGTCAATATTAGAACTTCTTTTTTTTTTAAGTTGAGTGGCGCCAACAAG GATCGAACTTTTTATGTTTTTAGGACTGAAATGGACGGAACTGAGAGTCA ACTGGGCGAGACTCTCGTCTTCAATCCTAAATAAGGACTGGCATAAGCCT AGTTATAAGGGGTCTAAGATGTGCTACTCAATGATGTGTGCTTTCACTGT TTTACCTTTTCAAGTTATATTTGTTTAGTAAACAGGAGAAATAATAATTA TATTTCTTTGGATACCCCAGGGAAATTGAGTACATCTTAGACCCCGCCAA TTTTTAAAGACAAGATTTACAATACGAAAAAATATAAAAAGTATAATTTT TAGTTTAAATCATCCCATTTGGCGTAAAAACAGATAATTTACAACCAAAC ATATCATTTTTTCCATACTAAAATGTCAAAGTACCACGTCAAAAAGGGCT TGAAGGGATTGTACCTTTGGGAATGTTAGTTTTTTTATTGTCTCCAGTAG AAAGGGTCTTTGAGCAAGGGGGAAAAATATAAACCCAAAAACTGAACAGT CTAATATACATATACGTAGTATGATGATTTTATCCCTTTTTGATTCTCTC ATATATCTTTTAACATATTATTATATTTTTATAGTATGATTATAATCGAA TAGATGTCTCTACTCTCTTTAGGTTGAAAAATGTTTCTTATCCGTTGCCT TAAGGGGGTTTCTTTTTCATATTTATTGAGCCTGTTTATTTTTTTTTTTT TTGGTTGATGGGAGATGTATCCGGAGRGGCGTATCTTTGATCATGGTTGT TGTGGTTTGTTATTTGTAAACATATGGTTCTATGTAATTATATTGTGGTC TGATATATAGAGTAGTATAAAATATAACCTAAACGTGATTGAAATTTGTT TCAAATCCGTTTCGTTGTAAAAATTGCGCCTGGTATGACCTATACATACA GCCTGCGGACTCTATTAAACAACCAATAAATACAATTTCTTTAAAAATGG ATTTTCTCCTTAACTAATCATCCGATTTTAATCAAAACTAATGCTAATTT AAACCTGTATATTTTTTTAATATTTATATTCAATATAATCAACTTTGGTG TGAATAACGGTCTCGACTCGACCTCAGATACGGGAGCAGGTATTGATGAA ATAATTCTTTGACATTTTCTGGAATTCCTCCCAGATCCTGGAGATCAGAT CGGATTTTGTACTGCAAGAGGATCTGTTGGTGGGTTGTTCAACTGTAACC CACGCAAAGAAGACCATGGGTTGAGGTCCGGGTAGCTTGGAGGCCAAACA ATAGGTTTAACAAAGTAAGAAAAAGTCTGACAACCAGGTCATCGTTTTCT TTATAATGTGGCATGGATCAGAGTCATAATTATCTCTAGGCTCTTCCAGT TCCTTCCTGACTCGCCAGACAAAGAACTCGTCCAGGTTTAAAAAGTTTGC AATCTGAACATTGTCTTGTCCGCCGTGGTTTGTAACAAGGACACTGCCTT TTCCAAGAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTAGCTTGGAGG CCAAACAATAGGTTTAACAAAGTAAGAAAAAGTACTGACAACCAGGTCAT CGTTTTCTTTATAATGTGGCATGGATCAGAGTCATAATTATCTCTAGGCT CTTCCAGTTCCTTCCTGACTCGCCAGACAAAGAACTCGTCCAGGTTTAAA AAGTTTGCAATCTGAACATTGTCTTGTCCGCCGTGGTTTGTAACAAGGAC ACTGCCTTTTCCAAGAATTAAGACTTCATTGATCGTTACGCTAAACTCTT CTGGCTAGTCGGTAAAACTATAAACAATGCCCTATCTCCGATTGCCCGGA TGTTGCAGGCACTCAAAGTTTGTTGTTAAATAACAACCGCTTCCTTGATA TATGTATATGTGGCAATGTCAACATAAAAGCAGTCTGGGAAGAAATTGGG GAAAAAATTAGTTTTCTTTTTCCAGCTATTATACATTATATGATAGGATC ATAAATTTTTTACAGCTCATTACATATGACACCCTATTTTAAGGGGGAAA AAATATCTTAATATAACTTAAGAACAGGTCTTAATCGATTATTTTAGTGA TCCATTTTCATAAAAACAATTCCAGCCTGATTTTATATTGAGACGTCACA TGTATATAATATTCCCGTTGCTTCCACTTGATTTGAAGGCCTCTGTACAG CATTCTAGTGTTGACAAAAAAATAATTACTAATTGATTTGTTTGTTTGCA GGGGGCAGAAAAGGATTTTAAATCGGATTTTTTTTTCTTATGAAGTGAAG AGGGTCTTCCTCTCCATCATAAAAGTGGATTTGAATGGGCCTCAATGTGT CTACATACATGTATTACATGTATATTGAAAACGATCATCTAAATGAGCGT ACTTAAGTGACTTGTATATTTTTTTTATTTTTTTCTTAAACCATTGAATA GTCAAGTTATTTACTAACCATTAGATAAGAGGATTTTTATGGATCCATTC TAAATATATAGAAGAGGATATTGTGTATATTTTTTTAAAATATTGAAAAA AAGGGGGAGAAGGGGGGGGGGGAAAGAAGYGGAGAGAAGAGAATGAAAAG AAGCTCGGGGTTATATTCATCATTTTCTCTTTTTTTTTTTTAAGAAAAAA AAATCCCCTTACTTTCCCGACTTTTTCAAAGATTTACTTGATCACTAGTT ATTTGTTGTATATACGTAGAGAACATATGGAAGAGTTACTTACAAAATAT ACTAGAGGACTCTTAAACCTAAAAGTTCTATTAAARTTAATTATTTAACT TGTACAATATAGATATACAACTTGTCCAAAATAGAAAATACAATTTGTAT TCTAGTTAGATTACAAAACAGCTTTGATGATTCTATTGTGATATTTTTGA GTGGAAAGTCCACTTGTAAACCCCCTTTTTATGGTTTGTTCAACCCAGGG TGTTCATTGAGATCAGAACACTCACGAATTTAATAATTACTGAAGGTTGA GTAATTGAAATTAATTCTTATTTCGATGTATTAAAGTATACACAATCAGT CACAAAAAAACAACTTGAGCTCTCTAGTTGACGTACAAGTTGAGAGTTTG ACACTTGAACGTGATCGACGAATTTCTATTCGCATACTCCAAGCAGTTGG GAGTCTCAAGGGCCACCTTCTAAAAACAATTGATTTTCTGCGAATAGCTT TGGATTTTGAAATTTTTCTCCAAAAATTTTAATTTCATTATTTTTTTATT TTATTTTTGACTTTTTCTTCAAATCAAATTAATTTTTTGTGGAGAGCAGT GAATTTTGAGAATAACAAATGATGTTAGAAAAAAGAAAAATAGAAAAAAT ATAATTTTGTATGAAAGGCTTCGAATTTTTAAAAATGTATTCCAATAACA TAACATTTTAAGTATAGAAATGGAGTTTTGAAAAAAAAATTAATTTTTTG TTAACAGCTGTGGATTTTCAAGGTTTTTTGCATAAAAATTTTATTTTTTG AGAATAGTAATGGATTTTTGAAAAAAAAAATTCCCAAAAATTTTGAAATT TTTGTACGTTTTTTTTAAAAACCAATTGGAAAAAAATATATCATCCTGCT GACGGACAAGTTATTATGTATTAATGAGTAATGTATCTATGGGAAGTTGA TCTTAGGTATGTGCTACAGAAGACATATATTTTAGTCAATTATATTAAAA TAGTCAAAAATGACACTATTAATATATGAAATCCCTTGAATATTCAATTA TTGCAAGATCATCATCAAAAATCTACTGTAAATACTTCCTTTATTCATCT CAGGTCATGATTCCAACTCGTACCATTTTACTTATACAAGTTACAACTCC TACGCAGCATATATAAGTAAAACATATGTTGAAGTTTGTAATATATTATT ATAGGACTCGTAAACATGGAAATTTGATTTTCATAGTTCTTTTTCTCTCT CTCTTTTTTGAACAAATCGATAAATGATGTATTGAAATAAACTTTTGATA TATGTATACATCATATAATAAGATTTTTTTTTTTTTCCTTTTAAGTGTAG TATTAGTAATAGTTGTAAACATTACTCTTCATTTTTTTTTTTTTCTTTAA AATAACTTATTTTTCTGAAATGTATATTTTCTTATTTTCTCTCCGTATTG TTTGTTATTACAGTGATTGATATCGAATTTTCCTCTTATTATTTAATATG GATATGTACATATTATGCTTTGATTTTTTACAGAAATACATTTATTTGAC AAATGTCTCCTTCCTTTTTTTTTGCAGATGACGTCAATCGCTTCGAAGGC AACGATACCACCAATAATTTCAAAATGATTATTGAGGATCTCAACATTCT CATTATTGGAGCCACGTAAGTCCGCTTGCTTTTTTTTAACTTGACTCTCT ACTCAAAGGCATACTTTATAAATGCACTCTTTTTTCTCTTATAATAGAGT TGGCTAAAATATGAACTTAGGGCGTGTMAGTTTTTCTTTRTAGTTGGTAA TCTAAAGAGTGTTTGTTTATTTTCCAAAGCTGCTATAATTATTCTTTAAT TCTTGAAGAGAGAACATCTAAGTATATTGTAGTCACTAGTGCGTGAAAAA ACAAAGAGTACCACTGATGATTTGTTGAGGAGTTGTTGATCCTCAATTCT ACTCTGTGGTCAACCAGAGTCATTTCTAATTATGTACCTGCTAGATAGTG AGTGGGGTTTCTGTTTATTTCCTTCCTGTCACAGCTGCTTGCAGTTAATC TAATGACAGGTTATGACAGCTAAGCTGCTCTCAAACACTATTCAAATTGT CAGGGTTACCATGCTCATTTTCTGTTTATTTTTAGTATACTGGTAGATCA TATTTAAAGAAGTAGGTGTTTGTCCGGCCTTGCACGAGACATTAAGAAGT TGATATTAATTAAAAACTTTTTTATGCCAAATAAAACAAAATGTAAATAC CATAAAAGTGTATTAATGCTAAATTTTCGAACTCATATGTATCTTTGCAC TTTTTTTAATAAAGGGATAGAGTAGGTTTACCTGGGATTGCCTGGGACAT TAAGAAATTAAAATTAATTATGAACTCTTCTGATTTTTTTTTAAAGAAAA TTGTAAGGGTTGAGAAGAAAAATTATTAGAGTTGAACTGTCGTGTGTTGC ACCTTCATATTGTTGTCAATAATTATTTGTCTTATTTTGTCTTTATATAT AAATTTGATAAACGCCTTTTAAAAAAAGTGTGCAAAGATACATTCCAAAA CCCAGCGAGGCTCATTTTTTAAATTATTTTGGGGTCTCTTGCTTTTTTAT ATGAAATAGTTTTTTATAAGTCAAAAAACTGGTTTTTAGAATAATGTTAT TTAAAGACTGCAATGGTCGAAAAGACACCAAAAACTGTTACCACAACCAT TTCTTGAGCCTTGAGAACCTACATGAAAAATTTCACCAAAATCCATTCAT TTGTTTGGGTGTGATTCCTGGACAAACACACAGAGACATTTGCATTCAAT ATATAGATACGCCACTGATCCCTGGTCAGTTATATGTCGGATACTTAGTT AATAAAAAAACAAAAAGAAATTATAGCAGGCAAGCTGAAACTCCTTCAAA GCATTCTACAAATTGTCAAAATTACCATGTTTTTTTCGGCTTACTTTTAT TTTACATAAGAGCAGGTTATAGTATAACCTTAGAAGTGTATAAAATATGT CTTATAAAGCAAATGCAACTTTTGTTTCTAGTTGACAACCTGAACGGTTT TTTTATTAGTATTAAAATTTTGAAAAGGGAATATCCAATTTGACAGCAGT AAATAGTGTGTGTGCTCATGAAAGATTAAGAGATTAAGAATGAGGAATTG CTTGAGAGTTATAAATGTAAGTATTTTTTTAGATTCGGAGTACACTGAAA GTTCGATATGAGAGTAATTCCAAATTATATGTCAAGACATCCATACTCCT CCCCTACAAAACATTCTTCAAATTGTCAGGATTACTATATAATTGTACGC TTTATTTTCTTTAAGATGCCATTATCTTCTTTTTTCCACAACTCTATTGA ATTCAGAATCAAAGAAATATTCTATACATCACAAACATATGAATATTTTT TTTTTATTAGTTGAATAATTATGAAATGAAAGAGGGAATTGAATTAAAGC AATCGTCNAACGAATATCCTCAGTAAATAAATTAATTTTTTTCATTAATT ACTACTCTAATAGCATAAAGTAAATAGGTCGACCAAAAGAAAAAAGCTTT AATTCCAACCCTGTATCCACCTCGTAAAATTTAATCAATAAGAAAAGTTA TTTTTTTATTCTATACATATAAAAACCTTATCAACGATTTATGGTAATTA TTTCTCATAAAATTAAAAATATTTGGCAAAGGAGTACTCTTGATTAATAT TGTTGTGTATAGTATGAGTCATAATATTTCAATACATTAATTTATATATA TATCACACTTTTCGATGACCTTTTGTTTTAGAAAAAAGGTAGAAAAACAT TTTAACCTTGCCCAAATATACTTTGAATGTTCTCCAAGAAGTAGGGGCTT ATCCTAGGGCCCATCTCTTACAACAATCTTTTTTCTACATGTACATAATT GAGAAAAGTCACACAATAATATATCGTGGCGTCAAAACCAAAACATCGTA ATTGGCAATTTTATGATGATAGAAAATTACTTAATAAGAAGTAGTGATTG CACTTAATGTATAAATCTTTGTACTTACTAATAAACTGAGACTTCCCAAA GCTACTTTTTAAGACAATGGTCCTGTGTAAACTACATTGTAAGATATTGC TACTTGCTACAATATGTACAGGGTTATTTACGCTTTTAGAACAAAAAGGA CTCTTTCTCCTGCAGGTTTAAACAAAACAATGGAAATATATATAGAAAAA TGGACTTTTAAACTGTACATAGAAATTTTATATTTTAATTTATAAAAGGG ACTATTATTACCTCATCTTTTTAATAACTTTTACATAGTTAACGTTGTAA TTGTTTTTTTTTAAATAACTTGAAAAAACTTTGTTTTTTATTGATTTTTT TGTTTTTAATTTGAATTAGGAACCTTTTCTGGAAATTTTGTTATAAGTGA AATAATATTAGAAAAAATAAAAAAATAATACCTACAATTGCAATCTTATT ACATGTATAATGTAATATTGCAAATCGGATGTATATACAAAAACTTTGGT CGGAATTTCCTGTAAAGACTCTCAGGTAGGTGTCCCTAGCCAAAAGAGCA AGAAGACCCAAAATTGTCCACCCGAGAATTTTCAGGATTTCTGTCCATCA TCAATGTGGCCTCCATCCTCACCACATTGTTCACCATTGGATTATGGAAT ATGGGTATCCATAGAGGGCAAGGCCTGTGATACTCCTCAAAGGAATGTAG ACGACGTCAAAGTTGTTGTGGAGAGTGAGTGGACCAACATGCCAGAGGAC TATCTTATCAATGTCTGCAATGCCTTTAGGGCATCTAGGGCTCCTCGGGA GGCTAAGGGGGATTTTAGGAATAAATATATTTATTATATAAAATGTTCCT TCTTCAACCATAACGAAGATAAATACTATTAGTATTAGGACTTAGGACTG ACTAGCTAATCCTCTTCTTTATTTTTTCTGTTTTTTGAATTGGTTGCTGC TGGATGATCACATTTTGAATATAAATTATAGTTATTAGAGTTGTCAGATG TGTTTCCAAGGTTGTTTTTTTTGGGGTCAAGTGTCACAATTTTACTTATG CAAACGTAAATACATATAGTAATATCATTCAAATCGAAAGGAATAAGGAA TAGTGCATGTGTCTGAACAGTCCAATTATTGACAAAGACAAAGAAATCCC TCCAAATTCAGTAGAATTATTATTTCTGATAATACTTTACGAGTTTTTGA AACATAAATTCCTCCATAATTTTCAGAGGTAAATTGTTGTATGTCACACA TACAAAGGTGGTTGGAAAAGATTATTAGGTAACAAAGATACAAGTTTCTT TTATTTTCTCAATATAATATCCTTCTAACTATACACACTTCTCCCAATGT TGCTCCCATCTCTATAGCCTCTCCAAATAGTACTCGGCATTTTTCTCTGC AAAATAATTGTTCACTAGACACTTTTTGTTTTTGGCATAATGAATCCAGA TTGACTTAAACGCGTCCAATTTTAACATATCCAGTCTTTTTCAGATGTTT GCTATTGTTTGAATACATTTATAGGTTACAAGTATTTAATGGCAGSTTGA TACTCAGTTGTGTCCATTTTCATAAGAACACAAAWATTAACTCACTCAAA CGATTGTTACATAAGAACTGAGCGTCCAAAATGGCAGACTCTTTGGTGAG TATATGCCAACAGATGCCATATAGATGTGACAGYTTATATTTACGAGASC TGCCATAGTCACGTGGAGGTGGGGAACTTTTATTATTACAATTTCTGTTG AGCAAAACAATGTAATGAATACAACATTACCTCAGTGAATTTTGTTGTCA GCTGTCCATGGTTTTTTTTGGGTTTTTTTGTCCTTCATAATCAATGTTCT GCACATTGATTTGTTGAATTAGAATTAGCTCATGTTAAGAGCTAATCAAT AATTGAATAATGATTTTACAAATTGGAAAATTATCTAACTACCAACTGAT TTTGGAATATTTTTCTGTTACTTTTCCATATGAAAGGTTGTATTATACAA TAAAGGTAACTACATGTTAGAGGATTACTACAAATCCATTTTCAATTTAA TGTATTTGCAAATAGATTTTATTTCTCGTATCTTTACAATAAATTCTAAT GGTTGCATGTTTTCTATTTCTTAAATAAAATCCATTATTTTGGTTAKGSC ACTTACAAGTGTTTCAATTCAATTCAAAGGGCTCTATCCAATTCCTCGTT GTTTCCTATTATCATGAGACTAAATTATTATTATATTAAAANNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNATTTTATAATAAGGGAATTAAATATTCCAAAATA AAAAGTTTTATAATTTATTTATTTCCTTTTCAGTAATACAATTTACTTCT TAGACACAAGAGACTTAATGGAAATACGAGATCAAGTAAGATATTCACAA GTTAAATTATGAATTAAGTTAATTTAATTATATTTTTGCTTTTTTTAGAG AATATCTTGGAGACCCGAGAAAAAAGCGTTTGAAATGTGCTTAGTCAAAG GGAAAACAGAGGTGAGTGGTCTATATAAAATGTGGCTCSTCAACAACAAA AAAAAACTAGCAAAATTCATCCTCACAATGAAAGAATTATAAATTTATTT TTAATTTAATTTGAAAGGGAAAATATCGAGATGATCTTATGTTAGATACA TTATATATTGGCTCTTAGTTAAATTCAACATTCTGAGGCATCTTACAACA TACGAGAAATTTGAATTCAAAGCCTATAACTGACACAAATATGTCTATGT CATATTGGGCTGTATATACCCGTATATAGAGCAAAAAATAAAATGGGATT TTTTTTCTTTTGCTAGATTTTTGTTCTAGATTGTATTTGTTATTAGTCAC AACATATCTAAATAGTTCCAAGCTGAGTTGGATAAAAATTCAGGTATTTA TTTTGTCTTTTTATAAATAGTCAGGAGGCTTGAATAAATGGAAAATGATT TCATCTTATAAAACCATTTTTAAAATAGAGAGATTTGTCTTATCGATAAA AATATTTTCTTGAAAAACAAGGGACATAGCTCATCTCAAAAAACCAATGA ATAGTCATATGTAAGATGATTGAGCCTTTAGTGTATTTTTCAACTAATCA TCTTAAGCCAAGATTCTCCTCATATTTAATTCATATGATATATTTTGCAG TCTGAATGTCAAAACCACATACGTGTCCTTGCAAAACTAGAGGCAAAGAA GCTCCTCGTTTGCGGAACCCATGCTTACAAACCCAAGTGTCGCCATTATC AATTTAAGGTAAGAGATATCTATATTTAATATAAGGTAAACTTTAATTTG GATCAATTTAAAGACACTCTACAAGTCCTACTAATTTCTAATACTAGAAT GGTCAGATGTAAGAAAAATTATACGGAACAGCTGGAAAGTCATTTTGACT GCCACTCCAATCAAATTCCTTTTGTAAAGAGTATTTATATATATTAGAGC AAAATAATTTATACTTTTTATAACACACGTACGCAGAATAATATTTCAAA AATTCACCAATCAAATATAATAATACTTGATAACCTGTTACGAACATTTA ATCAGTTTTTTCGTATCAAATCTGGTTTTCCAGATAGTTTCGAGTATTAT TCCCCTTTTTGTAGGTTTGAGACCACTTTTGAGAAAGAGAAAAAAATAGT TATTTTAAAGATCATGGTCGTGCACTATAATCGTAACATACTTTGACCTC ATCTAGTTCCCGTATGAGTGCAGCTCAGAAAAGTATCTCCTACTCATACA AGAGGTGAGGTAACTAATAAACTGAAATTTCCATTTGTTTTCACTTTGAG CCAGTTGTCGAGATGGAGCAACATAGATGAAATACGATATTCAAATTATT TCAAAATGGCCACGAAGCAAAGGTCCTCCCCAAACTCACTTGCTACCAAG AAACACAGTTCGTTAAAGAAGCTGGAGACATATAACAAAATTACAAGGAA ACTCCAGGACATATTTCAGGTGAAGAAAGCGACTCCTACCTTACAATCAG GGCTGTGATAAATTTAGTTATTAGTCTGAATACCCTTATACCCATCAGAG GATTAGGCCCATAAAATATGCACTCTCAAAAAACAAACAGCACACTGTCG GATGCAACTCAATAATAGGATCAAAAACTACGTAGCTCAATTGAAATTGT TATAGAGAAACGCAATGTGCGTAAATTTGCGCCCTTGTCGTTCCTAGAGA AGGAAATATACTTAATGTATGTGGACTTCAAAGAAGATTCCTAGTTCCGA TTGAGTAAACTTAATGTTATAATGTTTACTTTTGCCTAATCAGTACAACC CCATGTGACCAATGAAACAAACATTAAAAAACGCTGCTGTGTGTGGAAAT TTAGCACATGTCTTTTAGGAATCTAACAAGTAGTTAGAGTCCTTCTTCAG CAACTTCCTCATGGTTCCAGTTCCCTTGAGAGCCTCCTGATTGACGTTGA AGTGTTGGATTCAATCACAACTAANNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NCGTGGAGCCATATTGAAAATTAATATGCTATAACCATCCATGTCATTAA ATAAAACCAACAAATTCGTTACCATGCCTTTGTTGAGGATTTGGAATAGA GCACAGTTCGCTCCAATTGTAGTGCACGAGCCTGTATGGTGCGCCGGGGG AAGTTGTGCACTAAGGTAGGGTGTTGTGGGGGATTATTATAGAACTAGTA TGTCAATATGTAGTGTATACATCTAACAGACAAACAATAATAATAACAAG AAAAACAAAAACGGGGGAAATGGAATCACATTATTTTCATTTTTTTGAAA AAGCCAAAAAGGAAAATGTGAAACGGCTGTCTATTTTGTTCGTTTCTTTT ACTCCATACATATTATTATTATTCCTAATTTAAAATAAGATATTTTTCAT CAATTTTTCCAAATATATACATATATATACTTGGAGAAGAGAAAAAAAAG TTTTTCTTTTTTTTTTAG
back to top
Add to Basket