EMLSAG00000000021, EMLSAG00000000021-682787 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000021
Unique NameEMLSAG00000000021-682787
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:Rim "Rab3 interacting molecule" species:7227 "Drosophila melanogaster" [GO:0008021 "synaptic vesicle" evidence=NAS] [GO:0016192 "vesicle-mediated transport" evidence=NAS] [GO:0007269 "neurotransmitter secretion" evidence=NAS] [GO:0016079 "synaptic vesicle exocytosis" evidence=ISS] [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0005083 "small GTPase regulator activity" evidence=ISS] [GO:0017157 "regulation of exocytosis" evidence=ISS] [GO:0070073 "clustering of voltage-gated calcium channels" evidence=IMP] [GO:0007274 "neuromuscular synaptic transmission" evidence=IMP] [GO:0048786 "presynaptic active zone" evidence=IDA] [GO:0048167 "regulation of synaptic plasticity" evidence=IMP] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 EMBL:AE014297 GO:GO:0006886 GO:GO:0048167 GO:GO:0046872 GO:GO:0008021 GO:GO:0007274 GO:GO:0048786 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 GO:GO:0016079 KO:K15297 GeneTree:ENSGT00550000074588 GO:GO:0070073 FlyBase:FBgn0053547 RefSeq:NP_001014630.3 UniGene:Dm.1235 ProteinModelPortal:Q9VEE5 SMR:Q9VEE5 IntAct:Q9VEE5 PRIDE:Q9VEE5 EnsemblMetazoa:FBtr0301555 GeneID:42150 KEGG:dme:Dmel_CG33547 UCSC:CG33547-RA CTD:42150 InParanoid:Q9VEE5 OMA:SWGRRRI PhylomeDB:Q9VEE5 SignaLink:Q9VEE5 NextBio:827418 Bgee:Q9VEE5 Uniprot:Q9VEE5)

HSP 1 Score: 159.844 bits (403), Expect = 5.385e-44
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:unc-10 species:6239 "Caenorhabditis elegans" [GO:0040011 "locomotion" evidence=IMP] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0030424 GO:GO:0006886 GO:GO:0008104 GO:GO:0005509 GO:GO:0030054 GO:GO:0007626 GO:GO:0007617 GO:GO:0048786 GO:GO:0007271 SUPFAM:SSF49562 GO:GO:0040011 GO:GO:0043051 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 GO:GO:0040018 GO:GO:0017137 GO:GO:0030742 GO:GO:0030421 GO:GO:0016082 GO:GO:0032224 eggNOG:NOG286957 OrthoDB:EOG7BGHJV KO:K15297 GeneTree:ENSGT00550000074588 EMBL:AF257062 EMBL:FO081400 PIR:T29736 RefSeq:NP_001024901.1 RefSeq:NP_741831.1 UniGene:Cel.6180 ProteinModelPortal:Q22366 SMR:Q22366 IntAct:Q22366 MINT:MINT-3384948 PaxDb:Q22366 PRIDE:Q22366 EnsemblMetazoa:T10A3.1a GeneID:180990 KEGG:cel:CELE_T10A3.1 UCSC:T10A3.1b CTD:180990 WormBase:T10A3.1a WormBase:T10A3.1b HOGENOM:HOG000019307 InParanoid:Q22366 OMA:HLIFNDS NextBio:911884 ArrayExpress:Q22366 Uniprot:Q22366)

HSP 1 Score: 115.546 bits (288), Expect = 8.863e-29
Identity = 58/106 (54.72%), Postives = 72/106 (67.92%), Query Frame = 0
Query:   17 ITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRK-AGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            + PDLSHL+ EEREIIENV +RQ +EE+KE    +   EE+ +L+ QI  + E  +K  G + D  CQIC KTKFADGIGH C YC LR CARCGG+   + NK I
Sbjct:    6 MMPDLSHLSAEEREIIENVFKRQKDEEAKETQISQKASEELSELDKQITERKETSKKLVGTQDDAICQICQKTKFADGIGHKCFYCQLRSCARCGGRAQSK-NKAI 110          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:unc-10 "Rab-3-interacting molecule unc-10" species:6239 "Caenorhabditis elegans" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0006887 "exocytosis" evidence=IEA] [GO:0007271 "synaptic transmission, cholinergic" evidence=IMP] [GO:0007617 "mating behavior" evidence=IMP] [GO:0007626 "locomotory behavior" evidence=IMP] [GO:0008022 "protein C-terminus binding" evidence=IPI] [GO:0008104 "protein localization" evidence=IMP] [GO:0016082 "synaptic vesicle priming" evidence=IDA] [GO:0017137 "Rab GTPase binding" evidence=IEA;IGI] [GO:0030054 "cell junction" evidence=IEA] [GO:0030421 "defecation" evidence=IMP] [GO:0030424 "axon" evidence=IDA] [GO:0032224 "positive regulation of synaptic transmission, cholinergic" evidence=IMP] [GO:0040011 "locomotion" evidence=IMP] [GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP] [GO:0043051 "regulation of pharyngeal pumping" evidence=IMP] [GO:0045202 "synapse" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048786 "presynaptic active zone" evidence=IDA] [GO:0050806 "positive regulation of synaptic transmission" evidence=IDA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0030424 GO:GO:0006886 GO:GO:0008104 GO:GO:0005509 GO:GO:0030054 GO:GO:0007626 GO:GO:0007617 GO:GO:0048786 GO:GO:0007271 SUPFAM:SSF49562 GO:GO:0040011 GO:GO:0043051 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 GO:GO:0040018 GO:GO:0017137 GO:GO:0030742 GO:GO:0030421 GO:GO:0016082 GO:GO:0032224 eggNOG:NOG286957 OrthoDB:EOG7BGHJV KO:K15297 GeneTree:ENSGT00550000074588 EMBL:AF257062 EMBL:FO081400 PIR:T29736 RefSeq:NP_001024901.1 RefSeq:NP_741831.1 UniGene:Cel.6180 ProteinModelPortal:Q22366 SMR:Q22366 IntAct:Q22366 MINT:MINT-3384948 PaxDb:Q22366 PRIDE:Q22366 EnsemblMetazoa:T10A3.1a GeneID:180990 KEGG:cel:CELE_T10A3.1 UCSC:T10A3.1b CTD:180990 WormBase:T10A3.1a WormBase:T10A3.1b HOGENOM:HOG000019307 InParanoid:Q22366 OMA:HLIFNDS NextBio:911884 ArrayExpress:Q22366 Uniprot:Q22366)

HSP 1 Score: 115.546 bits (288), Expect = 8.863e-29
Identity = 58/106 (54.72%), Postives = 72/106 (67.92%), Query Frame = 0
Query:   17 ITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRK-AGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            + PDLSHL+ EEREIIENV +RQ +EE+KE    +   EE+ +L+ QI  + E  +K  G + D  CQIC KTKFADGIGH C YC LR CARCGG+   + NK I
Sbjct:    6 MMPDLSHLSAEEREIIENVFKRQKDEEAKETQISQKASEELSELDKQITERKETSKKLVGTQDDAICQICQKTKFADGIGHKCFYCQLRSCARCGGRAQSK-NKAI 110          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:rims2a "regulating synaptic membrane exocytosis 2a" species:7955 "Danio rerio" [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 ZFIN:ZDB-GENE-040426-1656 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 OrthoDB:EOG7BGHJV GeneTree:ENSGT00550000074588 OMA:NGSGMKH EMBL:CU695177 EMBL:CABZ01050945 EMBL:CABZ01050946 EMBL:CABZ01050947 EMBL:CABZ01050948 EMBL:CABZ01050949 EMBL:CABZ01050950 EMBL:CABZ01052252 EMBL:CABZ01052253 EMBL:CABZ01052254 EMBL:CABZ01052255 EMBL:CABZ01052256 EMBL:CABZ01066283 EMBL:CABZ01066284 EMBL:CABZ01066285 EMBL:CABZ01066286 EMBL:CABZ01066287 EMBL:CABZ01066288 EMBL:CABZ01066289 EMBL:CABZ01066290 EMBL:CABZ01066291 EMBL:CABZ01073503 EMBL:CABZ01073504 EMBL:CABZ01073505 EMBL:CR925804 Ensembl:ENSDART00000079296 ArrayExpress:E7FFP0 Bgee:E7FFP0 Uniprot:E7FFP0)

HSP 1 Score: 103.219 bits (256), Expect = 1.608e-24
Identity = 60/116 (51.72%), Postives = 72/116 (62.07%), Query Frame = 0
Query:    9 PSSGSSSQITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDC---TCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            P SG      PDLSHLT EER+II  VM RQ  EE KE   L+  H+Q E+ K + Q   K   + ++G E      TC IC KTKFADG GH+C YC  + CARCGG+V+LRSNK
Sbjct:    7 PRSGPVLPEMPDLSHLTEEERKIILGVMDRQKKEEEKEQSMLKKLHQQFEMYKDQVQ---KMGEEAQSGPEQKSDAPTCGICHKTKFADGCGHLCSYCQTKFCARCGGRVSLRSNK 119          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:Rims2 "Regulating synaptic membrane exocytosis protein 2" species:10116 "Rattus norvegicus" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0017156 "calcium ion-dependent exocytosis" evidence=IEA] [GO:0017157 "regulation of exocytosis" evidence=IEA] [GO:0019933 "cAMP-mediated signaling" evidence=IEA] [GO:0030054 "cell junction" evidence=IEA] [GO:0030073 "insulin secretion" evidence=IEA] [GO:0042391 "regulation of membrane potential" evidence=IEA] [GO:0042734 "presynaptic membrane" evidence=IEA] [GO:0044325 "ion channel binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 RGD:620001 GO:GO:0006886 GO:GO:0046872 GO:GO:0019933 GO:GO:0030054 GO:GO:0042734 GO:GO:0042391 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 GO:GO:0017156 SUPFAM:SSF50156 GO:GO:0030073 GO:GO:0048791 GO:GO:0017157 eggNOG:NOG286957 HOVERGEN:HBG058147 OrthoDB:EOG7BGHJV CTD:9699 KO:K15297 GeneTree:ENSGT00550000074588 EMBL:AF199322 EMBL:AF199323 EMBL:AF199324 EMBL:AF199325 EMBL:AF199326 EMBL:AF199327 EMBL:AF199328 EMBL:AF199329 EMBL:AF199330 EMBL:AF199331 EMBL:AF199332 EMBL:AF199335 EMBL:AF548738 RefSeq:NP_446397.1 RefSeq:NP_665888.1 UniGene:Rn.161948 PDB:2A20 PDB:2BWQ PDB:2CJS PDBsum:2A20 PDBsum:2BWQ PDBsum:2CJS ProteinModelPortal:Q9JIS1 SMR:Q9JIS1 DIP:DIP-29192N IntAct:Q9JIS1 MINT:MINT-270417 PhosphoSite:Q9JIS1 PaxDb:Q9JIS1 PRIDE:Q9JIS1 Ensembl:ENSRNOT00000006393 GeneID:116839 KEGG:rno:116839 InParanoid:Q9JIS1 OMA:SSARMKN EvolutionaryTrace:Q9JIS1 NextBio:619731 Genevestigator:Q9JIS1 Uniprot:Q9JIS1)

HSP 1 Score: 98.2117 bits (243), Expect = 9.607e-23
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II+ VM RQ  EE KE   L+  H+Q E+ K + +   +   Q++       TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 129          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:Rims2 "regulating synaptic membrane exocytosis 2" species:10116 "Rattus norvegicus" [GO:0005515 "protein binding" evidence=IPI] [GO:0005622 "intracellular" evidence=ISO] [GO:0005623 "cell" evidence=ISO] [GO:0006887 "exocytosis" evidence=TAS] [GO:0017156 "calcium ion-dependent exocytosis" evidence=ISO] [GO:0017157 "regulation of exocytosis" evidence=ISO] [GO:0019904 "protein domain specific binding" evidence=IDA] [GO:0019933 "cAMP-mediated signaling" evidence=ISO] [GO:0030073 "insulin secretion" evidence=ISO] [GO:0042391 "regulation of membrane potential" evidence=ISO] [GO:0043234 "protein complex" evidence=IDA] [GO:0044325 "ion channel binding" evidence=ISO] [GO:0045202 "synapse" evidence=IDA] [GO:0046982 "protein heterodimerization activity" evidence=IDA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=ISO] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 RGD:620001 GO:GO:0006886 GO:GO:0046872 GO:GO:0019933 GO:GO:0030054 GO:GO:0042734 GO:GO:0042391 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 GO:GO:0017156 SUPFAM:SSF50156 GO:GO:0030073 GO:GO:0048791 GO:GO:0017157 eggNOG:NOG286957 HOVERGEN:HBG058147 OrthoDB:EOG7BGHJV CTD:9699 KO:K15297 GeneTree:ENSGT00550000074588 EMBL:AF199322 EMBL:AF199323 EMBL:AF199324 EMBL:AF199325 EMBL:AF199326 EMBL:AF199327 EMBL:AF199328 EMBL:AF199329 EMBL:AF199330 EMBL:AF199331 EMBL:AF199332 EMBL:AF199335 EMBL:AF548738 RefSeq:NP_446397.1 RefSeq:NP_665888.1 UniGene:Rn.161948 PDB:2A20 PDB:2BWQ PDB:2CJS PDBsum:2A20 PDBsum:2BWQ PDBsum:2CJS ProteinModelPortal:Q9JIS1 SMR:Q9JIS1 DIP:DIP-29192N IntAct:Q9JIS1 MINT:MINT-270417 PhosphoSite:Q9JIS1 PaxDb:Q9JIS1 PRIDE:Q9JIS1 Ensembl:ENSRNOT00000006393 GeneID:116839 KEGG:rno:116839 InParanoid:Q9JIS1 OMA:SSARMKN EvolutionaryTrace:Q9JIS1 NextBio:619731 Genevestigator:Q9JIS1 Uniprot:Q9JIS1)

HSP 1 Score: 98.2117 bits (243), Expect = 9.607e-23
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II+ VM RQ  EE KE   L+  H+Q E+ K + +   +   Q++       TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 129          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:Rims2 "Regulating synaptic membrane exocytosis protein 2" species:10116 "Rattus norvegicus" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 GeneTree:ENSGT00550000074588 EMBL:AABR06050516 EMBL:AABR06050517 EMBL:AABR06050518 EMBL:AABR06050519 EMBL:AABR06050520 EMBL:AABR06050521 EMBL:AABR06050522 EMBL:AABR06050523 EMBL:AABR06050524 EMBL:AABR06050525 Ensembl:ENSRNOT00000050753 NextBio:35575765 Uniprot:F1LNC5)

HSP 1 Score: 97.4413 bits (241), Expect = 1.301e-22
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II+ VM RQ  EE KE   L+  H+Q E+ K + +   +   Q++       TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 129          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:Rims2 "Regulating synaptic membrane exocytosis protein 2" species:10116 "Rattus norvegicus" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 GeneTree:ENSGT00550000074588 EMBL:AABR06050516 EMBL:AABR06050517 EMBL:AABR06050518 EMBL:AABR06050519 EMBL:AABR06050520 EMBL:AABR06050521 EMBL:AABR06050522 EMBL:AABR06050523 EMBL:AABR06050524 EMBL:AABR06050525 Ensembl:ENSRNOT00000041618 NextBio:35574092 ArrayExpress:D4ABU5 Uniprot:D4ABU5)

HSP 1 Score: 97.4413 bits (241), Expect = 1.355e-22
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II+ VM RQ  EE KE   L+  H+Q E+ K + +   +   Q++       TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 129          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:RIMS2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 OrthoDB:EOG7BGHJV GeneTree:ENSGT00550000074588 OMA:NGSGMKH EMBL:AAEX03008716 EMBL:AAEX03008708 EMBL:AAEX03008709 EMBL:AAEX03008710 EMBL:AAEX03008711 EMBL:AAEX03008712 EMBL:AAEX03008713 EMBL:AAEX03008714 EMBL:AAEX03008715 Ensembl:ENSCAFT00000047827 Uniprot:J9NYS3)

HSP 1 Score: 96.2857 bits (238), Expect = 4.621e-22
Identity = 54/103 (52.43%), Postives = 66/103 (64.08%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II  VM RQ  EE KE   L+  H+Q E+ K + +   +   Q++       TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 129          
BLAST of EMLSAG00000000021 vs. GO
Match: - (symbol:RIMS2 "Regulating synaptic membrane exocytosis protein 2" species:9606 "Homo sapiens" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0017156 "calcium ion-dependent exocytosis" evidence=IEA] [GO:0017157 "regulation of exocytosis" evidence=IEA] [GO:0019933 "cAMP-mediated signaling" evidence=IEA] [GO:0030073 "insulin secretion" evidence=IEA] [GO:0042391 "regulation of membrane potential" evidence=IEA] [GO:0044325 "ion channel binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 GO:GO:0019933 GO:GO:0042391 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 GO:GO:0017156 SUPFAM:SSF50156 GO:GO:0030073 GO:GO:0048791 GO:GO:0017157 EMBL:AC012213 OrthoDB:EOG7BGHJV EMBL:AC007751 EMBL:AC090448 EMBL:AC090686 EMBL:AC107933 EMBL:AP001572 EMBL:AP002849 HGNC:HGNC:17283 ProteinModelPortal:E9PFB6 SMR:E9PFB6 Ensembl:ENST00000504942 NextBio:35501821 ArrayExpress:E9PFB6 Bgee:E9PFB6 Uniprot:E9PFB6)

HSP 1 Score: 95.5153 bits (236), Expect = 5.966e-22
Identity = 54/103 (52.43%), Postives = 66/103 (64.08%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II  VM RQ  EE KE   L+  H+Q E+ K + +   +   Q++       TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 129          
BLAST of EMLSAG00000000021 vs. C. finmarchicus
Match: gi|592749621|gb|GAXK01204792.1| (TSA: Calanus finmarchicus comp540019_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 171.014 bits (432), Expect = 2.120e-48
Identity = 80/104 (76.92%), Postives = 90/104 (86.54%), Query Frame = 0
Query:   18 TPDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            TPDLSHLTPEER IIE VMQ+QH EESKEI FL+ KQ EV+ LE QI  KAE Q+KAG EL+ TCQ+CLKTKFADGIGH+C+YC++RCCARCGGKVTLRSNK I
Sbjct: 6167 TPDLSHLTPEERLIIEGVMQKQHAEESKEIKFLKQKQIEVINLEQQIRQKAEHQKKAGVELEATCQVCLKTKFADGIGHLCNYCNVRCCARCGGKVTLRSNKVI 6478          
BLAST of EMLSAG00000000021 vs. C. finmarchicus
Match: gi|592808591|gb|GAXK01145977.1| (TSA: Calanus finmarchicus comp583011_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 28.1054 bits (61), Expect = 9.255e+0
Identity = 17/55 (30.91%), Postives = 28/55 (50.91%), Query Frame = 0
Query:   70 MQRKAGAELDCTCQIC-------LKTKFADGIGHICHYCSLRCCARCGGKVTLRS 117
             Q + G +L+C   +        L+ K +  IGH+  Y  L+ C RC G++ LR+
Sbjct:  945 FQGQGGLDLECVMVMTHSFYLNFLRWKISIHIGHLGTYSPLQGCVRC-GQILLRN 1106          
BLAST of EMLSAG00000000021 vs. C. finmarchicus
Match: gi|592894841|gb|GAXK01063534.1| (TSA: Calanus finmarchicus comp1340710_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 28.1054 bits (61), Expect = 9.362e+0
Identity = 16/43 (37.21%), Postives = 23/43 (53.49%), Query Frame = 0
Query:   48 MFLRHKQEEVMKLEAQIHHKAEMQRKAGAELD------CTCQI 84
            +FL    EEV  LE Q+H + ++  +AG  LD      C+C I
Sbjct:  124 VFLHRDGEEVPHLEDQVHDQHQLGCEAGENLDHCVAYGCSCSI 252          
BLAST of EMLSAG00000000021 vs. L. salmonis peptides
Match: EMLSAP00000000021 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:96464:133388:-1 gene:EMLSAG00000000021 transcript:EMLSAT00000000021 description:"maker-LSalAtl2s1004-snap-gene-0.27")

HSP 1 Score: 249.595 bits (636), Expect = 3.573e-86
Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = 0
Query:    1 MSLTPRSIPSSGSSSQITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            MSLTPRSIPSSGSSSQITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI
Sbjct:    1 MSLTPRSIPSSGSSSQITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121          
BLAST of EMLSAG00000000021 vs. SwissProt
Match: gi|41017531|sp|Q22366.2|RIM_CAEEL (RecName: Full=Rab-3-interacting molecule unc-10; Short=Rim; AltName: Full=Uncoordinated protein 10)

HSP 1 Score: 115.546 bits (288), Expect = 5.977e-30
Identity = 58/106 (54.72%), Postives = 72/106 (67.92%), Query Frame = 0
Query:   17 ITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRK-AGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            + PDLSHL+ EEREIIENV +RQ +EE+KE    +   EE+ +L+ QI  + E  +K  G + D  CQIC KTKFADGIGH C YC LR CARCGG+   + NK I
Sbjct:    6 MMPDLSHLSAEEREIIENVFKRQKDEEAKETQISQKASEELSELDKQITERKETSKKLVGTQDDAICQICQKTKFADGIGHKCFYCQLRSCARCGGRAQSK-NKAI 110          
BLAST of EMLSAG00000000021 vs. SwissProt
Match: gi|34395746|sp|Q9JIS1.1|RIMS2_RAT (RecName: Full=Regulating synaptic membrane exocytosis protein 2; AltName: Full=Rab-3-interacting molecule 2; Short=RIM 2)

HSP 1 Score: 98.2117 bits (243), Expect = 7.710e-24
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--HKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II+ VM RQ  EE KE   L+  H+Q E+ K + +   +   Q++       TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 129          
BLAST of EMLSAG00000000021 vs. SwissProt
Match: gi|34395823|sp|Q9EQZ7.1|RIMS2_MOUSE (RecName: Full=Regulating synaptic membrane exocytosis protein 2; AltName: Full=Rab-3-interacting molecule 2; Short=RIM 2; AltName: Full=Rab-3-interacting protein 2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.642e-19
Identity = 54/143 (37.76%), Postives = 68/143 (47.55%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLR-----------------------------HKQEEVMKLEAQIHHKAEMQRKAGAELDC-------------TCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II  VM RQ  EE KE   L+                              KQ    + + ++H + EM ++   ++               TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKIKEEHKAQPTQWFPFSGITELVNNVLQPQQKQPNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 169          
BLAST of EMLSAG00000000021 vs. SwissProt
Match: gi|41019522|sp|Q9UQ26.2|RIMS2_HUMAN (RecName: Full=Regulating synaptic membrane exocytosis protein 2; AltName: Full=Rab-3-interacting molecule 2; Short=RIM 2; AltName: Full=Rab-3-interacting protein 3)

HSP 1 Score: 83.1889 bits (204), Expect = 1.197e-18
Identity = 50/134 (37.31%), Postives = 69/134 (51.49%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKE--------------------IMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDC-------------TCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLT EER+II  VM RQ  +  +E                    ++  + KQ+   + + ++H + EM ++   ++               TC IC KTKFADG GH C YC  + CARCGG+V+LRSNK
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKKVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK 160          
BLAST of EMLSAG00000000021 vs. SwissProt
Match: gi|34395763|sp|Q86UR5.1|RIMS1_HUMAN (RecName: Full=Regulating synaptic membrane exocytosis protein 1; AltName: Full=Rab-3-interacting molecule 1; Short=RIM 1; AltName: Full=Rab-3-interacting protein 2)

HSP 1 Score: 82.4185 bits (202), Expect = 2.333e-18
Identity = 56/133 (42.11%), Postives = 63/133 (47.37%), Query Frame = 0
Query:   16 QITPDLSHLTPEEREIIENVMQRQHNEESKEIMFLR--------------------HKQEEVMKLEAQIHHKAEMQRKAGAEL----------DCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSN 118
            Q  PDLSHLT EER II  VM RQ  EE KE   L+                       +   +L  Q     E  RK G E             TC IC KTKFADG GH+C YC  + CARCGG+V+LRSN
Sbjct:   20 QELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSN 152          
BLAST of EMLSAG00000000021 vs. SwissProt
Match: gi|34395745|sp|Q9JIR4.1|RIMS1_RAT (RecName: Full=Regulating synaptic membrane exocytosis protein 1; AltName: Full=Rab-3-interacting molecule 1; Short=RIM 1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.343e-15
Identity = 56/156 (35.90%), Postives = 63/156 (40.38%), Query Frame = 0
Query:   16 QITPDLSHLTPEEREIIENVMQRQ---------------------------HNEESKE----IMFLR------------HKQEEVMKLEAQIHHKAEMQRKAGAEL----------DCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSN 118
            Q  PDLSHLT EER II  VM RQ                            N ES+     +   R               E   +L  Q     E  RK G E             TC IC KTKFADG GH+C YC  + CARCGG+V+LRSN
Sbjct:   20 QELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPERDWRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSN 175          
BLAST of EMLSAG00000000021 vs. SwissProt
Match: gi|122065961|sp|Q99NE5.2|RIMS1_MOUSE (RecName: Full=Regulating synaptic membrane exocytosis protein 1; AltName: Full=Rab-3-interacting molecule 1; Short=RIM 1; AltName: Full=Rab-3-interacting protein 1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.704e-15
Identity = 55/156 (35.26%), Postives = 63/156 (40.38%), Query Frame = 0
Query:   16 QITPDLSHLTPEEREIIENVMQRQ---------------------------HNEESKE----IMFLR------------HKQEEVMKLEAQIHHKAEMQRKAGAEL----------DCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSN 118
            Q  PDLSHLT EER II  VM RQ                            N ES+     +   R               +   +L  Q     E  RK G E             TC IC KTKFADG GH+C YC  + CARCGG+V+LRSN
Sbjct:   20 QELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPDRNWRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSN 175          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: EEB17818.1 (rab3 interacting molecule, putative [Pediculus humanus corporis])

HSP 1 Score: 154.451 bits (389), Expect = 3.240e-46
Identity = 72/103 (69.90%), Postives = 82/103 (79.61%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLT EER+IIE VM RQ  EE +E   +R KQ+EV  LE  I  ++E Q+KAG ELD TC ICLKTKFADG+GHIC+YCS+RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTEEERQIIEKVMMRQKQEEERENEIMRRKQDEVQVLEETIRQRSEQQKKAGIELDATCHICLKTKFADGVGHICNYCSIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06478.1 (Rab3 interacting molecule, isoform P [Drosophila melanogaster])

HSP 1 Score: 160.229 bits (404), Expect = 7.950e-46
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06486.1 (Rab3 interacting molecule, isoform K [Drosophila melanogaster])

HSP 1 Score: 159.844 bits (403), Expect = 9.375e-46
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06481.1 (Rab3 interacting molecule, isoform F [Drosophila melanogaster])

HSP 1 Score: 159.844 bits (403), Expect = 9.375e-46
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06480.2 (Rab3 interacting molecule, isoform T [Drosophila melanogaster])

HSP 1 Score: 159.844 bits (403), Expect = 1.110e-45
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06485.2 (Rab3 interacting molecule, isoform R [Drosophila melanogaster])

HSP 1 Score: 159.844 bits (403), Expect = 1.117e-45
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06489.2 (Rab3 interacting molecule, isoform Z [Drosophila melanogaster])

HSP 1 Score: 159.458 bits (402), Expect = 1.144e-45
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06488.2 (Rab3 interacting molecule, isoform V [Drosophila melanogaster])

HSP 1 Score: 159.458 bits (402), Expect = 1.150e-45
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AAF55479.5 (Rab3 interacting molecule, isoform Q [Drosophila melanogaster])

HSP 1 Score: 158.688 bits (400), Expect = 2.138e-45
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Match: AFH06484.2 (Rab3 interacting molecule, isoform U [Drosophila melanogaster])

HSP 1 Score: 158.688 bits (400), Expect = 2.139e-45
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1058261406|gb|JAT34188.1| (hypothetical protein g.49714, partial [Graphocephala atropunctata])

HSP 1 Score: 154.836 bits (390), Expect = 8.479e-46
Identity = 71/103 (68.93%), Postives = 85/103 (82.52%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTPEER+IIE+VM RQ  EE +E+  +R KQ+EV  LE  I  ++E Q+KAG ELD TC ICLKTKFADG+GH+C+YC++RCCARCGGKVTLRSNK I
Sbjct:   35 PDLSHLTPEERQIIESVMMRQKQEEDRELEIMRRKQDEVEVLEETIRQRSEQQKKAGVELDATCHICLKTKFADGVGHMCNYCNIRCCARCGGKVTLRSNKVI 137          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1062693539|ref|XP_017966150.1| (PREDICTED: rab-3-interacting molecule unc-10-like, partial [Drosophila navojoa])

HSP 1 Score: 152.14 bits (383), Expect = 1.393e-45
Identity = 71/101 (70.30%), Postives = 82/101 (81.19%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNK 105          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1037071489|ref|XP_016978178.1| (PREDICTED: rab-3-interacting molecule unc-10-like [Drosophila rhopaloa])

HSP 1 Score: 152.14 bits (383), Expect = 1.756e-45
Identity = 71/101 (70.30%), Postives = 82/101 (81.19%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNK 119
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEVMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNK 105          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1101363520|ref|XP_018907467.1| (PREDICTED: regulating synaptic membrane exocytosis protein 2-like, partial [Bemisia tabaci])

HSP 1 Score: 150.599 bits (379), Expect = 1.460e-43
Identity = 71/103 (68.93%), Postives = 82/103 (79.61%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTPEEREII++VM RQ  EE +E   +R KQ+EV  LE  I  + E Q+KAG ELD TC ICLKTKFADG+GH+C+YC +RCCARCGGKVTLRSNK I
Sbjct:   79 PDLSHLTPEEREIIQSVMMRQKQEEERENEIMRRKQDEVEVLEETIRKRNEQQKKAGVELDATCHICLKTKFADGVGHVCNYCHIRCCARCGGKVTLRSNKVI 181          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|242020225|ref|XP_002430556.1| (rab3 interacting molecule, putative [Pediculus humanus corporis] >gi|212515720|gb|EEB17818.1| rab3 interacting molecule, putative [Pediculus humanus corporis])

HSP 1 Score: 154.451 bits (389), Expect = 1.585e-43
Identity = 72/103 (69.90%), Postives = 82/103 (79.61%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLT EER+IIE VM RQ  EE +E   +R KQ+EV  LE  I  ++E Q+KAG ELD TC ICLKTKFADG+GHIC+YCS+RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTEEERQIIEKVMMRQKQEEERENEIMRRKQDEVQVLEETIRQRSEQQKKAGIELDATCHICLKTKFADGVGHICNYCSIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|194198936|gb|EDX12512.1| (GD20205 [Drosophila simulans])

HSP 1 Score: 160.614 bits (405), Expect = 2.430e-43
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1013925800|ref|XP_016034217.1| (uncharacterized protein Dsimw501_GD20205, isoform C [Drosophila simulans] >gi|1013925802|ref|XP_016034218.1| uncharacterized protein Dsimw501_GD20205, isoform D [Drosophila simulans] >gi|900913402|gb|KMZ02904.1| uncharacterized protein Dsimw501_GD20205, isoform C [Drosophila simulans] >gi|900913403|gb|KMZ02905.1| uncharacterized protein Dsimw501_GD20205, isoform D [Drosophila simulans])

HSP 1 Score: 160.614 bits (405), Expect = 2.607e-43
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1036819660|ref|XP_017067223.1| (PREDICTED: uncharacterized protein LOC108105255 isoform X6 [Drosophila eugracilis])

HSP 1 Score: 160.229 bits (404), Expect = 3.173e-43
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1036819585|ref|XP_017067219.1| (PREDICTED: regulating synaptic membrane exocytosis protein 2 isoform X2 [Drosophila eugracilis])

HSP 1 Score: 160.229 bits (404), Expect = 3.616e-43
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
BLAST of EMLSAG00000000021 vs. nr
Match: gi|1013925798|ref|XP_016034216.1| (uncharacterized protein Dsimw501_GD20205, isoform B [Drosophila simulans] >gi|900913401|gb|KMZ02903.1| uncharacterized protein Dsimw501_GD20205, isoform B [Drosophila simulans])

HSP 1 Score: 160.229 bits (404), Expect = 3.616e-43
Identity = 72/103 (69.90%), Postives = 83/103 (80.58%), Query Frame = 0
Query:   19 PDLSHLTPEEREIIENVMQRQHNEESKEIMFLRHKQEEVMKLEAQIHHKAEMQRKAGAELDCTCQICLKTKFADGIGHICHYCSLRCCARCGGKVTLRSNKKI 121
            PDLSHLTP ER  IENV+ RQ  EE K+   +R KQ+EV+ LE QI  ++E Q+KAG ELD TC ICLKTKFADG+GHICHYC++RCCARCGGKVTLRSNK I
Sbjct:    5 PDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVI 107          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000021 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-5.385e-4469.90symbol:Rim "Rab3 interacting molecule" species:722... [more]
-8.863e-2954.72symbol:unc-10 species:6239 "Caenorhabditis elegans... [more]
-8.863e-2954.72symbol:unc-10 "Rab-3-interacting molecule unc-10" ... [more]
-1.608e-2451.72symbol:rims2a "regulating synaptic membrane exocyt... [more]
-9.607e-2352.43symbol:Rims2 "Regulating synaptic membrane exocyto... [more]
-9.607e-2352.43symbol:Rims2 "regulating synaptic membrane exocyto... [more]
-1.301e-2252.43symbol:Rims2 "Regulating synaptic membrane exocyto... [more]
-1.355e-2252.43symbol:Rims2 "Regulating synaptic membrane exocyto... [more]
-4.621e-2252.43symbol:RIMS2 "Uncharacterized protein" species:961... [more]
-5.966e-2252.43symbol:RIMS2 "Regulating synaptic membrane exocyto... [more]

Pages

back to top
BLAST of EMLSAG00000000021 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 3
Match NameE-valueIdentityDescription
gi|592749621|gb|GAXK01204792.1|2.120e-4876.92TSA: Calanus finmarchicus comp540019_c0_seq1 trans... [more]
gi|592808591|gb|GAXK01145977.1|9.255e+030.91TSA: Calanus finmarchicus comp583011_c1_seq3 trans... [more]
gi|592894841|gb|GAXK01063534.1|9.362e+037.21TSA: Calanus finmarchicus comp1340710_c0_seq1 tran... [more]
back to top
BLAST of EMLSAG00000000021 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000000213.573e-86100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:9646... [more]
back to top
BLAST of EMLSAG00000000021 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
gi|41017531|sp|Q22366.2|RIM_CAEEL5.977e-3054.72RecName: Full=Rab-3-interacting molecule unc-10; S... [more]
gi|34395746|sp|Q9JIS1.1|RIMS2_RAT7.710e-2452.43RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|34395823|sp|Q9EQZ7.1|RIMS2_MOUSE1.642e-1937.76RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|41019522|sp|Q9UQ26.2|RIMS2_HUMAN1.197e-1837.31RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|34395763|sp|Q86UR5.1|RIMS1_HUMAN2.333e-1842.11RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|34395745|sp|Q9JIR4.1|RIMS1_RAT1.343e-1535.90RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|122065961|sp|Q99NE5.2|RIMS1_MOUSE3.704e-1535.26RecName: Full=Regulating synaptic membrane exocyto... [more]
back to top
BLAST of EMLSAG00000000021 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EEB17818.13.240e-4669.90rab3 interacting molecule, putative [Pediculus hum... [more]
AFH06478.17.950e-4669.90Rab3 interacting molecule, isoform P [Drosophila m... [more]
AFH06486.19.375e-4669.90Rab3 interacting molecule, isoform K [Drosophila m... [more]
AFH06481.19.375e-4669.90Rab3 interacting molecule, isoform F [Drosophila m... [more]
AFH06480.21.110e-4569.90Rab3 interacting molecule, isoform T [Drosophila m... [more]
AFH06485.21.117e-4569.90Rab3 interacting molecule, isoform R [Drosophila m... [more]
AFH06489.21.144e-4569.90Rab3 interacting molecule, isoform Z [Drosophila m... [more]
AFH06488.21.150e-4569.90Rab3 interacting molecule, isoform V [Drosophila m... [more]
AAF55479.52.138e-4569.90Rab3 interacting molecule, isoform Q [Drosophila m... [more]
AFH06484.22.139e-4569.90Rab3 interacting molecule, isoform U [Drosophila m... [more]

Pages

back to top
BLAST of EMLSAG00000000021 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|1058261406|gb|JAT34188.1|8.479e-4668.93hypothetical protein g.49714, partial [Graphocepha... [more]
gi|1062693539|ref|XP_017966150.1|1.393e-4570.30PREDICTED: rab-3-interacting molecule unc-10-like,... [more]
gi|1037071489|ref|XP_016978178.1|1.756e-4570.30PREDICTED: rab-3-interacting molecule unc-10-like ... [more]
gi|1101363520|ref|XP_018907467.1|1.460e-4368.93PREDICTED: regulating synaptic membrane exocytosis... [more]
gi|242020225|ref|XP_002430556.1|1.585e-4369.90rab3 interacting molecule, putative [Pediculus hum... [more]
gi|194198936|gb|EDX12512.1|2.430e-4369.90GD20205 [Drosophila simulans][more]
gi|1013925800|ref|XP_016034217.1|2.607e-4369.90uncharacterized protein Dsimw501_GD20205, isoform ... [more]
gi|1036819660|ref|XP_017067223.1|3.173e-4369.90PREDICTED: uncharacterized protein LOC108105255 is... [more]
gi|1036819585|ref|XP_017067219.1|3.616e-4369.90PREDICTED: regulating synaptic membrane exocytosis... [more]
gi|1013925798|ref|XP_016034216.1|3.616e-4369.90uncharacterized protein Dsimw501_GD20205, isoform ... [more]

Pages

back to top
BLAST of EMLSAG00000000021 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1004supercontigLSalAtl2s1004:96464..133388 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteRab-3-interacting molecule unc-10
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1004-snap-gene-0.27
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000021 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000021EMLSAT00000000021-695868Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1004:96464..133388-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000021-682787 ID=EMLSAG00000000021-682787|Name=EMLSAG00000000021|organism=Lepeophtheirus salmonis|type=gene|length=36925bp|location=Sequence derived from alignment at LSalAtl2s1004:96464..133388- (Lepeophtheirus salmonis)
ATGAGTTTAACACCCCGTTCAATTCCAAGCTCTGGATCAAGTTCTCAGAT AACGCCGGATCTGAGTCATCTCACACCCGAGGAACGGGAAATCATTGAGA ATGTAATGCAACGACAGCACAATGAAGAAAGTAAAGAAATCATGTTTCTA AGGTAAGTCATTTAACCAAAGTTTGACGGTACAAGTATCGCATTTTGACT AAAGAAATATCCATTGATTAGTATACTATGAATGTACAAGAAATGTACAT GGTAATATTGTTACTAATACACTCCCGTATTCCATCAAAAATAAAACAAA TACAAATTGTACCTATGCTCCAACAAACCCAAAGAAATCAAACCATTTTT CATTTACATTTTATATTTGAGCTTATTCTAGGCATTGTCAAGGGTCGAAA TTTTTATACAGAGCCGTTTTAAAAATTATATCATCACCATTGATGAATAA AATATGCTCCACCGATATGTCAATATAAAAGAAATCGCAAATGAAGGTGA TAATCCTTATAGAATTTGCAGTCAATACGTTATATTAAATCCACTGCAAG CAACCATGACAGGTAGGAAATGAAATCAATGCAGGAATTATTACGATGTC AATTTTCAATTCTACTTCGAGTCCTACAAGGACTTACACTTATAACTCCC GAGCAGATCTGCATTGTTAATATCCATATTTCATAAGCACACACACTGGT TGTTACTTAATACTTAGATTTTCTGTCTTCGAAAATTTAAAAAAAAAACA GCTTGGCCAAATTGATTAAGTTGCTAACGCTTTTTAGGATATATTTTATG TACCTCTGATCACTACCAAGGGGTAAAATTAATATCGTAAGAAGATCTTT TATCATTTTTTCTAAGAAATATGGATCTCGATTAAAGAGCAATAAAGTAT GTATGTGTTAGTGGTTAATNCCTATTTCACCTGCCATAAGTCTGAGGTTG TATTTTCAATTCTTGAACAAATTTGTTTATATGTACAACAAAATTCTGGA ACGCATTATGTTGAGTGTTGAGGGAACATTCTAATAAAATTTAATCAATG TTTTACCTCTATGTTCCTTCCTAGTTCAATTACGAAAGCCTAAGTACCGC TCTTGAAATTATAAGTACAATCATGAACACTACCCATTTTTGTGAGAGCA CACTCCAACTTATGGGGCACTCATTTACTAGTGTAAATACTTTGTACATG GCCCTATTATGTAACCAATTTACATCCTTCTTATCGAACAATTTTGTCTG TGGAGGACTAATTTTTAACAACGAATATATGTCATTATAGCTCATTATAT CATACAAAAAGAAAAATCCTTATAAAAAAACGCTAAAAATTMCCTATCCA AAAAAATTGGCCATATCTTGAAACCCCTAAAATCTTTTAATGATGGCACA TTGGTAAGTGTTTGACTTCTAGTCTTTTGAGATCAGGATAAAGATCATTT TGTATTTAAAGGATTCAATACTCAATCGCATTCTGTCGCCATAGTCTATG ATCTATCCAATTAAAACTATAGTAAAGGGGCAAAACTGTCGGATGCTACT AACTGTAACTGCGGGKACAACCAAGAGCCAAAAGGTATTCTATCTATATT ATTAAAGCAGAGTTCGACGCCTAATAATTCCGTGCAATGCTGAATACTCC CACTAATAATAGGTGCGTCCACAGGTGGTGGGATGGAGTGGATGTACCCT CTTTAAACTAAGAAATTTTTGGTTTTTACTATAAATTTTTTATGTCTAGT TTAAAAATCTTACGCTAAAATAGGGGCAAAAAATGGAATATTTGAAATTT AATTTTTTGAAAATGGTCGTGAATTTTTTGACATTTTTATCGGGAAAAAA ATATATTTGGATTTTTTTTCTTTAAATTTAATATTATTTGAAATTTTATT TTTGAAATATTTTTACAAAAATAAAATTAAGTATTGAAATTTTTTCCCAA AAAAATAAATTTTATATGAATTAATATGGCTTATAGAAATTTTTTTGTAA ACAAATTAATATTACAAAAAATAATTTCCCCTCAAAAATGAATAAAAAAA TACATATAGAGATAATCTTGCAGGCTCCCCTTAATAAGTAAGAAATACTC TGCTGAAATATAAGAGCTCACGCTTAAACATTTTATCCAAGAGATGGAAG TCACTAGTCTAAGATGTTTAATAAATAACTTTTAAAATAAAACTTTTTGA TGATAGCACTTTCTTTTTCCAACAGCTGGAGGAGGAGAGAGAGAAATAGA AAGACGTGAAGGGCTCCATTATAAGCATTGGTAGGAATATTTTGTCATTA TTTTTGTAATGGAATTGTTCTATTTAATTAATTTAGTGGGATATTGGTCA TTATATTGTACCTAAGMCCTCGATCCAGTCCAGCCCCACAAGTTGGCCCT TAAGCATTGTAAAATAGATCATTTGTGACGTCATTTTATGGTATTTTTTT ATTTTTAATAAATAAGGGATGACGGCTGCACTTTAACTGGTTGAATTTGC CGTTTGCTGAAATGATTGCATCAAAAATCCAAGCCCGGTTCCAGAAAGGT GATAGTCTCAAGGACATCGAGAGGTTCAGCCTGAACATCAAGAGCTTGTA CAAGGTTATGGATATGTTGAGGAAGGGGGCACGAGTTTCAGATATAAAAA GAGATCAGAGAGGACAATAGCAATACCCAGGATAGCTCCTAGCTCTGACT GAAGGCAAACCTTCAACGTCAACCTGGAGGCTCTCGTGGGAATTAAAAGT TCTTGAGAAGGCGATGCGGGGTTAATGAATAATTAGTTGTTTGTTTATTA GATTCAAAATCATAGATGTATAAATAATGTCCTAGAAAGCAGAACCGGCT TCTTCTAAATGGATTTCTAAACAGGCTTATTTATGGAATTAGATGTCCTG TTCCCATTATCAATAATATACAAAGTTATGCCCTTAACGGTCTAACGGTT CCGGGTCTTGAACCGAAACTGCAATATATTCCTTAATGATCTTGGTTGTT GTACTATTTTCGTTTGCTGTATTTTTGGTAGATGTATACCTGTTCATATT CCATCAACATAATTTTATGTAAATGAAACATGTCGTTACATTTATTGTAT CACTCAACTTGTCGTTCAAAAATGGAAAAAATGTCCCAAAATCATCTGGT AGTTAGCTAATTAAGTTAACCAAACCAACTGCTATTGATCTCTTAAGTAC TACGAGACTATTTTTGTCATATTATTTTTTTACAATTTTTAAAAGAAATT CAGAATTACACATAGTATTTATATACATAATAATAAAATCACCCCCTCCC CTCTCTAGCCTCTCCTTACGACTCCTATTTCGAAAACATATTTCAATATC CTTTCCTAGTCCCGAATTTTCTAGCGACGCCCTTATTTTAAGTGCCTCTT ACCAAAATGAGCATGTATAAAAGTAACCGAGACCGGGACCCAAAAGAACT GCTGAACCTTAACTGGGTACAACCTTGATAATAAACCAAATATTTTTAAT TGAACCATCATTTTAAGGACTCTGGATGAGATTTTCCCCAAATCTTTCTT TATCTCTCTTACAAAATTAAAGGGTCCAACAATGCGCAAAGCAAGCGTAA AGGAAATATTCTTATTTAAAGTATGAAAATATGATTAAGGATAAGAATAT GATTAAGGATAAAAATATTCAAGAATAAAAGCAGGAAAGAAGAAGGAAGG AGAACCCCTAGGACAATCATTCCGCATCATTCAATGAACAAAATATCTGC ATTCTACATGAACCTTCCTTCTATTTCTAAACAATGAATGTACATATATA CTTACTAGTGATGCAACGGGTTCAACCCACTTTGCGAACTGCTTAACTGA GAAAAGCTAGTTACTCTGAAAGTGTTTTTCAAAATAAGTAAATGCACTGG TTATTGCATAATGAACCCTGAATTTGAACGTACTGTTGAGACTCAGTTCA AAACCGAATTGTTTTTTACGGTTTGCTCTTTAGTGATGTGTCCGTTTTTG ACCGATATATTGGTTCAAGCAGGGATATTAGACAGTGGACCTAAATTTGT TTGTCTTCAAATCCTTAACCTATTTTCTCCACTATCCTGATATGATTTGT ACAACACATTTTTGTGCTAATGTTCAAAATTTTAAAACACACATAATGTT ATCAACAATTCATCAATTGAATCGGCCTTGACCGAATCTTAAAACTGATT CAGACCGATTTTATTGTAACAAGAGTACAACCCGATATTTTCTTTGGGAC CGATTCAAACCGAATTATTATTTAAAAGGGATCCAGACTGAACTTCTTTG AAAGACCGAATTAGTTTGGGCCATCAACAAATCAAAACAGTCTCATACCA GTCTAGGATTTTCAGAGAGAAACCAATGATACTGTACTGAGTGACCAGCC AAAAAGATTGATCAAGCGTCATCATTCATTTCTTTCTTCAGTCAAGAAGG GAACCAACTTAAACACCAACCTACCTGAGGCCCGTGGCTTTTTGCCGTCC TATGCAAAATATGAAGTCTACCTTTTAAAAATAAGACAAAAATATTTCAT TACTTCATTATTTTTTTAAATATAAATCTAGATATTTATTCTTCTACACA TAATATTCGAAGCACAAAGGTTGATTTTGTAAACGAACGGGTGAAAACCC CATAAGAAGAAAATATATGAAAGGTTGAGTGTGCGTATGATTATTATTAT TTTCCCTCTCTGTACCTTTTTGAATATAAGTAAGATCTCGACCCAGTTCT TAATAAAGCATTATTTATAAACACAATATTTTAATACGATGTGTTTATTA TAGAGCCTATTGTCCGGGTGAAGTATAAAATACAGATAACTTTCGTAATT ACTTTTTCATCTTTTAGGTGAATCCGAATAGTTGGTGGCATGGCCACCAA CCAATCTACTTTTTTAGCTCTATTCTGAGTACATCCTTCATTTTCTGTGC CTCGATTTCCCCACACTACTACATTTATAAAGAAGACGGAAGGAGGACTC CGAGCGAAACTTATATAAAGAGCAGACCCTCTCCGTTTCATCTTTTTTCG ACTTGTTGGTGAAGAATGTTCACGTAGGGAAACAACATTGTAGGCATCTT TCTCATGAATCGGCGAATGGATTTATCATAATCCATCCTATCCCACTTTA TCGATTCCCATGTCTGTTCTAGTCAGCTTTCGGAGTTGTTTGGAAACTAA AAGAATTGAGGAGTCGGATACTATCATTTTCACGAGCTCCTTTCGAACTT ATTGTATATTACTTTATTGACATTATTTGCTGCCCATGGTGATCCCTAAT TTCAATAGGGACTGGCATTCCTCCTGCCTTCTCCTCCCTGTTATTTCATA TATCCGAATATTTTTACAGAAAATGGGGTAAGTAACAACTGTTTCTTCAG CCTATCCAGCAAACCGCTTAGAACCAAATCATAACTGCTGAAATTTTGAT GATGATTTATGTAAAAACTTAAAAGTGTTAGAAAATATGTGGTAAGTTTG GTTTTATCACCCAACCTTTCTTCGGAAAAGAAAGGGGGGGGGGAATAAAT GGCCAGAAAATCAGTTTGTAATAGTCGCCCAATTATTTCCAACAATCGAA TTAATATTCATAAATGTTGGGTATTGAACATAGATTAACAAATGCTAATT CGACCAAATAACGTTCATATTAGTTATTTTGGTTTAATGAAGAAAATATA ACAGGTAACAATCAAAATATAGTCTAAGTTTTTGTGTTAAAGAGATTACT TAGTGAGCAAAGAAATAAATAGAATCCGAAACCGCAATTTAAGTAACCGT TATATCACTAATCCATAAAAATGTATTCCGTAGATGCATAAACTTTATCT TCTCAATTCACAATTTTTTTTATATGTTTGTTTATGGTTTTCATGTATAT TGCATGTACTTAAACGGTTATGTGAGTATGTATGAAGTTGTAGCAATAAC TGCATACTATATTCAAACGGCAGTATTTTCTTTAATAACATAGAACATAA CTCTCCAAAAAATCATCACTCTTACTTTCTGTTTTTTATGAGCACACTCA TACCTAATTACTCAAAACTTAGATGTTCCCTCCTCAAGAATGAAGTAATA ATAATGGGAGCTGGATATTATCAAGGACAGGGATTCTAAACCTTTTTTTT TAGGGATGTACCACTTGTATAATATTTTTCGGGATTTTTTTGAAAATAAA TCCAAAAATTGAACTTTTTTGGACCAAAAGTTCAAAATATTAAATTTTTT CGAAAAAGAAATCAAAAAACTTTAGTTATTCGCAAAAAATTAATCTTTTG TAGGAAAACAAACCAAAATCTATATCTGTTCTCAAAAAATTATTGAAAAT AAATATTAAATTTTTGGATACAAATTTAAAAATCCATAGCTATTCACAGT AAATTAAATTAAATGTCAAATATTCAATTTTTTGAAGAAAAAAAAATCAA GCATTAACTATCCTAGTGAAAAACAAAAATTCCTTAATTTAGGGGGTTAA AGCAATTTAAAAATAACCATACTTTAGTGCCCTATAATATTGGAATTGTA TCATGAGTCGTTCAAAAGGTCCGTAATTACGGTTGTATTACGCAGTTGAC TCCGAAAACTCAAAAGTTACATTTTTCTTAATTTAGTCATACTACTGCCG GGTTTCGGTCTCCACTCCATGGATAAATGAATATTACTTTATCTATTTAT ACTATTTTAAAAATACTTTGAAATGAAGTCCATGATTTACATAAATTAAT ACAGACGTTTTTTGATCTCTTTTATGTCATTTGATCCAGTTTTTGAATAC AAACTCTGTCCCTGCGACTACGGGGTAGTAAATAGGTCTTGCAACACCTT GCAGGCTTCGTTCTTTTCTGAATGAACTATCAAAAAAAATTGAATATCAC CTTTTATTTTTTGTTTTGTTTTTAATCATACAACATAAAAATTAACTAAT CTTTTTTATATTATCGCATATATGTACATATTTTGTAATAAAATTATAGA AAAAACTGTCTAATTTCAATTAGAATGTTTAAGTTTTAAGTTATTTTAAT TTTAAGAAGTACAAACCAAATCTTAGTAGGTTTGTGTTCCTCTTTACAAT GCTAATAAATGATATTGATCCCTACTCTTTTTTCCCCGCAAAATTAGTGG AAAAAAGTTTTTTGCAATTTTCTTGGCGAATTTCGATTTGAATATTTTTG AGCATATAAAATGGACTTCTCTTCAAATCAACTTTTTTATACATATATAT TGTAATATTGCATTTCATATAATATACAAGGGCTACATTATCATACCTCT AAGAATATTTTAACACTTGTACGCACCGAAAGTGTCTAATCATTAACAAA TAATAGCATTGACCATTCTCAGTGTGATTTCCCACTCTCTTCTTGGCCCA AGCAATGCCAGGTAACCCTTTACTATTAAATATATATAAAAAGCACACTA GTTTAGATATATTTTGTTCCAAATTCAAAGATGTATCAATTTTAGTTGGA GTATAACTTGGTTATACATCAGATATTTTTAACACTCTTTTAGTGAACAT TCATTTTTTGACGTAGTTAATGAACTTGGGTCTAACTTTAACCCAAATAT AAAGATAATTTAATTCATTGATACACCATTACGGATTAGAATGATGCATC AACAAGATATAATATGTGATAATTATAATATCAGTTAAATATTAAAATTT CTATTTCGAGTAAAAATTATATGAAATATAAATTGTGCTAATCGAACATT TGGTACTAAAAATGTACTCATTAACTTCGTTGTAATTTGTAGCAACGCAT ATACCTTAAACTGAAAAAGGAGATATATACACAACAAAATAACAAATTAA AAGTGACCAAATTAATCAAATTTACCCAACATTGATTAAAATTGTAAAGG CTGCGAATAATTTGTAGAAAATACATTTTTGCAACAGCAAAAAGTTGCAT TTTTCTAAAAAATGTTTGCAGGATCATATTAATGCTGTTTCCAGCATTAA CATCTATTGTAAACAGATTTAAAGCAATTTTATCAAAATTGGGGTGAAAA AATCCCAGTTCACTAATGAAGTTTTTGAAAAGATTATATATTTTTTTTCT ACATAGAGACTTTGTTCGTTTGGAAAAGTTACATATATAAAAACATAAAT AAATAACTATTTTAATTTATAATTAAATCCCTAAACAAAAGATTAGACGT AGTTTTTTGATGAACATCTTTTTCACCTTAGTACATAAACTTCAGCACCA ATACCTTCTGACGTTTCAACAAAGAGCCCAATCCATTTTAGAAAGCTTTT TTTTTCATTGGGGAAAGGAGAGAGTGTGAGTGTGAATGAGACGTAAAAGA ATTGTGTTATAAATATTTAAGAGAAGGATTTACTTCGTAAGCCCTTCAGG CTTTTGAGAGAAACATATTTGAAGACATGAGGGCCCAATGATATAATAAG AGTRAAAAAATATTGGAGATTGAGAGTCATATAAGGTATATTTCAATCTA TCGTCCTACAAAAATGAAATGAAACCATACAATCATTAACCAATTCATTT TCCCCAACTGAACTGCTGGAACTCATCTTCACTTGCTATAAAACAACTAA AAATCAAATTTACTTCTCAATTTCAAATTTTGACAAACATTATTTAATTG ATATATCCTTGTAAATACGGTGGCTTTGTATTCAACAGCACACTTAATGT ATTTTTTGATTGCCCTCTACTGAAAGGTGGTCAAAGATTTATTTAAACTT AATAGTTGTACAGGTTGTGCAAGTTATTGATGCTGCGAAACTGATTTATT TTTCAAATTTAATTTTCTCTCAAAAACCATTTATCAGATTAACAAAATCA AACCAGATTTTTTTTTTCAATTAAATCATCTCCAACCTCAATGACAGTCT CTTTACAATGCTGAAGCGCGAGCAGGCCATTGCCACATGGTCCCCTGGCA TTTCCTGGAATTACTTCTTAATCCAACAGATAAGTTAGTCTTTGGTGTTG AAGGGGGTTTGATTGGTTTGTCGTTCGATCGCGCTCCACACAGAAAATCT ATCAGATTCAGATCTGGCGAGTTGGGATGGAAAAAGTACGCAGAGATAAA GTCGTTAAAATTGTTTCGGAGCTATTTAAGACTTTTGTATTAGGTGCACC AGGAAGTCCAGTCCTGCTGCCTCATGTAAGGCCTTCCACTGGCAACCATA TTGATATTTTTTGCTTCTTGCTCACTCATACCTTGGTCACTATCATGTCC AGGTATACATCAGTGTTTTTTTATATAATATTCGAAATATAAGAGTTAAT AAAATTTTTGTAATAGGGTTAAAAACACGAAAGAGGAAAACAAAGAATAA AAAAATCTTTAACATTCAATATAGTCATCAGTGTTGACCTTGAGGCTTTG GGGGAACACATATGGAGGAATGACGTAACCTTCGGAGCTACCAACCCAAA TATAATTACTTGGGCTAGGCATGTTGTTACTCCCGGTGCTGATTCGATGG AGGGCTTCGAGTCTTTTCTGAATATTGAGGGTGACGAATTCGTCAATTGA TTCCGTCCATTTCTCAATCGGTACAAGTTTCAACAAGCTTTCTAACAACA ACATCAGCTGTATAAATACATGTGTTTGCCCGAGAGAGCGTACCAAAGTA GCAGCATAGATAACATGCGCATCGTGTTAGTCAAAAGAGGTTGGTTCCAA CATAATAAAGGCTAAAATTATATTTGGAGCCAATAAGAGAGGAATGAAAT AATTTTAAACCATAAAGCTGTGGTATTTGCTATAATAAATATAACAGTTA TTGTAGGAAAAAAATTATCATTGAAGGATTCCATACATGTCAAAGGTTTT AGTATGGTTATGAAAAAATGCTACGACTAAATATTCAGCACTAACGATCC AAATTCTGTTGTCATCTGTTTATAATGATCATGTATTACTTGGAAATCGA TTGAATATCTAAAACTGATCAAATCTATTATGAGAATTCGGTTCGAAAAA TCAACGTCTACAAATGAAACAGTCAATTTTCCATACTATAAACTGGCTAC TTTTTTAGAAAATAAATTTGAGTTAATGTATATATTTAAGACACTGTTTT TTAACGTAATTGACTTGCTTGTTTTTGTTTATTTATATGGTCTACGTGCC ATATATTTATATATTTTTCATGTGTTACATTGCCATGTTAGTAATGTATA AATACAATTGATGACTAATAAATCAAGATATTTCGTACATTATTTTTCTA AGCCGACATTACGTTGATGCCCATCACTAGTTTTAAAAATCGGGTGTATT TTTTTAAATTCCCTGTATTTTAAAGTTGGTAACCTGTAAGTGAATCTTCT TTTTTTAAGTTGTTTTCATTATTATTTAACTCCTCAGTAGTGAACTTGTA TTTTAACTGCTTTGAATTATATTTAAAACCTAACTGAATATTATTGCATG TGCCAATAAATGACGGAAACTAAACTTAAGGATTTGTTGTAAAGTTATAT TTGTAAGTCCTTCGTGAATTCAGAGTAGATATGACATATCGACATCGGAG TAATTATGGTCAGGTTCTTGCCTATTTCCTTCTCCCCTTCCCCATTTGTT ACAGCTGTTTTTACCTAATGAAACGTCATGATAGCTAAGCTGGTCTCTTC TTGTACAGTCTTCAAATTGTCAGGGTTAACATGTTTATATTGGATTTCAT TTTTTTAACAGGCCCAAACTGTTCCCCGTTTGCATAACCACCCATAAATA GAGGATGTTTGTAAGAGTGCAAGATGAAGAGGGGAGTGAGATATATTTTA TCACTGAATTAATATAAACAGTCTTTTAAATTAAAGAAGAGAACATTCTA CATTTAAAATATCATTACTGAAGGGAAGATTTTGTAACTATATTTAAATT CAAATATATCTATTTTATTAAGCATTTTTTTTTAAATTAGACCAAATATA GACGATAATGCTTACTTTAGAGGTACAACTGAATACCACAACGACCTATT AAATAATATACAAACACACAACAATTGTTTTTTTCCTTTACTAATTTAAA TAATCCTATATAAAATATTATTTCTTGACTGACAAATTTGTTAGTGTTCA AAAAGTGCCATGAGTATCTGTAAGAAGTCGACTGGAGAGTCTGTAGTCCC TCTAAATCAATGAATTTGTGTCTTTATCCTCCAAAAATTATCCATTAGGC AAAAATTATAAGTTTCAGACCCATGAGGTTAATGAATATWMAARGGAGWA ASGAKTATAGCTCKTTMCYCCTCGAGTGTTTTTCTTTATAAAATTGAAAA TACTGGANGAAGCAAAAATCAGCTCGCAGAATATCAATAGTTTTTGAAAA AAAAAAAYAAAAAAAAGTTCCACAACTACCTAATTTTAGTGTTATTTTTC GCCTTGAAGGCTATCAATTAATGCAAAAAAACATTTAATATATAGATTGT ATTTAAATCTTTCCAAATTCAAAAAATGTTTTCATTATTCCTATATATTT TCCTGAATCGGAGAAAAGGTCTTGTTAGTAACAAAAAAAACCCACAAAAA ATTAATATTATCTTTGAAAGTTTCATAATTATATTTATTTTAGGTCACAA TGTTACAAATCAAAGTTTGTAGAAAATTGAAAAAATACAACTTTTTATTT AAAAAAAGGACTCCTCCATCAATTATTATTTTAAAAAATATTTAATATTT TTTGATTGACAGAATATATATTTTTTTAATCTATGAATTAAGTTATTATT GATAGTATATAAAATCTTACTCTCTTTACTGCACTCTAAAGCAATCAGAA AGACGCAGTTGTTAACAAGTGTAATTACATTTATAAAGGAAATTAATAAT GATGAGGAAACTCAGAAGTTGTGTCTCTAATTGGTATTGATGTCGATGTA CATACTATTTGATGAATCAACATAAAAACAATCTGGAACAAAAATCAACA AAGGAGAAAAACCCAACGTATTTATTTACTTCATTTATTCAATATTTCAT AGACATATTTGAGTAACTTATAAACTTAGTATATTAATTACTTGAATGAG TTATCCTANACCCAAGAATTTAAGCTTTAGTTTAGGTACTTTATTTTATT TAAGAGACTAATATTGGCGTTGATATGGGCCTTTTAATGGACCTTATGTC AAATTGACCAGGGCGTGTCATCCGACCTTCACAGATTCGGATGATTTTTG GCAAACAAGCTCAAATTTATAAGCAAATTAAGTGTGCGAAATTTCAGCAC ATCACTCTGCATGAGATATAGATACTCGTCTCAGTACCTAATTGGACACA AAAAATTTCAATGTGCTTTTAATGTCTTATTAGTCCACGCTACTTATATT TGTATATTTTGTTATATAAAAAAGTGTATCTCTTGAAATTTCATACTTAA CTATTTAGAAGTGTTAGAATTCCAAAAATGAAGTCAAAAATAGAATATTT AAATTTATTATTATCTCAATTTTGATTTTTTTTAAATCGAAAATTCACTA GCAAGTACTTGATYAAGAATAAAATAAATTTTCCCAACTCTTATNNAATA TACAACTAGACCAATATGTTCTACATATGTATGGTTACCACTATGCCCAA AATCCTGTTGGTTTTTCTATCAAAGCTCCCAGAGTGGGATCTCAAAGTTT GGTTACTTTTCCCCGGAACTTTGGTGAGTTTTACGTGAATGTTTATATCT TAAACTTATCTTATGATTTAAATAGACTGACAAAAGAAACTAGTATTTTA AAATATTGATTTGAAGTTGACAAATTTAAAAAAAATATGAGTAATTTATA GTATATCATTTTTCTATAAAGTTGAACATAATTTGAAAATAGTTGTAAGT ACATTAGTTTTTCTGATGGTGGTGTAGGTTAGTATAAGAACTTTAAAGAT TTTTCGAACCTTTGCCATCACTTTGATGACTTTGGTATCAGATGTGTCTA GTCAATCTTTACCAAAAGTCACGGTAAATCACCTTGTGATTGAATTATCA GAACTATGAAAATAGTATTGCCATAAGATAGTCTACAGTGACCACTCAAG TAAAGCTTAGCCCCCCAAAATTTATGAACACAGCAATATGACTACTTTTA TAAATATGTATATTTTTTAAATATATACGAATATATAATTTTTTTAAAGG AAGTGGAGTAGGGGTTTAGAAGTATTTGTCAGGCTTTAAACCCTTAAATT AGGGTCTACCAAATCCATTGTGCAAACAAAAGCAATATCCCAAAGTCCCA AGTCTAAAAAAGAATGAGCAAACTATTTTAAAATTATGTCCAACTTCATG AACAAGTGATAAACTACTATTTTTTTTTTTTAATTTGTCATCTTCTAATC AATATTTTTAATTACTGTAGTTTCTTTTGTCAGTCTATATAAATCATAAA ATAAGATTGATATATAAATACCAAATTTCTGGAAAAAAAGACCATTATGT TATTTTTTTATTGTAGAGTGACGATCAATTATGGATATTTTCAATACAAT TTGCGACACACTCAAAGGACTTATTACAAATACATATTTATTGATAGAAA TTGACAAGAGCTTGTCCAAAAATATATATTTTTGAGAAAAATTGTTCTAC CTTGCTATTGTGATGACAGGCTACATAAAAATGTTAAAAAATTATCAATG TTCTATTGTGACAATCAATTTTTGATCACTTTCAGAGAAATTTACTGCGT TTTCAAAGGGTTAACAATAATAATTTGCGTTAGAAATGGAGGATAATATT TGTTGAAGAATAAAAATTTAATCCACACGCAAATTTAAAAAAAACAAAAA ACATTGTAGTTTGTTTTTGTGTTCATGGGCCCCATATAAATCCAAATGTA TCAGTTAGGCATTTCTACTAGATGGCTGTCCATTTTAAGATTTTTTTTTC TATGTTATAGATCGTTCATATAAATTAATTGCTTTTAAGTTTTAAAAAAA TACTTTTCGATGGATCAATATGTTGTAAATAACAAATTACTCTACATTGT CAGTCATATTCTATAAGTCTCTTACAATTTTCATCGGTAAAATTTGATGT ATAATTATATGTATACCAGACGTTGCTCGTCCCAAAAAAAGGAGTGGGAA ATCACATTGACTCTGTCAAGAAAAGAAATAGTTGACCAAAACTAGAGACG TACGTTACAAACAAAGAGGATACTTCAAATATTAAATATCAAGAAATATC TTAGTAATAATTTATTACCATAATTTTTAATAAGTTATTWTATGAAGTAT ATWAATATTTTTTCCCAATTTTTAAATTAAAATATAATTGTATTTAGCTT TTCAAAATAATAATGATAGATCAGGGCGATTATTATGACTATAACTCAAT TCAAGCATCAATAATTAATTTATAATTATTTTAATTGAATAAGTTTTGTG AGTATGCTCGCAAATTTGATTCAGNGAGATGGATCAAATACATGATCATT TATAGATTGAAAGCCCTAATTATTTTTCTTTAAACTGACATTTTATACAA CGGATATACGATATAAAATTGTTGGAGCTTTTAGCTAGAAAAACAATGTC TTTGATTTTTTTGGTCTTTTTTCTCTCGTCTGCTATGTGACATCAAAGAA TTTCCTTTGTTATTGCTCAGTATCATCACTTTATGTATTCTAACTCTATG GTTTAGACCCTTTGGTGCGGACGAGCATAATAATATCTTGCCTATATAAC AGAATATATATCAATGATTATTAAGTTAAATAAAAAATGAAATTGAATTT TACACTTCAAATAACATAGCAAAATATATGCATGAAAAAATTGTCATGAT GAAAAGTCTATCTTTTATTTTTGTCAAAAAATAGGTAAATCGAAATTTAA AAAAAAACGGTTTAGCACTTATTTTGCAAAATATAAGTAGAAAATAGCTC TTATTGACATTGTAAAGAGGAACACAAAACTTCTATGTTGTTTTTTTTTC GTACTTGCGAAATCAAAAAAGTTGTTGAAAATAATGTCGTTAATAAAATA ATCCTCGATAATTGGTTCATGTTTTAGAAATTGAAAATACTCTATTGTTG TAAAATTAGAGTTTTTGATTTGATGTTCAAAATGCATCGTTTTGTTGGAT TTCTTCTTAAAAATAGAAAATGGACATTTGATGAAAAAAAAAGATATAGC AATTTTTTGTGTTTTGGGTATAGAATAAGAGCCCCTTATATGACCCACCA CCTCCTGAAAATCGGTACCTCCGTTTTAGACTAACCAGATTAAAAAGAAG TGCCTATGCAAAGTTTTAACCTCCTTGGTCTAGCAGTAGTTGACATTATA CTAGCAGTAGCATTGCTTTACTTATAATGATTTATTAGGTGTCGACAAAC AGACAAACTTTACTTTAATCTTATAGAAGATAACTTCCAAACGAATCCTT ATTGTCACTCTCCGTTTTTCATGTGCGTACTCATACGTAGTTACTCTATA CTTAGATGAAGAATGAAYGAATAATGCTTGCAGCTTCAGAAAATGAAACA AAATGCWTTTTTCAGCTTACCGACAACAACAAAAAGCTTTAGGATTTACA GCCATTAATATATTCTATTTTTTATTTTATAAGCATGATGCACTTAGCTT CAGCTCAAAACCCAGTTTGCTATGCCTCTTAAGTCAAATTCATTATATTT AATCTTATATATGTACTATAAATCTATTCAAAAATATACTTTTTTGAATT GTGACATGTGTCCACATTTTCCCCTTGCTATAAGATATGAAAAAGCTCGG AATTCATTTTTTGGGTATCTAAATATTCCCAAAACCATACCTAATTGGTA TTAAAGTTGTTCCCAGTTGCCTCAGGTGATAATTTTGTTCAAAAAGTATG GATAAAACATAGAATTGAATGCTACAAAAGACATTAAACTAAAATATGAT TATTTTTGCATTGTACTTTTTTATCTAAGTATCAAGATTWCTAATACGAT GAAGGTAAAAGAAAACAGGATCGTAATACTAAAAATATATACTCCCATCG ATCAATTATCTTTTATTAGCACTGTTTAACTCAATTTCTTAGTTTTAAAT AATTTTCCTATTACCAATTTGAAAATCTAAATAATATATAATTGATCAAC TATGAAAATCTTCTTGCCCAATATAATTTTCACAATTGCCCCATTTTCTT ACATCACTCGAGCCTCCTAGCTTTCCTGCCCTCTGTCAGAAGGTGGTGTG TGGTCCTTGTGAAAGAAAATAATCCCAAGCGGTGCTTTATTGCCCTCACG ATGGTCTTRGGAGCCACAGAGAAGTTGTTGCCGAGGCGATTGATCGATTT AGTGGGATCCTCCTTTCTATTCTTCTCCAAAGTCAACAAGAACTTCATAM CCCTTTTTAAATTATMCCATCCACNTGATCGATTTAGTGGGATCCTCCTT TCTATTCTTCTRCAAYGRCAACYAGAACTTCATAACCCTTTTTAAATTAT ACCATCCACTTTCTGACCTCCTGGAGAGGTCTTCTCCATTTACTTTATCT TGACCAACATAAAAACTGAGCTCCTAGAACACTTTAAAATGTCCAGAATC TTCATCACATCAACTTCAGCATCTAGTAGATCTGAGATGCTTTGCCTTTT CACTTGTTCCTCGTTCATGATGATGAATTGACTGTATGATTTGTACGGCG GYATCAGAATATCACTAAACAATCACTAAACCTTTTCATAGTAATAAAGA AACTAAACATTAATTAACAGTCCACGTTTTGCTGCCCTACGTTGTATTTC CTATATACTTGTATATATTTTCTTAGACTTCTATTCCTATAAACCTAAAA TTTAGACAAATAATTATAATAGCATTATTATAATTATTAGTTGAAATTTT TTAGAGTACTTTTTGTCTCCTGTGGCTGMAATTGTGTTTTGATATAATAA AAGKTTCATTAGAGAAGMACTTTTWTTATTTATTCAATTTCCGTTTTTCT AATATATGAAGACTTTTACTACTCCTAACCTACTTTTCTTATCATTATTA TTGGGAAGCTTTCGTTTCACTTATGAATATATATTTTTTATCTGTACAAA TAGAGGTTCAGTTTGTTGGTTAAAAATGTATTGTTGTTTACCCTAGGTGT GTGCGACTATAGAAGAGCCTGATTACAGCCTAGGTTTTGAAATTGTTCTT GTGGGGTGTTGTTGTATGAGAAATTGATTATTATGATATCTTTGATTTGT TTTGGTTGACTCAAGACGACATTGTCAACTCGGTTACAGAACTTGTCTGT TTTTTGGGTGTGTCGTTTTTTCTTCTAACAGTGCAGTCACCCATGTTGAG GATCTTTTAATAGCTTTTTTGAGCCTTTTAGGCCTTTCCAGATCATATTG AATTATTTCTTGCTCTTTTGGTTATCCATTGTTTTCATTGACATAATCAA CATCTTCATTGTCAGTATCATCAACATCATTTCAGTCCTTCCTTTATTGT TGTTGAACGCCATTATTATCCTTTGGTTCTTGGTTGGAGTCTTTGTCATC TTCTTCTTCTTGTGTTTCCTATTCTTGGCAGATAATTGGTGCAAACAGAG AGACATGAAAACGTACTTTTCCAATTTCAGATTGTACAGGGAACGGGGAT CAAATTTTTCCCTACTTTAAACCTTGATAACTTGAAGACGACATTATCAA ATAAAAAACCGGTTACCAAAAAGGAAAGCTATTCTTGTCAGCTGATGATA TGTAGTTCAGTTAGCATCATGCCGTCATCATATGAGGAGATAAATAGTTA TAAGTGGAACGAGGAGCTTTCGAGGRCCGCCGTAGTCATGGCATTGGTTA ATAATGGATGTAAAACCTCCAATTCAACGATTGCTTCAACCTTAGGAATG AATTTACGAACTGTTCAGCGTATCCGTAAGAAGCTATAGGACACCTGGGA TGTTGATATCACCATAAAGAGGGCACCCAAGGAGGAGGGCGCCGACAGGA AGGTCAGGGACACCGACTTTGTCGACAAGTTGAAGAAGATGGTTGAGGAT GACCCTACCAGGTCCATGATGGCCATGGCGAGGGATCTGGGCTGGCATGA GAAAACAGTAAGGACTCAGCKCCCTGCCATGCAGTGGTTAACCGAGAACT GTTATGGCGTCGTAACCAAGGATTTGTGGCCTCCTAACTCTCCCGACCTT AATCCTTTGGACTATTTTGTCTGGGCTATGTCGAGAGACATACCAACAGA CATCCCCATAGCACCAATGCCAGCCTGATGGCCTCCATCAAGGTGGTATT CGGCAACATGGACAATGAGATGGTCAGAAGAGCCTGCGGCCGGTTCAGAG GNNCTGATGGCCTCCATCAAGGTGGTATTCGGCAACATGGACAATGAGAT GGTCAGAAGAGCCTGCGGCCGGTTCAGAGGTCGTATTGAGGCCGMTATTG ATGCCAACGGMGATTATATTGAATGAATGGCTAKTCTATAKCRATATGCT CGGCATACTTTTMATTTTCAATAAAAAAGTTAAAAAATGTATATTTGGTG TTGTTTTTTGTAGAAAAATATTTTGGCGACAATTTGATCCCTGCTCCCTG TAGTTCTTCAAAGGATTGTTCATTTGTCCATTTGTGCGGAATTTTTCTAT CAAATAGGCATATTAGGTAAGGAAAAGATCATTTAACTAACCTTGACACA TAATAAATATATGTTTGTCAAATATAAATTGAGAAATTTTCACTAGCTTC CTTTGTCATATTCTTTTTGTTATAGTTATACAGAAAGAGAATAGAAAATT AAGAGGAATTATAGTTATTCCTATCCTTGACACCTTTTGTAACAAAGAAA GCATTAATAACAATATATCTCTTGCCTTTCAAATAAATAAAAAAGGTTTT GCACCTCATTTACTCAAATTTTCTATTAAAAATAATAGATAGGCTGCAAA AAATATTTGTTTATTGAGGTCAAACGTATGACAAGACGCTTTACCCAAAA AGAAATCGATAAAAACCTTGACAATTTGCAGAATATTTTGGAAAAGAGCA GCTTTACAGTTTTAACTTAACATTATATCAGCTGCAAACAGCAATCAAAG GATGGAAATACAAACAAATCCCATCCCGAATCTATCAAGGACAGAGGCAA GAATCGTATGATTCAAATAATATAAAATGCCGCCATGTTAAAAATAAATG TGGTCACCTAGACAATTTGAAGAATGTTTTGAAGGAGAGTAGCTTAACTG TTATCTATGGTGTCGCTGACCCTCTTTTGAAGCACCCGCTCTAAAATTTT TATCATATATTTGGTTGGGGGAAAAGTCATTTCGTATTTCCCGCCCTTTT TTTAAATAAGTATACTATTATGGGTCACACCGGTTCATACGATAAAGTGT TGTACAATTGTGAGTATTTATTAAAACGCTTTTTGGAAAAAATCTTTGGT TGACACATTTATAATATTATCTTAATTTCAATTCATAACATAAGTAATAA ATATATTTTTTAACAAATTTAGATCATATATACATTCTTTCAATATAGAT TTTATTCGTCTAGACTAAGATACCATCTTGTAATAATTGATTGATATTTT TGCTGGTCTGCTAAGTAAATTAATATCTATCGAGTACTTTTAGTATGTTT GAAGAGTTGTTTTGTCCCCCAAGAAAACCGGATTTTTACTCCCGTCATTC AAGAGCACAAACACTCGTGGTTTGACTTAATACTTAGATGTTCTCTCTTC AAGAATCAAAGAACTTTAATAACGGTATTGGAAAATAATTGTTCATATTT CCAAAAACTGTGCGCAAGACTTTTAAAAAATACTTTTTGTAAGCTATTCA TTGTTATTTAACTTCTCCTCAACATACTTGCAGCCTGACAAAGGCACATA TGATCATCAAAGCAAAAAATATATAATTAAATACCTCTTGAGGTTCTTAA TAAAATGTTTTTTCATATATTCTTTGAGGAAAGAGAAAAAAAGGATGGTT TGTTAATATGTTCTAGAGTAGGTTTGCTATGTGTTGCTCGCGACATTTAG AAATTAAAATTACATAAGAATTTTTCTTCTAAATATTAAATTAAAAATAA TCACTGTAAAATTTTAAGAATTTTTTTTTTGCTAAATGTTGATGTTGGTA TTTATCTTTGTCCATTTTTTTATAAGAAGATAGAATAGATTTCCCCGGAG TCAGCCGGGACATTCACAAATGAAAACTGATTCTGAGCTTTTCTATTTTT TGAAAGGAGATTWTAAAGTTTAGAGAAAAAAATATATTCAAGTTGAACTA TCGTTCGCTCATATTTCATATTATTATCAAAAATCCTTTGTCTAATTCTG TCTTTTTTTTTCTTCTTCTTTAAATCTTATAGTCTCCTTTAAAAAATTAT GGAGGGATTCTTACCAACATTCAACAAAGCCTTTATGTATACGGTCTATC TTTGATGTTTTATATACTAAATAGTCGTTTGTAAGTCATAAACTCGTTTT TAAAACTTTGCTATTTTAAAGCCGTTATAGCCAAAAAAAAAAATATATTG CCAGAACCATTTCTTGACACTTGACCAACATACAAAATTTTAGGAAAATA TAGGTATTGGCTTGGCCGTTATTCCAGGACTCAGACACACAGATATTCGC ACTTAATATATACATAGATTACTTTTCCAGGGAAAAAATAATTATCTTAT ACAGTGTGGAAAAATATCATTTGAAAATTTGTTAATTGATTCAACTTATA TTATACAACAAACGATTTTTTAAATTCATTTTCATAATTTGCAATTTTAC AAATTCTTTTAATGCGAATGATTCTATTAATAATAATTTTAGCGAGGTGA AATTAGTGTCATGAGATTTGATAGCATGCAAGATTTTTAAAATGGAACAA TTTGTTTAAATTAAATAACTGAACTGTATTTATTAAGGAAACCCCAAGAG TTGTAAGACGTCTGCAAAATCGCCAATAACTATTATTTAGTCAATAAATC ATCCAAGATCGATTATCTGTTGTTCATAAAATTTTGCATCTTTACATAGG ATATTTATGGTTTTATAATTTCCAAATGAAAAGTTATTTAAAAAAAAAAA AATCACCGTGTATTAAAATACCGAAGTTAAGTTTATTCATTGTATGGATA TTGGGAACATCACCTATCTGTTATGATTTCCAAAATTATGTAAAAACAAA ACTTTAAATCCTTAACACCATTATAATACAAAAATAAAACTTTTTTTTTT TTGGTCAAAACACATTTAACTCCTTCGTTTGATACAATTTTCTAAACTTT AACTACAATTGTGTACCTTCATTATGTAACAAATGTAAAACTTTTCTAAT AGATACAAAACTTTTGGAAAAAGGAAGTTATGAAACTGTTCTATGAAATT GATTGAATGAAAGCAGAGAGTTAGTTTCCAAAATGGGTACCTCATAGGAA GGAAAAAATTGAATATTGATAATATAGATGGGTGATTATTATATATATTT AGAAGCCTTTAAATGGTGACCTAAAATGGAKAGAAGTTACTGAATTTATT CRCCAGCCAATGTCCGGGAATTATTCCCCAGAGTCTGAATTTGAATGGAA AGAGGAGCATATCTTGCTGCTTCCGCAATAACAATTGCTTTCAGCTCCTG AGGATGCAACACATCATTATTTGTTACTCTGTTAGCTATGAAGGCTTTAG AGTTTAGTAATGCAAAATCTAAAGACTTGGTTTCAGATGACATTCCTCAG TTCCTTTTCGAAATCCCAAATGAAACCATACCTTTGGTAACGTTAGTAAC CAAACGGTTTGGTAACCTTTTATATTTAACTTTACCAGGGATTTCAAATN CCCACAGCGGAACAATCCACGAAAGCATGTGGAGTATCCTTAAAAATGTT ACCACAATCCTTGCATACCATAAAAAACTTAATTATTCCAGCAGAGATTT AGAATTGAGCAGTAAACTTTACGCCATCTTTTATTCCTCTCAAAGAATTT AATATCCTCTTTCTCCAATTTCCCGGGGGCCCTAACTGCTTTATATGATC ATCGGAATTTTTTTCCCCTACATCTAATGAATTAGGAATTTTCATTTTAA GATGCAAAGGGGAAGGTAAATCCTTTCCTTAGGGGAACTTGAATCTTCCG TCCCAAAATGGTACAAAATTATCAATATCATAAACAGTAAGAATTCCATT ATTGATTGCATACTCCTTGATACATATATGCAATATATTGATGCAGGATC TTTGAGGTTATTGAAAAAAAACTTTTCTCTAAATTTTGCCAGATTATATC TATAAATGAATCTTCCTGATATACAGACTTGTATTTCCAGATGATTATTT GTGTATTTTCATTGTTTTGGATCATATCGAACGAGGTTTTGTAAGAAAAA ACGAATTTAGAAGATGAAACTTTTTTTTAAAGAGGAAAGTATAGTATTAT ACAGTACCACCGTGTTTTTTTTTCTTTTCTACCAATGAATGTTCTTGGGA ACATTTATTTGTAGAATCAAAATTTATCCATGCTTAAGCTGCGAATAATT ACCAACCATTTCGGGATAATAAGTCTATAATTCGTAAGAATTGAATAGCT ACCAACTGATTTTGAGCCTTTTTTCTATTTCTTACCTTAAAAAAGATTGT GTAACATAATAAAGGACAGGACATGGATAATATATAAGTATAAAGTGCAA TCAGGAGTTTTTGTGTGAATAGTTTTAAGTATAAGTCCTTCTCTTAAGGA GAGACAAAAAAAAATTAAAATACAGGGTATTTTTGGTTGTTATATGTCGA TGTTTCCGCTTTTTCTTCTACTAATCAGTCTTCTGATAGTTGATTGGTTG AATGAGAATGAGCTTTTTTAAGCTGTGAACACTTTCCAACAATTTATAAA TAATAATTTCATAGTTTGAAATTATTGGGTAAAAACCAAATGATTTTGGG GTTTTTTTCTGTTTCTTTTGGGAGGAAGGCTATGTGATACAATATGTGTA TGTGTAAGTGCAAAGGCGGATTATTGCACGTGAACACGTCTAATTGTGTG TATATATAATGATGAAAATCCGGTGTATTTATAAGCTGACCCGGGTTTTT TTTAATTGGTAGTTTGATAAGGGATTTTCTTTTCCGTATCAGTTGCCATT GTTATTTAATTTCTGAAGTAGTGAACATCCTTTCCTAAATAGATTCAATT TTGTTCAAAACCTGATTGAACATTCGTTTATACCCCTATAAGCCAGAGTG TAACCCTGCTGATTTTTCGCAAAGCTATAATTTCTAAGTCCGTGTTGGAC TCAGAGTAGAATTGGGGATCGACATCGGAGTAATTTTAGCGAATGTCATT GTTTATATAATTTTTCTCCTACTTCCCTTGTTAAAACTGATCCAATGAAA CGTTATGAGCATTATCCTTTCTCTCGTCCAAAACATTCCTCAAATTGTCA GGGTTAATATGTTGATTTTCGGTTTGTTTGTTTTTTAACATACTAATTCT AGTCTCGATTTTCATCAATATATATATATACCTTGAAAATTAAATATGAA TATATAAATGATATCGGAAGAAGAGTTAATCCCACAAAAAACCTCCTTAA TAATATATTTATAAATATACTTAGACGTGTACACGCACAATAAATGTGGT AACCTTCTTTACGTCCTTGTCTTGAAGAGAATTTAACTTCTTACCTCGCT AAAACAACATTATATAGTTTATTTTAATATCAGCTGTCGATATTTCCCCT TCGTTTCTCCTCATGTGTGTTCTGAAATTTGATAAGTTGAATTAGATTTA GATAATTTGAAGGTGTGAACCATTCACAACAACAATAGTTGTTATTAATA ATAAGCTTGTTGATAAGATAGTTGTTATACCATCTTATTTTGGGCTTTGT TTTCTAGTGAGAGGGAGGGGGCTGTGTTTGCATTATACAATAATTATTAT TATTCAAAGATAATTAAAAGACATGACATTATTCATGAGTGAATCAATAT ATTTTTTTCCTTCATAAAAATATAAGTTACATAAAGGCTGTAGCTTGAGT AATATATATTCATTTAATCAACAATACACAAGATTAAAACTAAATTAAAG GTTATTACAATTTAATACTCACATTTGCTCAATATTTTATTTTTACTGAA TAATATAAATCTATATAAAGTCAGAAAAACACTGAAATTCTTATCATTAC ACATTTTTCCATAGTTTTTTTTTTTTTTCAATGATCGTAATATGATGTTT TTTAGCATTAAATTGTAGAAAACCCCCTGAGCCAGTATTTACACTAGGAT TTGATGGGAAAGTAATGGAGGACTATGGATAGAGTTGTAAAAAATATGAC CTGTAGTTACATTACACAAAAACTCGAAAATTAATATGACCACTTCGAAC ATTTTACAATTAAAAAAAAGAGCAAAGTACATGTCATGTCGTTTCACTAT WTTAGCCATAATCAGCCGTTAGAGAAATGGGATAAAAACAAATCCCAGTC CTGATTTAGCCAAGATATAGGCAGGYATTACTCCAATGTCGATCCTTAAT TTCTGAGTCAAACAAGGAATTGATTGGACACTTATTAAGTGTAAGCACTT AATAAGTAGTATATTTAAATACCAACATTTTTGCAGAAAAAAAACCTATA ACCAAGTAGAAAAGAGGATAAATACTATAACCAATTAAAGCTATTATTTT CATCTATGATTAAAGTAAAGGTCAGAGAAGAATTCAGGATTGGAAATGAG TTTTTGGCCAATATCCTTGCATAATACAGAGTCCGTTGTGTGTTTATTTC CTTCATCTCACAGCTGCTTGCAGCTAATTTAATGAAACGTCATGAAAACT AAGCTGTTCTTCCTTTATACATTCTTCAAATAGTCAGGATTATCATGTTA ATTTGTGGGGTTTTTTTTTATATTTTATATCCCAAAAAAACCATTCCTAG TTCAGATAGAATAATTGTTCTAAGAATAATGTTTAACTATACTTGATTGG CGCAACTCAATTAAAAGAAAATATAAAAACGAAGAAAAGGAGGCTCAATT GAAATATTATATACATTTAATCGACCATTTTTTCATTAACGACGCATTTA TTTATCGCTAATGCAATATGCATTTGTATATCGTGTGCATTATGTATATA TTAGAGTATCACGTTTTAGAGTTCATTATTTAACACTACACCACGCTTCT AACCAAATGAAAATATATTTAAATCAAATTTTGAAAGCATCAAATCCCAA TAACAATTTTTGTGTTTCATTGAGCATTTTTAAACAKCTTCCACATCCAA AAAAATAAAAGCCATGGATCAAATGTAGTACTTTTGTATTTTCTATAACT CATATTGTAGACAGAAAAGTATGGTACACACTTACGGAATTAAAAATTTT AAGTACATTTTATTGAGTGGAATAAGGACTGAAATTTGATATTCAATGTC CTTTGTAGTAACATACACTTTGATTGCATTTTGAGTATTTGATTTGAAAA GAAAATGTACATCATACATTTTTTTTTTTTTTTGCAAACTAGGCTTTCAG CTTTCCTTTGTGAACCGGCATTTTGTGAACTTCAAATTTTATTAAATTGT TTCAAATCTATTCAAAATAGGTTTAATAGCTGGAATTTTTTATTGGGCTC CTGAAACACGTTTCTCAATATATATGCAATTCTTTTTGGTTGCAAAAAGA TATTTTCAAGAAGAATAACTTGTAAATTGTTTAATTTTTAATTTAGTTTA GGTGATCTTCCTTATTCCTTTAAATTGTTTCAATTTAAATTATACGTGTT TGCTACTTACGTAATATCAGCTGTTATTCTACATATCACATCAAGTTCAT CAAAATAAATGAATACATTTTCAGTTTCTAAAATTCGTTAAAACTCATCA ACATTTTATAGAAATAATTATCAAAATTAATTAGTATATTTTAATTAAAT AATCACAAATGTCATCTTCTTATTGAGATTAATTTATGAAAATTATACTT TTTAAGTATTTTTATTGATATTTACAATAGCAAAATAGTTAGAGAAATAT TACAACTTTAAATAGCGTAATTTTGAGTCTATGTCGACTTTGTCTCATAT ATTTGACATAACTTTTCGCCCAGTTGACTAAGTACGTTCAAAATTTACTA TCGAAGGGTTAAAGATCATAAGAACTATAAAAATTAGTTGATTTCTTTGA AATAAGGTAAGATATTTTGGGTGCGTGGAGATTACGTCGAAACACAGAAA GAACAAGAAATGTCAAACGCACCAAACGTCGAATAGACAAAATATCGAAC GTACCAAATAGTTGTTCAAAATTAAACTAATAAAAGGCAAGTGTGAAAAA GTCTTGTTCATGCGAGTATTGGGGGGGGGGGAATCTTATTGACTCGGATA AAAAGTTCCGGTCAAATTTGGAGAGTGGGGMCTTGCATTATCCATATGCA AGACCCACTTTTACTTCCTTTGAGGAGCTTCAACAGTTGTATAATTGCGT ACATCGTATAAGTTAATCAGAGCCTTAAACTTAAGAAGGGGAACAACGGT AATGCTATCGTAAGCCCATTTATTTTATAGTTGGCAACCTGAAGCGTGTT TTTTATTCTTTAGCTATTTTCATATTTATTTAATTTCCTGAGGACTGAAC TTCTGAAAAATGGAATCTTCAATATATATCAATGCTTTTTCTCACATTTT GCAAACTTAATATTATTAAATCGAAAATATTTTATTAGATAATATAGACT ATATCTTTAAGAACCGGTTAAGGGTTTTTTTAAAATAAAATTTATATTAT TTGGTAGTAATTTTATCAAGTCCTTTAACCTTTTTGTTTTTGCTCTTTTT TTTATAAATTTATTTTCTTTCAAAACACCTTTTTAAAAATTACCATTCGA CATTTTGCGTTTCAACGTTTTTATCCTAGTTACCATATTTTGCATTTATG ATTTTCACCATTGTAGGTAACGGAAAACTATCGAAATAAATTAAAAAGTC AACTGAATTAGCAATGAACGTAAACTTTTAAATAAAAAACCCAAATATTT ATCTTTTTTTGAAAAGTGGCACGGAAAGTTTTCAGTATAAATAGTGACAT TAAATTAAAAATTCTTTATTATAACGAATGAATGTTCAACATTTTTTTAA GCTAAATGATCAGAAAATTTTTATAAACTATCTTTATCAAAAAAAAAAGT CAAATATCCATAAAAATTATTTAAAATTTATTACAAACTCAAAATTATGA ATAATTCTGTATTAAAATAATGAAACAAATTTTCAAAAGTGTCTTTATTT GAAAAAAAAAACTAACAAGTAAAAAATTATTTATTCAAAACAACAAAAAA ACYAATTAAATATTAATAKCAGCCATTAAGTTTACTTATTCAAAAGAATA ATAAAAAATTATGAATAATTTTTTATTTAAAAAGTCAAACAATTTTCTAA AATTAATCCTTATAAAAAATTAAAAACAAAAGGGAGTTTGCAACTCGAAA AGCATTGCACTAACCATGTAACATCAGAGTAAAATGATGCTTAGAGATAT TTGATATCTTTATTGCTTTATTTTTTTTAACGAAATTAGTTGTTATACTC AAATTTAACATATTTGGCCTGTCAACATAAAATATGCAAGAAGGGTTTAT TTTTTTAAATTGACTGTCGATTTCATTTATATTCTTCGAGGAATTACCGT TCATTTCTATGTGCAAACTATTCTTATTAACTCCTGGATGTGTCACAAAT TGCACTGATTTAGTCAAAATTTATCGTCACAATAAAATTATGAGAAATTG ATTGATTTTATTGGTGAAAGGAGAGCCATATCGGTATCCATATAAGTATC AACCGGCAGAATGATCGAGTATTTACATTTGAGGACATAGCAGAGGAGCA CCAATAAGTTTCCACCAAAAAACACGCTGTGTCAGTGATGATGTTAGGCC TGGTTACATCCAACAGGAAGGCCATGAGTCCCTCTTTAGGAAACAGGTTA AAGGGTGATGAGTACGTCAAAATGCTGGACACCAAAGTTCTTCTATGGAT CAAATCCATAATTGAAAATTCTCTCTGGGTGTTCCAACAAGATGGAGCAC CTGTCCAAACCGCAAAGAAAGCCCAGGAGNGGCTCCAAACCAATTGTGGG MGAAGGAAGMRTGGCCGTTACAGAGCCCTGACATGACTATTCCATCTAGG AGCATCCAAGTCCTGCAGGAGACGCCCCAACAATACCTACTCCCTGAAGA TCTCTGTCAAAAAGGCCTGGGCCTCCATGGACGCCGAGTATATCCAGAGT GTCTACAGTAGCTTCTGCCACACCCTGGAACCTACCATCTGAGTTTATTA GCTTGCTTCCTCATTCACACAGGGCCATGGACTTAAATACTTTGTATGTT AAAAGGAGTGCATAAATGGTCCCCATGCTAATAATCACGTAGAAAAGTCG AAAGATATATATATACAGATATATATTTAATATCAACAGATAGTCTTAGG CTTTGTGAGGTTAAAACATTCTGTTACATATTCAATAAGTAGTTGGTATG GCCTTGTAGAAACTGAGATAGTGAGTAATGAATAGTTTTTGTTTACATAT ATATGTGTTCTAATGACTCTTTTTCATTGTGAGTCGTTGCTAATGGGATG GTTTATTATTACTATTTGTTCATCTTGGTTAATCAAAATGTTAATATGTG TTGTCATTTGTCTATATATATATTTACTAATGTGTCTGTACAATACTAGT GTTGGGTTTCGGTTTGAAAATCCTAGACCGGCACATCGTTACATTTTTTG TACTACATAACTTTTTCTCCGTGATCAAACCGAAAAGAAAGCCAAAAAAT CAGTTCGTAGTTTGACAATTCTGCATAATATTATTCAATAATTGTTGGAA ATTGATCTCAGCTTAAAATAAATTATTTCTAATTCAACCAATCAACGTTC AAAACACTATTTAGGAGAGACTTTGACTTATGTTTTGATAAGTAAAGAAT GAAAGTGAAGTTAGAAGTTGTTTTTATACTTGAAAAGTGAATATTTTGAT GACTTAAGTTATAACAGTTTCAAATAGTGCTGACAAGTAGCTTTTATGAG AAGCTTTTTAAACCAGATTTTTTTTTCCTCTCATAGGATTTCTACTTTCA GTCATCCTTTTCACTTGTTATCTAGAAAAGATCTTCACCATCTTTTTATG CAACTGGCTACAGAAACAACAAAAGCTTATAAAAAGATAGATGGTGGATT TTTTAACGTCTCTCTTGAATACAAGGACTTACACTTTTAAACTATTTTAC GTTACACTCTGTCTTCATTCAAAAACGAGGCACAAAATCAGTTGGTTGGT ATCCAATTCTTTCCAACTTTCGAATGATTAGTTATCATTCTTGGGAATTG TTTACAGCATAAACAGAACCCATTCAAATTCAACAATTCAACGTTGTTTA TAACATTGATTAGGAGAAAAGAGACAGAAACATCGACAGCTGACAACAAA ATTACATGTGTTGTTCTGGAGATAACGCAGTGTTCAAAGGACAAGCTCGT TTTTGAATCTGTCTTAAAAAAATATTTGTCTGAATTTGTCTCACTTATAA TTATTTTTATATGTTGATAGAGTTTTGATGTGGCCAGTTGTGTGTCAATA TTGTGAATAKTGTCACAGTTACGTCATGTGAGGTTAAAAGGGGGGTTTAA ATCATAATGYCACAATTCATAAATTAGGATTGTGGAGATAGTCAGTCCAT CGATTGAGAACGAATAAAATGATCCATCATTTAAATACAATTTAATATCG GTCTGAGATTGGTCTTGTCATGGACCGAGTCTCACCCCTAGTACATACAT TTCATATATTATGCTATTACTTATAAACAAACATAATTATTCCTTGCTAT AGTCTATACATACTAAATAATTATATGTAAAGAAATGTTTAGTAATAGTT GTTTCAATACATCTTAGAAAGCTGCTTATTTGGAAATAGGGAGAAGTAAT GACCAACTATGGCCCATAATTACACAATTATTCTAATTCCATCCCTTGTT TCATTTCAAAAATATTCTCACTGAAAAGAAATTTCATTTTGACCAACTAA TGGTAAAAAAGAGAAACAAAGATTGGATGCTCTAAATACTGAGCATTCCT TTACACCAATTGTCGAGATATTTATATTTATAGTTGTAAAAATATAAACA TAGATGAACCTTTTGTAGTTGAAAGATGACCAATGTTTTGTTTTTTTAAT TTTCCTTCGATGTTGTCATTATTCTTTAATTCTTGAAGAGTGTACATCTA AAGTATGTGAGATAATGGATAATGAAGAGTATTCTATGGGTTGGTTGGGA GTAAATGTAGGTCCTTGTTGGATTCAAGTTAAAATTTATGATCAACATCA AGGTATTGTAACTGTCCTAGGTCGAAACAGAAATAAAGTGGTATTTATCT ACAAATGGTAAACCATTGGATCAAAAGTCCAGGACTTATCAAAAAACACG TTTGTTTTTGTTTTGTTCAAAATTGGTTCTTTTATGATCAATTATTAATA AAGAATGTTTGCCCTGCGTTGTCCGGATATTAAGAAATTAAACATTGATT CTAAGGTTGTCTGGTTCATATAATAGAAAAAATTAAGAATTATTCTCGGA GCATGTTGTTATGTATCTTTGCACACCCTTTTTCAAAGAAATTATAAGGT TTAGAAAGGACAAAATATTCAAGTTGCACTTTTGTTCGCTCCTCTTTCAT ATTATCGTCAAAAATCCTATGTCTTATTCTTTCTTATTTTTTTTCTTCTC TAAACCTTATCTCCTTTTTAAAAAAAACTGTGTACAAAGATAAATATCAA CATGGAACGAGAATAATTCTTAAAATTTAACGGTCTTCATTTTTTGTTTT ATATAAAATAGTCGTTTGCTAATAAAAAATGATATTTAAGGCTAAAAAAA ATGTTCCGACAACCATCTTTTGATCCTTAAGAAACTGCATAAAAAATTAC AACAAAACCTATTCATTGGTTTTGCTGTGATTCCGGACACACACACAGAA ATTTGCATTTAATATTTCAATTTTTTTAGTCACTTTATAGACCTGTGCCC CATAACACATTTCAATTTTTTTATTTTTTTTGAAAAGTTCTAAAGCAGGG GTAAAAACTCGTTTTGATTTAAAGCCAAATGCAGCTTAATCTGATCTCAA GCTAGCCGGTCAATAAAATCATTGCAAAATAGCATAACAACTAACAATAA GTCTACTTTTCTTTCTTTCTATTAGTCACTATGTCACAGGACACAAAATT TTAGCAGCAGTCAACATGCAGTTTTTAACGAATTTTCCAGAACTATAAGG CTATGATCCGAAAGCTATTTGAGTTATAATTAGATTACTAGCTTTTACCG TCACCAGATGAAAACTGATGGCTGTTTTTTCAGAACCATGATCATTTTAT TATTCAGTTGTTTTATCAGGTCTCCCTGCAAGCTGATATACTTTTCTTAT ACTGATTTTTATAAAAATGCCAAATATTGTATTCTTTAAAGACCTAAACT TACTTTCCATTCACTTCTTTGAAAATATAAGAAAATTTCTCTGTGTCAAG TTACTCTTTTTTCACAATGACATTACACTGATGCAGATGCAAGGCTAAAG GAAAATATCTACTACAATTGATTCAATAGATCCTAAACATCATTAAATAC TACCCCCTACTGGTGTTAGTTTCCCCACAATATAGCTTTTATGCTCTCTA CTAGTATTACAATACTGCGTCCCTAACGAACAAGAAAAGAATAAGTGATT TTTTTTTAAAACCATATATTTTAATCACGCAGATTTATGTACAAGCGAGC TGGATCCGGCCGTCGGGATGTATTTTTTACACCACTGGTTTAATGGTACA TACATACTTCTCAAATAACTAATCTTCAATATTTTGCATGTATGAATGTT AATTTAGTTGTAAAACGATGTATAATATTTCCATAAGTATCCAATCCTTT TCTTGATTAATGATCCCTCTTTCTTGTCTACTCCTACTTATTAGGATATT TGTCTTGTATGTAGATAAAAAATAATATACCGGTTTAGAAAATCTCATTT TGCGTGTGATCTATTTCAAGCTGTTATGAACTTAATGGATCCTATTTTCT TTAAATAATGAGCAAAATAATTATGGGAAGGGATCCTCATTATAATCATA TATCCGTAATGATTTTATTTAGAAATACTGTAGAAAATACAATTGTGCCC CGTCGCCACAAAAGGAAGCTTTGATTTTTTTTTCAACATTGAGTGTGGAT TAAATATATATTCTTCAAGAAATTATTCGTTTTACCCCTCTGTGTGTGTT GCAAATTGCAATTAAAGCGACAAAATCGACAGTCAGAATGAGAAAATGAS AGATTTGATGGTTGAAAGGGATCATATCCGGGCCAATATAAATCTTTTAA TTGAATTAGAGGTTCTTAACTATGTATAACTAAAATAATTGACCATCTYA ACTKAAGCCACAATTATAAAACCATAGTCTTTAATTAACTCAAATATGTG TATCAAGTATAGTATATATATATAGTTCAAAAAATATATGGTAAATTTTT TCCTTCTTTTGATTTTTGTTCAGAATTGTTTCTATGTTAACGTATCACAT ATATAAATCGGAACCTATAAAATATGATGTATACATTCGACTTTAATAAA TTGAATGGGCCCAACTTTTTACACTGCAAGTCAAAAGTATGTGTAGAAGT TTATTTTATCGTATAACATACAAATATAAAATAATAATTTAAAGAATATT GATATATACAATTTGGGAAGTGTTGGGTGCGAGGGATCTAACATTACAGG TCTTTGTTCTGTTTGCTAGAAAACTTTGATAGTTTCAACTAAATAGGCTT CCTAGTATGCGTTATTTATTCTTTGTGGTTGTTGGACCCCACCACATTAT TGGAAATGAAATTGAGTCATAGATGAATGATTCATCACTTAGTGACAGGG TGTATACATTATACATACATTTATTGGCTATTCAAACAAAGAATTCTAAT TGGTTGTAAGCATAGAATACATAATTCAAATTGTTTGTCTTCCAATTTTT GTTTTACTTATTCTTTAAATGGTATTTCCAGAAGTTGCATCCACGTTAAA CTGGAAACATAATATTAATACACGTAATGAGCAAATTTTCCCTATAAGTG TATGAATTTACCTCACAATTCTCTGGTTTGCTTTCTTCTAAGTAGGATAT ATATAAATTAGTCTGTTATTAATTTTTTTGTTTTTTCGAAAGACCTGACG GGGATAGACCAAAAATATTTTTTGATGAAAAAACAAGAGAAATAAAGTTT GACCAATATTAATAAAATGTGTACAAGTTTTGTAGAGCCTTTGGTTTTAT ACATTTCAAAATTTTATGCGAAAAAATAGAACTCCTATTAAAAAAATAGT GTATATAAATCTAAATAGAGCGTTTTGCAGAAAATAACTATTTTAGATGA ATTAACCTTATTTCAATTTTCTTTTTTATAGTTTTACATAAAATTCCTAC TTATTATACAGCAATGACTTAAGAAGTATTAATGTACCTTGTATAGTGCG TACATTTTTTTCCCCATTACATACACAGATTTGTTATGGATTTTCTCCTA GTNNNNNNNNNNNNNNNNNNAAAATGAAAGCTGAATAAAAAAATATTATT TTTCAATAATATCAATCACCTTTGGTATCTATAATAGTCTCGAACCTACC TTGATTTTGTGCTAGAGAAGGATATGTTGATGTGTCTCTCAACTTCACCC AACACAATGACGTAAGGTTGAGGTCTAGTGAGTTTGGTGGCCAAACACTG AGTCCGACAATGTCAAAAAAAAACCAAAAAAACGTAATCACCCCACGTTT TCTTTGCAGTGGGGTATAGAGCAGAGTCCAGGCTCATCCAGTTCCTTCCT GACTCTCCAGATAAAGGACTAGTGATTTGTATAAGAGGTTAGCAAACTAA AAAGATGAATTACCTTTTAACTGACGCCAAACACTTTGGCTATCTTCTAA AATAATGGAAACCGTCTTGCCTGATCATGCACAGATAACACAATCGCTCA AAATTTGTTGATAAACAACGATTGTATGCTGTAGAATCCAAATCTTTTTT CTAAATCAAATGGCATTCAAGAAAGTACAACAGTGCAAATTTCAGGTCAA TTGATCAAACTCTTTTGGTTCTGCAATATAATTTAATGTTTGGAAGTGCT ATTTCGTTGAATTTATTTTAGAAATATTTGTTCAACAAATATATTTACAC CTATGGCTAATTATTTTATATGATGTTTGTATGGGCTTACATTTATATTT ATACTTCTTTTCAGTGCCTTTATAATTGTAACATATATTGGCAATAAAAT GAATTATAATCTAACACAATACTATCTTTTAAAATATGCTAAACGCTGTA TTTACTATAATTTAAATTTACAAAAGTAATTGACCCTTATTTACTATTAG CTTGTTTTATAAATTTATTGTAGGTGTTAAAGTCGTACGCTTAAAAGGTT TTATATAATAAGGGAAACTTAGACATATTTTTGAATATTATGTAGTTTGC TTGAAAAAATGATTTCGGGATCCGCTCAAAATATTCCTGTACTTGATATT TTAAGCTTCTATGATGTAACCCGTTTAAGCGTGCATGGACAGTTTGTCCA AACCCATTTTTGCCGAACGGACACTTTCCTTAAAAGAATGATAAACATAT TTGACAATGATTCATTCTGGAATACTTTATAATTATGTTACATGTAATAA ATAATAATTGATTCCAAATTGACTTCGAAAGCTGAATAGAACAGACAACT TGATCGAAAAAGTGGGATGAAGATCAGTCATGAAAAATTCATTCACAGAT TCAAGAGAGAGATGGCTACGAAATCATCTCACTACATCAACTGTCTTCAC CAACAAGTAGATCAAAATAAAACAGAGGGGTTCTGCTCTTTCTGCAAGGA ACACACAGAGTCCTCCGTGTATCTCTTTTATGAATGTGATAGATTTATAC TTGTAAGAGAAATCGTCGAACGGAAAAATTAGGGATGCACTAGAAATAGA GCTCAAAAAAGAAGACTGGTTTGTGGCTATGCCATCGAAGACTTGGGCTC ACTTATTCACGCATTCATCACTAACGTTATGTGTATATTATACTCGGGTC GGACTATGGTCTCAATAATTAAGACGAAGAATTCGAGGATTTCGTTGAGG GTTCCTCTACCGTTTTAAAATATAGTGTTTAGCAGGGACCATGCCGGCTT TCATAGTTTGGAGAGCTTAATTCCAAAAATGATCAACACCACAATGTAAT TGTTTAAACAAATTGGTTTTATATTAGGGGTGTTCCGATCGATATCAGAA TTTAGACTGATTCTGATACCATCTTTATGGACGATTCAGATACGGATTCT TTATTATGTATAAAGAAATTATTTCAACAAATAACAACATGATTAACTGT TTTAAATGTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTATGGTAATATTT ATGTCTGTATAGTTCTTTCACGAAGGAGTATGGCTCTTAATCAAACATGA CTTTTTTTAAAGACTTTAAAGGCCAAATCTGAATCTTTTGAAGGGTTTAA AGATCATTTTTGTACTGTGCGAGTTGTAATAACAATAATAAACGTCGTTT TAGACTAAAAACATGTCATGGCCTGAATTTTGTAATGTAGGTCTAGTAGT ATTACCATTGTTATATGTTCAAATATAAATTGAAGAAAAAATAGTTTAAT CTGGACCCCTACACGTAGGAACCCCTATAATTCAATATGAATTATTCCAT TCTATGATCTTCGCCTCCTTTTGTTGTTTGACCATTAGAAATAATATATT TTTAAAATTAAAAAACTTTTTTTTTCTTATGACTGTAAATATCTCCTAAA TTAGGATGTAAAAGTATCCGTGGAATCGACAGTATCAATCGATTCCTATA CTTCAATAAAAAAGCCTAATTCTGGCCGAATCCGCTGCATCGGTACATGG TATCGGTATTATATGTTGTAATAACCTTTGAATTAATAAAAATGTAGTGT ATTTAATTTATTATAAGGATGCTTCAACATTTGGCTCGAACAACTGTAGC AAAAGTAATTACAATCGTCCCATCAAAAAATAAGTTATTAAGATAAAAAA ATGTTTACAGGGGAGAGGAAGTCTACAAGTAAATAATTATGAAGTCATAA ATACTTAATAATTGCAAATCCTATTAAATAATTTAATGACTTTATCTTTT CAAATTGAATTGAATTAAACATTTTATCTTTTAAAATAAGATTAACATGA ATCGGACTCATAAATACATAGTATTGGAGCAAGAATCATTATCAAATATA TGAACTATTTGTTGGCCAAAAATATCATAGAACCCCAGTTAATGGCCTTA AAACTATTTAATGTGAATTAACATAAAATTGACATCCCAAGGCTATTCTT GTTAATACTTAATTTGAAATGCTCTTCAAATAAAGAGAAAAATCTCTAGA GTATATAATGAAATTATGAAATTTTTAAGCAACAACTATTAACTAATGGC TATTCGTTTTTATCTTTTAGGCACAAACAGGAAGAAGTAATGAAATTGGA AGCTCAAATACATCACAAAGCAGAAATGCAACGAAAAGCAGGGGCTGAAT TAGATTGCACATGCCAAATATGTCTCAAAACAAAATTTGCGGACGGAATC GGTCATATTTGCCACTATTGCTCCTTACGATGTTGTGCAAGATGTGGCGG MAAGGTCACACTTCGGTCAAATAAAGTAAGATTAAAAAACAGGGCCGTCG CATTGGGAGGGGTGTTATTTTTTATACTTTTTTTTTTACAAATTTATCGA CTGACTTATTTTTAAGAAAATATAA
back to top
Add to Basket