EMLSAG00000000022, EMLSAG00000000022-682788 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000022
Unique NameEMLSAG00000000022-682788
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:Rims2 "regulating synaptic membrane exocytosis 2" species:10090 "Mus musculus" [GO:0005515 "protein binding" evidence=IPI] [GO:0005622 "intracellular" evidence=IDA] [GO:0005623 "cell" evidence=IGI] [GO:0006810 "transport" evidence=IEA] [GO:0006836 "neurotransmitter transport" evidence=IEA] [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0006887 "exocytosis" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0017156 "calcium ion-dependent exocytosis" evidence=IDA] [GO:0017157 "regulation of exocytosis" evidence=IMP] [GO:0019904 "protein domain specific binding" evidence=ISO] [GO:0019933 "cAMP-mediated signaling" evidence=IDA] [GO:0030054 "cell junction" evidence=IEA] [GO:0030073 "insulin secretion" evidence=IMP;IDA] [GO:0042391 "regulation of membrane potential" evidence=IDA] [GO:0043005 "neuron projection" evidence=IEA] [GO:0043234 "protein complex" evidence=ISO] [GO:0044325 "ion channel binding" evidence=IDA] [GO:0045202 "synapse" evidence=ISO] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0046982 "protein heterodimerization activity" evidence=ISO] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IGI] [GO:2000300 "regulation of synaptic vesicle exocytosis" evidence=ISO] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 MGI:MGI:2152972 GO:GO:0006886 GO:GO:0046872 GO:GO:0019933 GO:GO:0030054 GO:GO:0043005 GO:GO:0045202 GO:GO:0042391 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 GO:GO:0017156 SUPFAM:SSF50156 GO:GO:0006836 GO:GO:0044325 GO:GO:0030073 GO:GO:0048791 GO:GO:0017157 eggNOG:NOG286957 HOGENOM:HOG000082403 HOVERGEN:HBG058147 OrthoDB:EOG7BGHJV CTD:9699 KO:K15297 EMBL:AB021131 EMBL:AK032619 EMBL:AK083172 RefSeq:NP_001243313.1 RefSeq:NP_444501.1 UniGene:Mm.309296 ProteinModelPortal:Q9EQZ7 SMR:Q9EQZ7 BioGrid:228026 PhosphoSite:Q9EQZ7 PaxDb:Q9EQZ7 PRIDE:Q9EQZ7 Ensembl:ENSMUST00000082054 GeneID:116838 KEGG:mmu:116838 UCSC:uc007vod.2 UCSC:uc007voh.2 GeneTree:ENSGT00550000074588 NextBio:369190 PRO:PR:Q9EQZ7 ArrayExpress:Q9EQZ7 Bgee:Q9EQZ7 CleanEx:MM_RIMS2 Genevestigator:Q9EQZ7 Uniprot:Q9EQZ7)

HSP 1 Score: 68.5514 bits (166), Expect = 5.425e-12
Identity = 46/74 (62.16%), Postives = 52/74 (70.27%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK-DSQN 199
            RNDSLSSDQSE VRPPPP+PHK K        +   + LSSSEEEL STP+  TSC+  E ESES+SEK DSQ 
Sbjct:  519 RNDSLSSDQSESVRPPPPRPHKSKK-----GGKMRQVSLSSSEEELASTPEY-TSCDDVELESESVSEKGDSQK 586          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:Rims2 "Regulating synaptic membrane exocytosis protein 2" species:10116 "Rattus norvegicus" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 GeneTree:ENSGT00550000074588 EMBL:AABR06050516 EMBL:AABR06050517 EMBL:AABR06050518 EMBL:AABR06050519 EMBL:AABR06050520 EMBL:AABR06050521 EMBL:AABR06050522 EMBL:AABR06050523 EMBL:AABR06050524 EMBL:AABR06050525 Ensembl:ENSRNOT00000050753 NextBio:35575765 Uniprot:F1LNC5)

HSP 1 Score: 66.6254 bits (161), Expect = 1.976e-11
Identity = 43/69 (62.32%), Postives = 49/69 (71.01%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRPPPP+PHK K        +   + LSSSEEEL STP+  TSC+  E ESES+SEK
Sbjct:  479 RNDSLSSDQSESVRPPPPRPHKSKK-----GGKMRQVSLSSSEEELASTPEY-TSCDDVEIESESVSEK 541          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:Rims2 "Regulating synaptic membrane exocytosis protein 2" species:10116 "Rattus norvegicus" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 GeneTree:ENSGT00550000074588 EMBL:AABR06050516 EMBL:AABR06050517 EMBL:AABR06050518 EMBL:AABR06050519 EMBL:AABR06050520 EMBL:AABR06050521 EMBL:AABR06050522 EMBL:AABR06050523 EMBL:AABR06050524 EMBL:AABR06050525 Ensembl:ENSRNOT00000041618 NextBio:35574092 ArrayExpress:D4ABU5 Uniprot:D4ABU5)

HSP 1 Score: 66.6254 bits (161), Expect = 2.007e-11
Identity = 43/69 (62.32%), Postives = 49/69 (71.01%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRPPPP+PHK K        +   + LSSSEEEL STP+  TSC+  E ESES+SEK
Sbjct:  479 RNDSLSSDQSESVRPPPPRPHKSKK-----GGKMRQVSLSSSEEELASTPEY-TSCDDVEIESESVSEK 541          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:Rims2 "Regulating synaptic membrane exocytosis protein 2" species:10116 "Rattus norvegicus" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0017156 "calcium ion-dependent exocytosis" evidence=IEA] [GO:0017157 "regulation of exocytosis" evidence=IEA] [GO:0019933 "cAMP-mediated signaling" evidence=IEA] [GO:0030054 "cell junction" evidence=IEA] [GO:0030073 "insulin secretion" evidence=IEA] [GO:0042391 "regulation of membrane potential" evidence=IEA] [GO:0042734 "presynaptic membrane" evidence=IEA] [GO:0044325 "ion channel binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 RGD:620001 GO:GO:0006886 GO:GO:0046872 GO:GO:0019933 GO:GO:0030054 GO:GO:0042734 GO:GO:0042391 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 GO:GO:0017156 SUPFAM:SSF50156 GO:GO:0030073 GO:GO:0048791 GO:GO:0017157 eggNOG:NOG286957 HOVERGEN:HBG058147 OrthoDB:EOG7BGHJV CTD:9699 KO:K15297 GeneTree:ENSGT00550000074588 EMBL:AF199322 EMBL:AF199323 EMBL:AF199324 EMBL:AF199325 EMBL:AF199326 EMBL:AF199327 EMBL:AF199328 EMBL:AF199329 EMBL:AF199330 EMBL:AF199331 EMBL:AF199332 EMBL:AF199335 EMBL:AF548738 RefSeq:NP_446397.1 RefSeq:NP_665888.1 UniGene:Rn.161948 PDB:2A20 PDB:2BWQ PDB:2CJS PDBsum:2A20 PDBsum:2BWQ PDBsum:2CJS ProteinModelPortal:Q9JIS1 SMR:Q9JIS1 DIP:DIP-29192N IntAct:Q9JIS1 MINT:MINT-270417 PhosphoSite:Q9JIS1 PaxDb:Q9JIS1 PRIDE:Q9JIS1 Ensembl:ENSRNOT00000006393 GeneID:116839 KEGG:rno:116839 InParanoid:Q9JIS1 OMA:SSARMKN EvolutionaryTrace:Q9JIS1 NextBio:619731 Genevestigator:Q9JIS1 Uniprot:Q9JIS1)

HSP 1 Score: 65.855 bits (159), Expect = 3.438e-11
Identity = 42/69 (60.87%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRPPPP+PHK K        +   + LSSSEEEL STP+  TSC+  E ESES+ EK
Sbjct:  479 RNDSLSSDQSESVRPPPPRPHKSKK-----GGKMRQVSLSSSEEELASTPEY-TSCDDVEIESESVGEK 541          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:Rims2 "regulating synaptic membrane exocytosis 2" species:10116 "Rattus norvegicus" [GO:0005515 "protein binding" evidence=IPI] [GO:0005622 "intracellular" evidence=ISO] [GO:0005623 "cell" evidence=ISO] [GO:0006887 "exocytosis" evidence=TAS] [GO:0017156 "calcium ion-dependent exocytosis" evidence=ISO] [GO:0017157 "regulation of exocytosis" evidence=ISO] [GO:0019904 "protein domain specific binding" evidence=IDA] [GO:0019933 "cAMP-mediated signaling" evidence=ISO] [GO:0030073 "insulin secretion" evidence=ISO] [GO:0042391 "regulation of membrane potential" evidence=ISO] [GO:0043234 "protein complex" evidence=IDA] [GO:0044325 "ion channel binding" evidence=ISO] [GO:0045202 "synapse" evidence=IDA] [GO:0046982 "protein heterodimerization activity" evidence=IDA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=ISO] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 RGD:620001 GO:GO:0006886 GO:GO:0046872 GO:GO:0019933 GO:GO:0030054 GO:GO:0042734 GO:GO:0042391 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 GO:GO:0017156 SUPFAM:SSF50156 GO:GO:0030073 GO:GO:0048791 GO:GO:0017157 eggNOG:NOG286957 HOVERGEN:HBG058147 OrthoDB:EOG7BGHJV CTD:9699 KO:K15297 GeneTree:ENSGT00550000074588 EMBL:AF199322 EMBL:AF199323 EMBL:AF199324 EMBL:AF199325 EMBL:AF199326 EMBL:AF199327 EMBL:AF199328 EMBL:AF199329 EMBL:AF199330 EMBL:AF199331 EMBL:AF199332 EMBL:AF199335 EMBL:AF548738 RefSeq:NP_446397.1 RefSeq:NP_665888.1 UniGene:Rn.161948 PDB:2A20 PDB:2BWQ PDB:2CJS PDBsum:2A20 PDBsum:2BWQ PDBsum:2CJS ProteinModelPortal:Q9JIS1 SMR:Q9JIS1 DIP:DIP-29192N IntAct:Q9JIS1 MINT:MINT-270417 PhosphoSite:Q9JIS1 PaxDb:Q9JIS1 PRIDE:Q9JIS1 Ensembl:ENSRNOT00000006393 GeneID:116839 KEGG:rno:116839 InParanoid:Q9JIS1 OMA:SSARMKN EvolutionaryTrace:Q9JIS1 NextBio:619731 Genevestigator:Q9JIS1 Uniprot:Q9JIS1)

HSP 1 Score: 65.855 bits (159), Expect = 3.438e-11
Identity = 42/69 (60.87%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRPPPP+PHK K        +   + LSSSEEEL STP+  TSC+  E ESES+ EK
Sbjct:  479 RNDSLSSDQSESVRPPPPRPHKSKK-----GGKMRQVSLSSSEEELASTPEY-TSCDDVEIESESVGEK 541          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:RIMS1 "Regulating synaptic membrane exocytosis protein 1" species:9606 "Homo sapiens" [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 EMBL:AL160405 EMBL:AL590011 EMBL:AL034373 EMBL:AL390056 EMBL:AL445256 EMBL:AL035633 HGNC:HGNC:17282 ChiTaRS:RIMS1 ProteinModelPortal:E7ENC2 SMR:E7ENC2 Ensembl:ENST00000348717 UCSC:uc011dyb.2 NextBio:35499584 ArrayExpress:E7ENC2 Bgee:E7ENC2 Uniprot:E7ENC2)

HSP 1 Score: 62.3882 bits (150), Expect = 4.684e-10
Identity = 42/69 (60.87%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRP PPKPH+ K        +K  + +SSSEEE  STP+  TSCE  E ESES+SEK
Sbjct:  497 RNDSLSSDQSESVRPSPPKPHRSKR-----GGKKRQMSVSSSEEEGVSTPEY-TSCEDVELESESVSEK 559          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:Gga.43738 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0006461 "protein complex assembly" evidence=IEA] [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0042391 "regulation of membrane potential" evidence=IEA] [GO:0044325 "ion channel binding" evidence=IEA] [GO:0045202 "synapse" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048169 "regulation of long-term neuronal synaptic plasticity" evidence=IEA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 OrthoDB:EOG7BGHJV TreeFam:TF321703 GeneTree:ENSGT00550000074588 EMBL:AADN03003516 EMBL:AADN03003682 Ensembl:ENSGALT00000025694 Uniprot:F1P5P9)

HSP 1 Score: 62.3882 bits (150), Expect = 4.997e-10
Identity = 42/69 (60.87%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRP PPKPH+ K        +K  + +SSSEEE  STP+  TSCE  E ESES+SEK
Sbjct:  468 RNDSLSSDQSESVRPSPPKPHRAKR-----GGKKRQMSVSSSEEEGASTPEY-TSCEDVEIESESVSEK 530          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:RIMS1 "Regulating synaptic membrane exocytosis protein 1" species:9606 "Homo sapiens" [GO:0005083 "small GTPase regulator activity" evidence=TAS] [GO:0005515 "protein binding" evidence=IPI] [GO:0005886 "plasma membrane" evidence=TAS] [GO:0006461 "protein complex assembly" evidence=IDA] [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0007268 "synaptic transmission" evidence=TAS] [GO:0007269 "neurotransmitter secretion" evidence=TAS] [GO:0007601 "visual perception" evidence=IEA] [GO:0014047 "glutamate secretion" evidence=TAS] [GO:0016079 "synaptic vesicle exocytosis" evidence=TAS] [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0017156 "calcium ion-dependent exocytosis" evidence=TAS] [GO:0030054 "cell junction" evidence=IEA] [GO:0042391 "regulation of membrane potential" evidence=IEA] [GO:0042734 "presynaptic membrane" evidence=ISS;NAS] [GO:0044325 "ion channel binding" evidence=IEA] [GO:0044822 "poly(A) RNA binding" evidence=IDA] [GO:0045055 "regulated secretory pathway" evidence=NAS] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0046903 "secretion" evidence=NAS] [GO:0048169 "regulation of long-term neuronal synaptic plasticity" evidence=IEA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IEA] [GO:0050790 "regulation of catalytic activity" evidence=TAS] [GO:0050896 "response to stimulus" evidence=IEA] [GO:0061025 "membrane fusion" evidence=NAS] Reactome:REACT_13685 Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 Pfam:PF02318 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 GO:GO:0006886 GO:GO:0006461 GO:GO:0046872 GO:GO:0030054 GO:GO:0007601 GO:GO:0042734 Orphanet:1872 GO:GO:0050896 GO:GO:0042391 SUPFAM:SSF49562 GO:GO:0061025 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 GO:GO:0017156 SUPFAM:SSF50156 GO:GO:0048169 GO:GO:0014047 GO:GO:0016079 GO:GO:0005083 GO:GO:0048791 GO:GO:0045055 EMBL:AY190519 EMBL:AB045726 EMBL:AB051866 EMBL:AB002338 EMBL:AK296303 EMBL:AK294868 EMBL:AK295001 EMBL:AK300853 EMBL:AK309185 EMBL:AL160405 EMBL:AL590011 EMBL:AL034373 EMBL:AL390056 EMBL:AL445256 EMBL:AL035633 EMBL:BC151853 EMBL:BC152435 EMBL:AF263305 EMBL:AF263306 EMBL:AF263307 EMBL:AF263308 EMBL:AF263309 EMBL:AF263310 RefSeq:NP_001161879.1 RefSeq:NP_001161880.1 RefSeq:NP_001161881.1 RefSeq:NP_001161882.1 RefSeq:NP_001161883.1 RefSeq:NP_055804.2 RefSeq:XP_005248749.1 UniGene:Hs.485729 PDB:2CSS PDBsum:2CSS ProteinModelPortal:Q86UR5 SMR:Q86UR5 BioGrid:116646 IntAct:Q86UR5 MINT:MINT-2808819 PhosphoSite:Q86UR5 DMDM:34395763 PaxDb:Q86UR5 PRIDE:Q86UR5 Ensembl:ENST00000264839 Ensembl:ENST00000370420 Ensembl:ENST00000401910 Ensembl:ENST00000414192 Ensembl:ENST00000425662 Ensembl:ENST00000491071 Ensembl:ENST00000517827 Ensembl:ENST00000517960 Ensembl:ENST00000518273 Ensembl:ENST00000520567 Ensembl:ENST00000521978 Ensembl:ENST00000522291 Ensembl:ENST00000523963 GeneID:22999 KEGG:hsa:22999 UCSC:uc003pga.4 UCSC:uc003pgb.4 UCSC:uc003pgc.3 UCSC:uc010kas.1 CTD:22999 GeneCards:GC06P072653 HGNC:HGNC:17282 HPA:HPA039297 MIM:603649 MIM:606629 neXtProt:NX_Q86UR5 PharmGKB:PA38220 eggNOG:NOG286957 HOGENOM:HOG000082403 HOVERGEN:HBG058147 InParanoid:Q86UR5 KO:K15291 OMA:ERKKTPG OrthoDB:EOG7BGHJV TreeFam:TF321703 ChiTaRS:RIMS1 EvolutionaryTrace:Q86UR5 GeneWiki:RIMS1 GenomeRNAi:22999 NextBio:43896 PRO:PR:Q86UR5 ArrayExpress:Q86UR5 Bgee:Q86UR5 Genevestigator:Q86UR5 Uniprot:Q86UR5)

HSP 1 Score: 62.003 bits (149), Expect = 5.549e-10
Identity = 42/69 (60.87%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRP PPKPH+ K        +K  + +SSSEEE  STP+  TSCE  E ESES+SEK
Sbjct:  497 RNDSLSSDQSESVRPSPPKPHRSKR-----GGKKRQMSVSSSEEEGVSTPEY-TSCEDVELESESVSEK 559          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:rims1a "regulating synaptic membrane exocytosis 1a" species:7955 "Danio rerio" [GO:0017137 "Rab GTPase binding" evidence=IEA] [GO:0006886 "intracellular protein transport" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 InterPro:IPR010911 Pfam:PF00168 PROSITE:PS50004 PROSITE:PS50106 PROSITE:PS50916 SMART:SM00228 SMART:SM00239 ZFIN:ZDB-GENE-090312-135 GO:GO:0006886 GO:GO:0046872 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR017455 InterPro:IPR011011 InterPro:IPR013083 SUPFAM:SSF57903 PROSITE:PS50178 SUPFAM:SSF50156 TreeFam:TF321703 GeneTree:ENSGT00550000074588 OMA:HLIFNDS EMBL:CR354543 EMBL:CR356236 Ensembl:ENSDART00000112553 Uniprot:F1RCJ3)

HSP 1 Score: 61.6178 bits (148), Expect = 7.272e-10
Identity = 38/67 (56.72%), Postives = 47/67 (70.15%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCEEFESESISEK 195
            RNDSLSSDQSE +RPPPP+P+K K         K  + +SSSEEE  STP+  TSCE+ E ES+SE+
Sbjct:  469 RNDSLSSDQSESLRPPPPRPYKSKR-----GGNKRQMSVSSSEEEAGSTPE-YTSCEDVEIESVSER 529          
BLAST of EMLSAG00000000022 vs. GO
Match: - (symbol:RIMS1 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0006461 "protein complex assembly" evidence=IEA] [GO:0042391 "regulation of membrane potential" evidence=IEA] [GO:0044325 "ion channel binding" evidence=IEA] [GO:0045202 "synapse" evidence=IEA] [GO:0048169 "regulation of long-term neuronal synaptic plasticity" evidence=IEA] [GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IEA] Pfam:PF00595 InterPro:IPR000008 InterPro:IPR001478 Pfam:PF00168 PROSITE:PS50004 PROSITE:PS50106 SMART:SM00228 SMART:SM00239 GO:GO:0006461 GO:GO:0045202 GO:GO:0042391 SUPFAM:SSF49562 Gene3D:3.30.40.10 InterPro:IPR013083 SUPFAM:SSF50156 GO:GO:0048169 GO:GO:0048791 OMA:ERKKTPG OrthoDB:EOG7BGHJV TreeFam:TF321703 GeneTree:ENSGT00550000074588 EMBL:DAAA02025209 EMBL:DAAA02025210 EMBL:DAAA02025211 EMBL:DAAA02025212 EMBL:DAAA02025213 EMBL:DAAA02025214 Ensembl:ENSBTAT00000061208 Uniprot:F1N7B7)

HSP 1 Score: 61.6178 bits (148), Expect = 8.952e-10
Identity = 41/69 (59.42%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRP PPKPH+ K        ++  + +SSSEEE  STP+  TSCE  E ESES+SEK
Sbjct:  336 RNDSLSSDQSESVRPSPPKPHRAKR-----GGKRRQMSVSSSEEEGVSTPEY-TSCEDVELESESVSEK 398          
BLAST of EMLSAG00000000022 vs. C. finmarchicus
Match: gi|592749621|gb|GAXK01204792.1| (TSA: Calanus finmarchicus comp540019_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 36.5798 bits (83), Expect = 4.738e-2
Identity = 35/74 (47.30%), Postives = 42/74 (56.76%), Query Frame = 0
Query:   74 NIPRHHSRD----LYPRVLVSEGESRDQCTPLFDPETG-QPSL---XXXXXXXXXXMMGLHYRRNDSLSSDQSE 139
            + P  H RD    LYPRVLVS+ E+RDQ   + + E   Q SL   N     + RR M   + RNDSLSSDQSE
Sbjct: 5231 SAPEDHGRDGPYNLYPRVLVSDQEARDQFPVMSETEMKIQKSLLDPNDARGVSNRRKMDSSF-RNDSLSSDQSE 5449          
BLAST of EMLSAG00000000022 vs. L. salmonis peptides
Match: EMLSAP00000000022 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:92038:93364:-1 gene:EMLSAG00000000022 transcript:EMLSAT00000000022 description:"snap-LSalAtl2s1004-processed-gene-0.16")

HSP 1 Score: 407.142 bits (1045), Expect = 1.018e-145
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 0
Query:    1 MPDPSIDNIISSNPPPHHFPYTPRQAPPFTHQRPFYPRFPRGQQLSRQRSLEGGFPSSASSSASSTAGGAPEDNIPRHHSRDLYPRVLVSEGESRDQCTPLFDPETGQPSLNGGGNQNRRRMMGLHYRRNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCEEFESESISEKDSQNMN 201
            MPDPSIDNIISSNPPPHHFPYTPRQAPPFTHQRPFYPRFPRGQQLSRQRSLEGGFPSSASSSASSTAGGAPEDNIPRHHSRDLYPRVLVSEGESRDQCTPLFDPETGQPSLNGGGNQNRRRMMGLHYRRNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCEEFESESISEKDSQNMN
Sbjct:    1 MPDPSIDNIISSNPPPHHFPYTPRQAPPFTHQRPFYPRFPRGQQLSRQRSLEGGFPSSASSSASSTAGGAPEDNIPRHHSRDLYPRVLVSEGESRDQCTPLFDPETGQPSLNGGGNQNRRRMMGLHYRRNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCEEFESESISEKDSQNMN 201          
BLAST of EMLSAG00000000022 vs. SwissProt
Match: gi|34395823|sp|Q9EQZ7.1|RIMS2_MOUSE (RecName: Full=Regulating synaptic membrane exocytosis protein 2; AltName: Full=Rab-3-interacting molecule 2; Short=RIM 2; AltName: Full=Rab-3-interacting protein 2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.083e-12
Identity = 46/74 (62.16%), Postives = 52/74 (70.27%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK-DSQN 199
            RNDSLSSDQSE VRPPPP+PHK K        +   + LSSSEEEL STP+  TSC+  E ESES+SEK DSQ 
Sbjct:  519 RNDSLSSDQSESVRPPPPRPHKSKK-----GGKMRQVSLSSSEEELASTPEY-TSCDDVELESESVSEKGDSQK 586          
BLAST of EMLSAG00000000022 vs. SwissProt
Match: gi|34395746|sp|Q9JIS1.1|RIMS2_RAT (RecName: Full=Regulating synaptic membrane exocytosis protein 2; AltName: Full=Rab-3-interacting molecule 2; Short=RIM 2)

HSP 1 Score: 65.855 bits (159), Expect = 1.532e-11
Identity = 42/69 (60.87%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRPPPP+PHK K        +   + LSSSEEEL STP+  TSC+  E ESES+ EK
Sbjct:  479 RNDSLSSDQSESVRPPPPRPHKSKK-----GGKMRQVSLSSSEEELASTPEY-TSCDDVEIESESVGEK 541          
BLAST of EMLSAG00000000022 vs. SwissProt
Match: gi|34395763|sp|Q86UR5.1|RIMS1_HUMAN (RecName: Full=Regulating synaptic membrane exocytosis protein 1; AltName: Full=Rab-3-interacting molecule 1; Short=RIM 1; AltName: Full=Rab-3-interacting protein 2)

HSP 1 Score: 62.003 bits (149), Expect = 3.080e-10
Identity = 42/69 (60.87%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRP PPKPH+ K        +K  + +SSSEEE  STP+  TSCE  E ESES+SEK
Sbjct:  497 RNDSLSSDQSESVRPSPPKPHRSKR-----GGKKRQMSVSSSEEEGVSTPEY-TSCEDVELESESVSEK 559          
BLAST of EMLSAG00000000022 vs. SwissProt
Match: gi|34395745|sp|Q9JIR4.1|RIMS1_RAT (RecName: Full=Regulating synaptic membrane exocytosis protein 1; AltName: Full=Rab-3-interacting molecule 1; Short=RIM 1)

HSP 1 Score: 60.077 bits (144), Expect = 1.650e-9
Identity = 41/69 (59.42%), Postives = 48/69 (69.57%), Query Frame = 0
Query:  129 RNDSLSSDQSECVRPPPPKPHKRKTHLHHPHSEKGLILLSSSEEELQSTPDCTTSCE--EFESESISEK 195
            RNDSLSSDQSE VRP PPKPH+ K        ++  + +SSSEEE  STP+  TSCE  E ESES+SEK
Sbjct:  511 RNDSLSSDQSESVRPSPPKPHRPKR-----GGKRRQMSVSSSEEEGVSTPE-YTSCEDVELESESVSEK 573          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000022 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 20
Match NameE-valueIdentityDescription
-5.425e-1262.16symbol:Rims2 "regulating synaptic membrane exocyto... [more]
-1.976e-1162.32symbol:Rims2 "Regulating synaptic membrane exocyto... [more]
-2.007e-1162.32symbol:Rims2 "Regulating synaptic membrane exocyto... [more]
-3.438e-1160.87symbol:Rims2 "Regulating synaptic membrane exocyto... [more]
-3.438e-1160.87symbol:Rims2 "regulating synaptic membrane exocyto... [more]
-4.684e-1060.87symbol:RIMS1 "Regulating synaptic membrane exocyto... [more]
-4.997e-1060.87symbol:Gga.43738 "Uncharacterized protein" species... [more]
-5.549e-1060.87symbol:RIMS1 "Regulating synaptic membrane exocyto... [more]
-7.272e-1056.72symbol:rims1a "regulating synaptic membrane exocyt... [more]
-8.952e-1059.42symbol:RIMS1 "Uncharacterized protein" species:991... [more]

Pages

back to top
BLAST of EMLSAG00000000022 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 1
Match NameE-valueIdentityDescription
gi|592749621|gb|GAXK01204792.1|4.738e-247.30TSA: Calanus finmarchicus comp540019_c0_seq1 trans... [more]
back to top
BLAST of EMLSAG00000000022 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000000221.018e-145100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:9203... [more]
back to top
BLAST of EMLSAG00000000022 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
gi|34395823|sp|Q9EQZ7.1|RIMS2_MOUSE2.083e-1262.16RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|34395746|sp|Q9JIS1.1|RIMS2_RAT1.532e-1160.87RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|34395763|sp|Q86UR5.1|RIMS1_HUMAN3.080e-1060.87RecName: Full=Regulating synaptic membrane exocyto... [more]
gi|34395745|sp|Q9JIR4.1|RIMS1_RAT1.650e-959.42RecName: Full=Regulating synaptic membrane exocyto... [more]
back to top
BLAST of EMLSAG00000000022 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000022 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000022 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1004supercontigLSalAtl2s1004:92038..93364 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteRegulating synaptic membrane exocytosis protein 2
Logic nameensemblgenomes
Descriptionsnap-LSalAtl2s1004-processed-gene-0.16
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000022 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000022EMLSAT00000000022-695869Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1004:92038..93364-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000022-682788 ID=EMLSAG00000000022-682788|Name=EMLSAG00000000022|organism=Lepeophtheirus salmonis|type=gene|length=1327bp|location=Sequence derived from alignment at LSalAtl2s1004:92038..93364- (Lepeophtheirus salmonis)
ATGCCGGATCCCAGCATCGACAATATCATATCATCAAACCCTCCTCCTCA CCATTTTCCATATACACCTCGTCAAGCACCGCCATTTACTCATCAACGAC CATTTTATCCAAGGTAAGAAAATGTACTTAATCCACAATAGCGTTTTTTT CCGGGATCCCGTTGTCTCAGAATTTACACCAATGGGAAATCATTCATTTC ATTATTTCATAATATAGGCTTAATTTAAACTAAAAATTAAGCCATAAATA TAAACATATGTCCGGTAATTGATTTGTAAACTGTTCCATGACGTCACATA TGTTTCATATTTATATTTATTTAGAGTGTTTTTGAAGTGGTATGAAATGT TGCATTTTAAATATCTATTATTTTTATCAAATGAATTACAGTGATACGGT AGTTGACTTTTAGCCGAGACTCGGTAAAGAAATGAGAACCCGCGTGCTCA CTAATTCTATTGTATTGACTAAATTAACTAAGATATCTTTAATTCTCAAC AGATTCCCTCGAGGACAACAGCTATCGAGACAAAGATCTCTTGAGGGAGG ATTTCCATCATCAGCCTCATCTTCTGCTTCGTCCACAGCTGGAGGTGGTA TSCATCATCTKCCATCATCAATTATRCCARCCCCAKCAGCCTCTATCTCC TCTAATAGAGGAGGTACGCCACGCCGTTTAAGTGAGGGAGAACCACCTCG WTTGTTTCGRTATCCATATCAGCATYGAGGCGGCAGCCGCATGCCTCCRC CAAGTTATCGTAMGCGCCATCCTCCATCATCTTGGGGTCGAGAATCTCTC TCAGCCCCTGAAGACAACATTCCGCGTCATCATAGTCGTGATCTGTATCC TCGAGTTCTTGTCTCAGAAGGAGAATCCAGGGATCAATGTACTCCTTTAT TTGATCCCGAAACGGGTCAACCATCACTCAATGGTGGTGGAAATCAAAAT CGGCGTCGGATGATGGGACTTCATTACCGAAGAAATGACTCACTTTCATC GGATCAAAGTGAGTGTGTCCGACCACCGCCCCCAAAGCCCCACAAACGAA AGACMCATCTTCATCACCCCCATTCAGAAAAAGGACTCATACTGCTTTCA TCTTCAGAGGAGGAGCTACAATCCACACCTGACTGCACAACATCATGCGA AGAATTTGAAAGTGAATCCATTTCCGAAAAAGGTAAGAGGTTGAGGGGTT TTTATTTAATTATATATATAATAATGTTCCGTTGAAGCACGTCTCTTCTC CATAAGAAGGAGAATATATGTACATATTTGCCTTTTGTTTCCTTTTGCAT TCGTTAGATTCCCAAAATATGAATTGA
back to top
Add to Basket