EMLSAG00000000023, EMLSAG00000000023-682789 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000023
Unique NameEMLSAG00000000023-682789
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:Q52V24 "Hepatopancreas trypsin" species:6717 "Pontastacus leptodactylus" [GO:0005515 "protein binding" evidence=IPI] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0046872 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 PDB:4BNR PDBsum:4BNR EMBL:AY906961 PDB:2F91 PDBsum:2F91 IntAct:Q52V24 MEROPS:S01.035 EvolutionaryTrace:Q52V24 Uniprot:Q52V24)

HSP 1 Score: 163.696 bits (413), Expect = 1.549e-48
Identity = 93/177 (52.54%), Postives = 115/177 (64.97%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTD--ETMICAAAP--GKDSCQGDSGGPLAQDGT----LVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            +Q +A E D+    G EQ + VSKI  HE F  +  + D+ LLKL  SL  N+ V P+ALPE+    TGDV+V+GWGT    G +  VL+ VTV +VSDEDC  A +G+ +  ++MICA  P  GKDSCQGDSGGPLA   T    L GIVSWG  GCA PGYPGVY +VS  +DWI
Sbjct:   58 LQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCR-ADYGADEILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWG-YGCARPGYPGVYTEVSYHVDWI 232          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:Prss1 "Anionic trypsin-1" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 RGD:3417 GO:GO:0005615 GO:GO:0046872 GO:GO:0007586 GO:GO:0006508 GO:GO:0007584 GO:GO:0031000 GO:GO:0004252 GO:GO:0035094 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 OrthoDB:EOG75B84T HOGENOM:HOG000251820 TreeFam:TF331065 CTD:5644 GeneTree:ENSGT00740000115192 KO:K01312 EMBL:V01273 EMBL:J00778 PIR:B22657 RefSeq:NP_036767.1 UniGene:Rn.34435 ProteinModelPortal:P00762 SMR:P00762 STRING:10116.ENSRNOP00000043068 MEROPS:S01.094 PhosphoSite:P00762 PaxDb:P00762 PRIDE:P00762 Ensembl:ENSRNOT00000040403 GeneID:24691 KEGG:rno:24691 UCSC:RGD:3417 InParanoid:P00762 OMA:HPQYNSW NextBio:604133 PRO:PR:P00762 Genevestigator:P00762 Uniprot:P00762)

HSP 1 Score: 144.436 bits (363), Expect = 4.868e-41
Identity = 79/175 (45.14%), Postives = 101/175 (57.71%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + GDEQ +  +KI  H  + S   N D+ L+KL S + LN +V PVALP          ++SGWG   SNG + P +L+ V   V+S  DC  AY G    +MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA P  PGVY KV  F+ WI +T
Sbjct:   69 IQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWG-YGCALPDNPGVYTKVCNFVGWIQDT 242          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:Prss1 "protease, serine, 1 (trypsin 1)" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0005615 "extracellular space" evidence=IDA] [GO:0007584 "response to nutrient" evidence=IEP] [GO:0007586 "digestion" evidence=TAS] [GO:0010033 "response to organic substance" evidence=IEP] [GO:0031000 "response to caffeine" evidence=IDA] [GO:0035094 "response to nicotine" evidence=IDA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 RGD:3417 GO:GO:0005615 GO:GO:0046872 GO:GO:0007586 GO:GO:0006508 GO:GO:0007584 GO:GO:0031000 GO:GO:0004252 GO:GO:0035094 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 OrthoDB:EOG75B84T HOGENOM:HOG000251820 TreeFam:TF331065 CTD:5644 GeneTree:ENSGT00740000115192 KO:K01312 EMBL:V01273 EMBL:J00778 PIR:B22657 RefSeq:NP_036767.1 UniGene:Rn.34435 ProteinModelPortal:P00762 SMR:P00762 STRING:10116.ENSRNOP00000043068 MEROPS:S01.094 PhosphoSite:P00762 PaxDb:P00762 PRIDE:P00762 Ensembl:ENSRNOT00000040403 GeneID:24691 KEGG:rno:24691 UCSC:RGD:3417 InParanoid:P00762 OMA:HPQYNSW NextBio:604133 PRO:PR:P00762 Genevestigator:P00762 Uniprot:P00762)

HSP 1 Score: 144.436 bits (363), Expect = 4.868e-41
Identity = 79/175 (45.14%), Postives = 101/175 (57.71%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + GDEQ +  +KI  H  + S   N D+ L+KL S + LN +V PVALP          ++SGWG   SNG + P +L+ V   V+S  DC  AY G    +MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA P  PGVY KV  F+ WI +T
Sbjct:   69 IQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWG-YGCALPDNPGVYTKVCNFVGWIQDT 242          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:Try29F "Trypsin 29F" species:7227 "Drosophila melanogaster" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA;ISS;NAS] [GO:0006508 "proteolysis" evidence=IEA;NAS] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 EMBL:AE014134 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 KO:K01312 GeneTree:ENSGT00620000088101 MEROPS:S01.A91 FlyBase:FBgn0015316 RefSeq:NP_523518.2 UniGene:Dm.2653 ProteinModelPortal:Q9VLF5 SMR:Q9VLF5 MINT:MINT-1601632 PRIDE:Q9VLF5 EnsemblMetazoa:FBtr0301665 GeneID:34226 KEGG:dme:Dmel_CG9564 CTD:34226 InParanoid:Q9VLF5 PhylomeDB:Q9VLF5 GenomeRNAi:34226 NextBio:787484 Bgee:Q9VLF5 Uniprot:Q9VLF5)

HSP 1 Score: 138.658 bits (348), Expect = 1.559e-38
Identity = 77/159 (48.43%), Postives = 98/159 (61.64%), Query Frame = 0
Query:   21 QKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFT--GDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY--FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIA 173
            Q VG+ ++  H KF ++  ++D  LL+L+     N     V LPE+D +      V+VSGWG   S   +  VLRSVTV  VS   C++AY  FGS  + M+CA  P  GKD+CQGDSGGPLA DG L G+VSWG  GCA P YPGVY +VS   DWI+
Sbjct:  105 QLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWIS 262          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:PRSS2 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG75B84T TreeFam:TF331065 GeneTree:ENSGT00740000115192 Ensembl:ENSGALT00000030486 Uniprot:F1NP19)

HSP 1 Score: 134.806 bits (338), Expect = 4.975e-38
Identity = 69/153 (45.10%), Postives = 96/153 (62.75%), Query Frame = 0
Query:   26 SKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            S I  H K+ S   N D+ L+KL S+++ +  ++P+ALP    +   + ++SGWG   SNG + P +L+ +   ++SD++C +AY G     MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA  GYPGVY KV  ++DWI ET
Sbjct:   25 SVIIRHPKYSSITLNNDIMLIKLASAVEYSADIQPIALPSSCAKAGTECLISGWGNTLSNGYNYPELLQCLNAPILSDQECQEAYPGDITSNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-IGCALKGYPGVYTKVCNYVDWIQET 176          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:LOC679835 "similar to Anionic trypsin II precursor (Pretrypsinogen II)" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=ISO] [GO:0005509 "calcium ion binding" evidence=ISO] [GO:0005615 "extracellular space" evidence=ISO] [GO:0006508 "proteolysis" evidence=ISO] [GO:0008152 "metabolic process" evidence=ISO] [GO:0008236 "serine-type peptidase activity" evidence=ISO] [GO:0031638 "zymogen activation" evidence=ISO] [GO:0043542 "endothelial cell migration" evidence=ISO] REFSEQ:XM_001054181 Ncbi:XP_001054181)

HSP 1 Score: 135.191 bits (339), Expect = 1.811e-37
Identity = 74/175 (42.29%), Postives = 98/175 (56.00%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + GDEQ V  +KI  H  F     N D+ L+KL S + LN +V  VALP          ++SGWG   S G + P +L+ +   ++   DC  +Y G     M+CA     GKDSCQGDSGGP+  +G L GIVSWG  GCA P  PGVY KV  ++DWI +T
Sbjct:   69 IQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNDPDLLQCLDAPLLPQADCEASYPGKITNNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIQDT 242          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:LOC100365995 "rCG28262-like" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 RGD:1311446 RGD:2317994 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG75B84T EMBL:CH473959 TreeFam:TF331065 GeneTree:ENSGT00740000115192 KO:K01312 OMA:TAENDIM EMBL:AABR06030674 RefSeq:NP_001102096.1 UniGene:Rn.225509 MEROPS:S01.387 Ensembl:ENSRNOT00000041100 GeneID:362347 KEGG:rno:362347 UCSC:RGD:1311446 CTD:22074 NextBio:679603 Uniprot:D3ZQV0)

HSP 1 Score: 134.806 bits (338), Expect = 2.239e-37
Identity = 74/175 (42.29%), Postives = 97/175 (55.43%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + GDEQ V  +KI  H  F +   N D+ L+KL S + LN +V  VALP          ++SGWG   S G + P +L+ +   V+   DC  +Y G     MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA    PGVY KV  ++DWI +T
Sbjct:   69 IQVRLGEHNINVLEGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWG-YGCALKDNPGVYTKVCNYVDWIQDT 242          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:Try4 "trypsin 4" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 RGD:1311446 RGD:2317994 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG75B84T EMBL:CH473959 TreeFam:TF331065 GeneTree:ENSGT00740000115192 KO:K01312 OMA:TAENDIM EMBL:AABR06030674 RefSeq:NP_001102096.1 UniGene:Rn.225509 MEROPS:S01.387 Ensembl:ENSRNOT00000041100 GeneID:362347 KEGG:rno:362347 UCSC:RGD:1311446 CTD:22074 NextBio:679603 Uniprot:D3ZQV0)

HSP 1 Score: 134.806 bits (338), Expect = 2.239e-37
Identity = 74/175 (42.29%), Postives = 97/175 (55.43%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + GDEQ V  +KI  H  F +   N D+ L+KL S + LN +V  VALP          ++SGWG   S G + P +L+ +   V+   DC  +Y G     MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA    PGVY KV  ++DWI +T
Sbjct:   69 IQVRLGEHNINVLEGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWG-YGCALKDNPGVYTKVCNYVDWIQDT 242          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:LOC683849 "RCG64545" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] EMBL:CH473959 GeneTree:ENSGT00740000115192 EMBL:AABR06030678 Ensembl:ENSRNOT00000043527 RGD:1597830 Uniprot:W4VSR6)

HSP 1 Score: 134.42 bits (337), Expect = 4.138e-37
Identity = 73/175 (41.71%), Postives = 99/175 (56.57%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + G+EQ V  +KI  H  F     N D+ L+KL S + LN +V  VALP          ++SGWG   S G + P +L+ +   ++   DC  +Y G   + M+CA     GKDSCQGDSGGP+  +G L GIVSWG  GCA P  PGVY KV  ++DWI +T
Sbjct:   69 IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIEDT 242          
BLAST of EMLSAG00000000023 vs. GO
Match: - (symbol:Try10 "Protein Try10" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] EMBL:CH473959 GeneTree:ENSGT00740000115192 EMBL:AABR06030674 Ensembl:ENSRNOT00000048049 RGD:1359400 Uniprot:W4VSR7)

HSP 1 Score: 134.035 bits (336), Expect = 4.410e-37
Identity = 73/175 (41.71%), Postives = 99/175 (56.57%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + G+EQ V  +KI  H  F     N D+ L+KL S + LN +V  VALP          ++SGWG   S G + P +L+ +   ++   DC  +Y G   + M+CA     GKDSCQGDSGGP+  +G L GIVSWG  GCA P  PGVY KV  ++DWI +T
Sbjct:   69 IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIQDT 242          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592778099|gb|GAXK01176469.1| (TSA: Calanus finmarchicus comp3490_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 113.62 bits (283), Expect = 6.059e-29
Identity = 81/179 (45.25%), Postives = 103/179 (57.54%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGT-NYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPV-LRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLA---QDGT--LVGIVSWXXXXXXXXXXXXXXXKVSKFIDWIA 173
            ++V  +A EHD     G EQ V VSK+T HE +GS  +   D+ + +L   L +NE V PV LPE  Q+  G   VSGWGT+ S     P  L  V V VV+D+ C   Y     E+M+CA   GKDSCQGDSGGP+     DG+  L G+VSW   GC    +PGVY +VS F +WIA
Sbjct:  311 DEVVVVAGEHDRSVDEGTEQMVPVSKLTVHESYGSPKSFENDIAIWELGEPLVMNENVAPVTLPEAMQQTEGSCTVSGWGTLHSGDSGLPSKLMKVDVPVVTDQTCKIEYPLQIAESMLCAGEHGKDSCQGDSGGPMVCYNADGSPYLGGVVSW-GIGCGGYYHPGVYTEVSYFTEWIA 844          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592757377|gb|GAXK01197036.1| (TSA: Calanus finmarchicus comp2639531_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 108.612 bits (270), Expect = 3.670e-28
Identity = 68/171 (39.77%), Postives = 95/171 (55.56%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQ---KVGVSKITYHEKFGSHGTNYDVCLLKLKSSLD--LNEKVKPVALPEK-DQEFTGDV-VVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY---FGSTDETMICAAAP--GKDSCQGDSGGPL-----------AQDGTLVGIVSW 148
            A  +Q +  EH+ F+  G E    ++ +  I  H ++    TNYD  LLKL  SLD  L+  ++P+ LPE  +Q ++G V  V+GWGT  S GP+ P LR V V+V+S+  C + Y        E M+CA  P  GKD+CQGDSGGPL            Q+  L+G+VSW
Sbjct:    3 ASLLQVLLGEHNYFT--GTEAATVRMNIIAIKNHPQYDEQTTNYDFSLLKLAQSLDFSLHPSIRPICLPEGVEQTYSGAVATVTGWGTTSSGGPTSPSLRGVDVNVLSNSACQEDYGYPASWITEQMMCANTPGGGKDACQGDSGGPLVSSGGGDGVTPGQNYELIGVVSW 509          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592778098|gb|GAXK01176470.1| (TSA: Calanus finmarchicus comp3490_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 109.768 bits (273), Expect = 8.849e-28
Identity = 75/184 (40.76%), Postives = 96/184 (52.17%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTG--DVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFG---STDETMICAAAP--GKDSCQGDSGGPL--AQDGT--LVGIVSWXXXXXXXXXXXXXXXKVSKFIDWIAET 175
            V  +A    L +   +E+   +  I  H  + S     D CLLKLK SL+  E V+P+ALP   Q+     +  V+GWGT+   G   P VL  VTV VVSDEDC+ +Y     S  ++MICA     GKDSCQGDSGGP    + G+  LVG+VSWG                S F+DWI ET
Sbjct:  221 VHVVAGGIKLNNFENEEEPRNLDHIISHPNYASATITNDACLLKLKESLEFTEFVQPIALPASGQDTPAGTECTVTGWGTLSEGGFGLPNVLHKVTVPVVSDEDCNASYGASGYSVADSMICAGVEEGGKDSCQGDSGGPFFCGEKGSEELVGVVSWGIGCARKGYPGVYTEN-SYFVDWIMET 769          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592765461|gb|GAXK01189107.1| (TSA: Calanus finmarchicus comp970163_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 101.293 bits (251), Expect = 2.682e-25
Identity = 63/161 (39.13%), Postives = 91/161 (56.52%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQ-KVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEK--VKPVALP-EKDQEFTGDV-VVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGS--TDETMICA--AAPGKDSCQGDSGGPLAQDGT------LVGIV 146
            A  +Q    +HDL+S +  +  ++ V KI  H  + S  TN+D  LLK+ S +D +E   V+P+ LP + DQ + G +  VSGWGT  S G +   LR V V V+S+++C D  +        M+CA  +  GKDSCQGDSGGPL   G+      L+G+V
Sbjct:    3 AAGIQVHLGQHDLYSATESKLLRMSVEKIVEHPNYHSKSTNFDFSLLKMSSRVDFSENPHVRPICLPMDTDQSYAGYLATVSGWGTTSSGGNTASKLREVEVKVISNQECQDMGYKPEWITSQMMCAGVSGGGKDSCQGDSGGPLVTRGSGGGSYELIGVV 485          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592784512|gb|GAXK01170056.1| (TSA: Calanus finmarchicus comp156_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 102.064 bits (253), Expect = 3.200e-25
Identity = 74/170 (43.53%), Postives = 96/170 (56.47%), Query Frame = 0
Query:   10 EHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKV-KPVALPEKDQEFTG--DVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTD--ETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWXXXXXXXXXXXXXXXKVSKFIDWI 172
             H L+    D+  + VSK+  HE + S     D+C+L+L    DL+  V   ++LP   +E+    +  VSGWGT    G     L  VTV VVSD+DC  AY G +D  ++MICA   A GKDSCQGDSGGP      L G+VSW   GCA  G+PGVY + S FI W+
Sbjct:   84 NHHLYEDDADQMDIAVSKVILHEDYDSWTIYNDICMLELSGQADLSSSVIAAISLPSDMEEYPAGTECQVSGWGTTSEGGSLGQTLMKVTVPVVSDDDCRGAY-GQSDIADSMICAGLDAGGKDSCQGDSGGPFMCGSQLSGVVSW-GYGCAEAGFPGVYTQTSYFISWL 587          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592762833|gb|GAXK01191580.1| (TSA: Calanus finmarchicus comp41520_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 100.523 bits (249), Expect = 1.798e-24
Identity = 71/177 (40.11%), Postives = 100/177 (56.50%), Query Frame = 0
Query:    7 IAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEF--TGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDC--SDAYFGSTDET--MICAAAPGKDSCQGDSGGPL-AQDG----TLVGIVSWXXXXXXXXXXXXXXXKVSKFIDWI 172
            +  EHDL    G E+KV V  +T H  + S   +YD  +L L  ++   E + P  LP        +   VVSGWGT+ + G +  VL  VT++ +S+  C  S   + S+D T  M+CA+A GKD+CQGDSGGPL  Q+     T++G+VSW   GCA    PGVY +V+  +DWI
Sbjct:   85 VLGEHDLRRADG-EKKVRVCGVTNHPSYNSRTVDYDFAILTLCDTVTFTEDISPACLPASSSTNYDSRQAVVSGWGTLSTGGSTPTVLHEVTINTMSNSQCTGSSTDYSSSDITGRMLCASAQGKDACQGDSGGPLVTQEAGGYYTVIGVVSW-GFGCADARAPGVYARVTNQLDWI 609          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592762835|gb|GAXK01191578.1| (TSA: Calanus finmarchicus comp41520_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 99.3673 bits (246), Expect = 3.944e-24
Identity = 71/177 (40.11%), Postives = 100/177 (56.50%), Query Frame = 0
Query:    7 IAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEF--TGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDC--SDAYFGSTDET--MICAAAPGKDSCQGDSGGPL-AQDG----TLVGIVSWXXXXXXXXXXXXXXXKVSKFIDWI 172
            +  EHDL    G E+KV V  +T H  + S   +YD  +L L  ++   E + P  LP        +   VVSGWGT+ + G +  VL  VT++ +S+  C  S   + S+D T  M+CA+A GKD+CQGDSGGPL  Q+     T++G+VSW   GCA    PGVY +V+  +DWI
Sbjct:  416 VLGEHDLRRDDG-EKKVRVCGVTNHPSYNSRTVDYDFAILTLCDTVTFTEDISPACLPASSSTNYDSRQAVVSGWGTLSTGGSTPTVLHEVTINTMSNSQCTGSSTDYSSSDITGRMLCASAQGKDACQGDSGGPLVTQEAGGYYTVIGVVSW-GFGCADARAPGVYARVTNQLDWI 940          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592784513|gb|GAXK01170055.1| (TSA: Calanus finmarchicus comp156_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 98.9821 bits (245), Expect = 4.049e-24
Identity = 73/171 (42.69%), Postives = 95/171 (55.56%), Query Frame = 0
Query:    9 AEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKV-KPVALPEKDQEFT--GDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTD--ETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWXXXXXXXXXXXXXXXKVSKFIDWI 172
              H L+    D+  + VSK+  HE + S     D+C+L+L    D +  V   ++LP   +E+    +  VSGWGT    G     L  VTV VVSD+DC  AY G +D  ++MICA   A GKDSCQGDSGGP      L G+VSW   GCA  G+PGVY + S FI W+
Sbjct:  293 GNHHLYEDDPDQMDIAVSKVMLHEDYDSWTIYNDICMLELSGQADFSSSVIGAISLPSDMEEYPVGTECTVSGWGTTSEGGSLGQTLMKVTVPVVSDDDCRGAY-GQSDIADSMICAGLDAGGKDSCQGDSGGPFMCGSQLSGVVSW-GYGCAEAGFPGVYTQTSYFISWL 799          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592885372|gb|GAXK01073003.1| (TSA: Calanus finmarchicus comp811858_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 101.679 bits (252), Expect = 4.301e-24
Identity = 58/151 (38.41%), Postives = 85/151 (56.29%), Query Frame = 0
Query:    5 QXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQE-FTGDV-VVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDG-----TLVGIVSW 148
            + +  EHDL ++   +++V V     H ++ S  + +D  +L L + L    +V PV LP + +  + G V  VSGWGT+ S G     L  V V V+++ +C+ AY G    +MICA   GKDSCQGDSGGPL   G     +L+G+VSW
Sbjct: 1447 EVLVGEHDL-AVDDGQERVAVCSKEEHPEYISATSGHDFSILTLSTPLQFRREVSPVCLPNQPETTYEGAVSTVSGWGTLESGGSQPDKLMEVNVTVITNAECNSAYAGGITNSMICARDDGKDSCQGDSGGPLVTMGGEDFYSLIGVVSW 1896          
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Match: gi|592859852|gb|GAXK01097710.1| (TSA: Calanus finmarchicus comp38035_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 98.2117 bits (243), Expect = 4.508e-24
Identity = 63/148 (42.57%), Postives = 84/148 (56.76%), Query Frame = 0
Query:   11 HDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKV-KPVALPEKDQEFTG--DVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTD--ETMICAAAP--GKDSCQGDSGGPLAQDGT---LVGIVSW 148
            + L+    D+  + VSK+  HE + S   N D+CLL+L    D    V   + LPE+ +++    + +V+GWGT    G    VL  VTV V+SDE+C  AY G +D  ++MICA     GKDSCQGDSGGPL   G    L GIVSW
Sbjct:  194 YHLYEDDPDQVDIAVSKVMLHEDYDSWTINNDICLLELDGQADFGSDVIGGINLPEEGKDYPAGTECIVAGWGTTSEGGSLATVLMKVTVFVLSDEECRGAY-GQSDISDSMICAGVEEGGKDSCQGDSGGPLMCGGLPLELSGIVSW 634          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000000023 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:1582:2451:1 gene:EMLSAG00000000023 transcript:EMLSAT00000000023 description:"augustus_masked-LSalAtl2s1005-processed-gene-0.0")

HSP 1 Score: 345.895 bits (886), Expect = 2.010e-122
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK
Sbjct:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000004828 (pep:novel supercontig:LSalAtl2s:LSalAtl2s254:397245:398159:-1 gene:EMLSAG00000004828 transcript:EMLSAT00000004828 description:"augustus_masked-LSalAtl2s254-processed-gene-4.1")

HSP 1 Score: 304.679 bits (779), Expect = 6.420e-105
Identity = 148/174 (85.06%), Postives = 157/174 (90.23%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ VS ITYHEKF SHGTNYDVCLLKLKSSL  NEKVKP+ALPEKDQEF GDVVVSGWGTI S+GP  PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAE +
Sbjct:   92 EVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAEHQ 264          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000010925 (pep:novel supercontig:LSalAtl2s:LSalAtl2s730:283497:284811:1 gene:EMLSAG00000010925 transcript:EMLSAT00000010925 description:"maker-LSalAtl2s730-augustus-gene-3.19")

HSP 1 Score: 295.819 bits (756), Expect = 7.300e-102
Identity = 145/174 (83.33%), Postives = 154/174 (88.51%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQ + VS ITYHE F SHGTNYDVCLLKLKSSL  NEKVKP+ALPEKDQEF GDVVVSGWGTI S+GP+ PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGK SCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWI E K
Sbjct:   64 EVQVVAGEHDLFSTSGDEQTIDVSDITYHEMFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKXSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIVEHK 236          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000010924 (pep:novel supercontig:LSalAtl2s:LSalAtl2s730:259189:288108:-1 gene:EMLSAG00000010924 transcript:EMLSAT00000010924 description:"maker-LSalAtl2s730-snap-gene-2.5")

HSP 1 Score: 275.404 bits (703), Expect = 1.552e-92
Identity = 146/174 (83.91%), Postives = 154/174 (88.51%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHD FS SGDEQK+ VS ITYHE F +HGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGD VVSGWGTI S+GPS P+LRSVTV +VSDEDCSDAY GSTDETMICAAA GK SCQGDSGGPLAQDGTLVGIVSWG  GCA PGYPGVYGKVS+FIDWI E K
Sbjct:  154 EVQVVAGEHDHFSTSGDEQKIAVSDITYHEMFETHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDAVVSGWGTIYSDGPSSPLLRSVTVQIVSDEDCSDAYPGSTDETMICAAAAGKXSCQGDSGGPLAQDGTLVGIVSWG-RGCAFPGYPGVYGKVSQFIDWIVEHK 326          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000000025 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:6858:7782:-1 gene:EMLSAG00000000025 transcript:EMLSAT00000000025 description:"maker-LSalAtl2s1005-augustus-gene-0.8")

HSP 1 Score: 270.396 bits (690), Expect = 1.962e-91
Identity = 145/174 (83.33%), Postives = 152/174 (87.36%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ V  ITYHE FGS G NYD+CLLKLKSSLDLNEKVKPVALP+KDQEFTGDVVVSGWGTI SNG S PVLRSVTV VVSDE CSDAY+GS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCA PGYPGVY KVS FIDWIA+ K
Sbjct:   92 EVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCATPGYPGVYAKVSMFIDWIAQHK 264          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000002836 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1638:13958:14826:-1 gene:EMLSAG00000002836 transcript:EMLSAT00000002836 description:"maker-LSalAtl2s1638-augustus-gene-0.2")

HSP 1 Score: 254.988 bits (650), Expect = 1.445e-85
Identity = 133/175 (76.00%), Postives = 149/175 (85.14%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            ED+  +A EHD  S+SGDEQK+ VS++  H+KFG++G NYD+CLLKLKSSL LNEKVKPVALPEKDQEFTGDVVVSGWGT+   G S  VLRSVT+ +VSDE CSDAY G TDE+MICA +PGKDSCQGDSGGPL QDGTLVGIVSWG  GCA PGYPG+YGKVSKFIDWIAE K
Sbjct:   76 EDILVVAGEHDFLSMSGDEQKIAVSEMXRHDKFGTYGPNYDICLLKLKSSLALNEKVKPVALPEKDQEFTGDVVVSGWGTVEFGGSSSDVLRSVTLQLVSDEYCSDAYDGHTDESMICAGSPGKDSCQGDSGGPLTQDGTLVGIVSWG-NGCAFPGYPGIYGKVSKFIDWIAEQK 249          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000007886 (pep:novel supercontig:LSalAtl2s:LSalAtl2s464:52646:53754:1 gene:EMLSAG00000007886 transcript:EMLSAT00000007886 description:"maker-LSalAtl2s464-augustus-gene-0.4")

HSP 1 Score: 208.379 bits (529), Expect = 3.161e-67
Identity = 102/175 (58.29%), Postives = 122/175 (69.71%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
             DVQ +   HD  S  G EQ   + KITYHE F S G N D+CLL+++   + N+ VKPV LPEK+   TG+VVVSGWGT+ +NG S PVLR+VT+++V    C   Y G  DE+MICA+  GKDSCQGDSGGPL Q+ TLVGIVSWG  GCA P +PGVY KVS FIDWI E K
Sbjct:   88 NDVQVVVGAHDFNSPEGTEQTQNIVKITYHENFASKGINNDICLLEVEHPFEFNDNVKPVTLPEKEFTPTGEVVVSGWGTLRANGNSSPVLRTVTLNMVPYLRCYINYIGGLDESMICASGKGKDSCQGDSGGPLVQENTLVGIVSWG-IGCAHPWFPGVYTKVSMFIDWIHENK 261          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000004826 (pep:novel supercontig:LSalAtl2s:LSalAtl2s254:382958:388781:1 gene:EMLSAG00000004826 transcript:EMLSAT00000004826 description:"maker-LSalAtl2s254-snap-gene-3.35")

HSP 1 Score: 174.866 bits (442), Expect = 2.631e-53
Identity = 84/158 (53.16%), Postives = 110/158 (69.62%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYP 159
            E+VQ +A EH+L  +SG EQ   VS I YHE + + GTN D+CLLKL+SSL+ N+KV  V LP K+++F G V VSGWG++   G S   LRSV V ++S   C+  Y  + D++M+CA A  KDSCQGDSGGPL +  TLVG+VSWG  GCA+P +P
Sbjct:  105 EEVQIVAGEHNLSKVSGIEQIANVSFIKYHEDYATKGTNNDICLLKLESSLEFNDKVDAVNLPRKNKKFKGKVRVSGWGSVTPGGESSDFLRSVDVKIMSFAKCNLLYLNALDKSMLCAGARRKDSCQGDSGGPLTKKNTLVGVVSWG-IGCASPWFP 261          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000005416 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2918:1117:2218:1 gene:EMLSAG00000005416 transcript:EMLSAT00000005416 description:"maker-LSalAtl2s2918-snap-gene-0.4")

HSP 1 Score: 169.474 bits (428), Expect = 1.943e-52
Identity = 83/174 (47.70%), Postives = 108/174 (62.07%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            ++ + +A +H   S+ G EQ++ V     H  FG+ G N D+C+L L+  L  NE    +    K   F GD V+SGWGT  S  P   V R   V++VS  +C +AY    D++MICAAAPGKDSCQGDSGGP+  DG   G+VSWG  GCAAP YPGVY K+SKF+DW+ E 
Sbjct:   62 KNAKVVAGDHSQLSLEGFEQRIRVKSYVIHPDFGTSGVNNDICILHLEKPLKFNE----LQCLTKIXXFEGDAVISGWGTTYSGAPPSFVXRWAKVNIVSKAECQNAYGSLLDDSMICAAAPGKDSCQGDSGGPMVCDGVQCGVVSWG-YGCAAPKYPGVYTKLSKFMDWVKEN 230          
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Match: EMLSAP00000003510 (pep:novel supercontig:LSalAtl2s:LSalAtl2s191:404984:406519:-1 gene:EMLSAG00000003510 transcript:EMLSAT00000003510 description:"maker-LSalAtl2s191-snap-gene-4.24")

HSP 1 Score: 137.117 bits (344), Expect = 3.629e-40
Identity = 77/171 (45.03%), Postives = 90/171 (52.63%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            EDV  +A EHDL   SGDEQ                                             D+EFTG+ +VSGWG       + PVLR+  + ++S ++C D Y    DETMICA + GKDSCQGDSGGPL Q+G LVGIVSWG   C  P YPGVYGKVSKF DWI
Sbjct:   86 EDVMVVAGEHDLSEKSGDEQT--------------------------------------------DEEFTGEAIVSGWGVRSFGSSTSPVLRATNITLISFDECKDKYGRQFDETMICAGSLGKDSCQGDSGGPLFQNGKLVGIVSWGVF-CGHPSYPGVYGKVSKFHDWI 211          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|136424|sp|P00765.1|TRYP_ASTAS (RecName: Full=Trypsin-1; AltName: Full=Trypsin I)

HSP 1 Score: 157.918 bits (398), Expect = 1.100e-47
Identity = 91/178 (51.12%), Postives = 109/178 (61.24%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDE---TMICAAAP--GKDSCQGDSGGPLAQDGT----LVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            +Q +A E D+    G EQ + VSKI  HE F     + D+ LLKL  SL  N  V P+ALP +    TG+V+V+GWGT    G +  VL+ VTV +VSD +C D Y    DE   +MICA  P  GKDSCQGDSGGPLA   T    L GIVSWG  GCA PGYPGVY +VS  +DWI
Sbjct:   58 LQIVAGELDMSVNEGSEQTITVSKIILHENFDYDLLDNDISLLKLSGSLTFNNNVAPIALPAQGHTATGNVIVTGWGTTSEGGNTPDVLQKVTVPLVSDAECRDDY--GADEIFDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWG-YGCARPGYPGVYTEVSYHVDWI 232          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|136409|sp|P00762.1|TRY1_RAT (RecName: Full=Anionic trypsin-1; AltName: Full=Anionic trypsin I; AltName: Full=Pretrypsinogen I; AltName: Full=Serine protease 1; Flags: Precursor)

HSP 1 Score: 144.436 bits (363), Expect = 2.614e-42
Identity = 79/175 (45.14%), Postives = 101/175 (57.71%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + GDEQ +  +KI  H  + S   N D+ L+KL S + LN +V PVALP          ++SGWG   SNG + P +L+ V   V+S  DC  AY G    +MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA P  PGVY KV  F+ WI +T
Sbjct:   69 IQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWG-YGCALPDNPGVYTKVCNFVGWIQDT 242          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|97537546|sp|P35041.2|TRY7_ANOGA (RecName: Full=Trypsin-7; Flags: Precursor)

HSP 1 Score: 142.51 bits (358), Expect = 2.659e-41
Identity = 72/157 (45.86%), Postives = 100/157 (63.69%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDV--VVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY-FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAE 174
            V V++I  H K+  + T+YD  LL+L+S L  ++ V+PVALPE+D+        +VSGWG+  S   S  +LR+  V  V  E+C +AY   +  + M+CA     GKD+CQGDSGGPL  DG L+G+VSWG  GCA PGYPGVY +V+   +W+ E
Sbjct:  108 VNVARIVEHPKYNEYNTDYDYALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWGSTKSATESNAILRAANVPTVDQEECREAYSHDAITDRMLCAGYQQGGKDACQGDSGGPLVADGKLIGVVSWG-SGCAQPGYPGVYARVAVVRNWVRE 263          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|97537501|sp|P35036.2|TRY2_ANOGA (RecName: Full=Trypsin-2; AltName: Full=Antryp2; Flags: Precursor)

HSP 1 Score: 140.584 bits (353), Expect = 1.648e-40
Identity = 76/159 (47.80%), Postives = 98/159 (61.64%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQ--EFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY--FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            VGV +   H ++  +  +YD  L++L++ L  ++ V+PV LPE ++  E      VSGWG   S   S   LR+  V  VS EDCSDAY  FG   + M+CA     GKD+CQGDSGGPL  DG LVG+VSWG  GCA PGYPGVYG+V+   DW+ E 
Sbjct:  117 VGVLRTVEHPQYDGNTIDYDFSLMELETELTFSDAVQPVELPEHEEPVEPGTMATVSGWGNTQSAVESSDFLRAANVPTVSHEDCSDAYMWFGEITDRMLCAGYQQGGKDACQGDSGGPLVADGKLVGVVSWG-YGCAQPGYPGVYGRVASVRDWVREN 274          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|97537521|sp|P35038.2|TRY4_ANOGA (RecName: Full=Trypsin-4; Flags: Precursor)

HSP 1 Score: 137.117 bits (344), Expect = 4.844e-39
Identity = 71/159 (44.65%), Postives = 99/159 (62.26%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDV--VVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGS--TDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            + V++I  H  +     +YD  LL+L+S L  + KV+P+ALPE+D+     +  +VSGWG+  S   S  +LR+  V  V+ ++C+ AY  S    E M+CA     GKD+CQGDSGGPL  +  L+G+VSWG  GCA PGYPGVY +V+   DWI ET
Sbjct:  115 IHVARIVQHPDYDQETIDYDYSLLELESVLTFSNKVQPIALPEQDEAVEDGIMTIVSGWGSTKSAIESNAILRAANVPTVNQDECNQAYHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAEDKLIGVVSWG-AGCAQPGYPGVYARVAVVRDWIRET 272          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|2851507|sp|P00763.2|TRY2_RAT (RecName: Full=Anionic trypsin-2; AltName: Full=Anionic trypsin II; AltName: Full=Pretrypsinogen II; AltName: Full=Serine protease 2; Flags: Precursor)

HSP 1 Score: 134.035 bits (336), Expect = 3.032e-38
Identity = 72/175 (41.14%), Postives = 99/175 (56.57%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + G+EQ V  +KI  H  F     N D+ L+KL S + LN +V  VALP          ++SGWG   S+G + P +L+ +   ++   DC  +Y G   + M+C      GKDSCQGDSGGP+  +G L GIVSWG  GCA P  PGVY KV  ++DWI +T
Sbjct:   69 IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIQDT 242          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|205371855|sp|P00760.3|TRY1_BOVIN (RecName: Full=Cationic trypsin; AltName: Full=Beta-trypsin; Contains: RecName: Full=Alpha-trypsin chain 1; Contains: RecName: Full=Alpha-trypsin chain 2; Flags: Precursor)

HSP 1 Score: 134.035 bits (336), Expect = 3.451e-38
Identity = 72/175 (41.14%), Postives = 97/175 (55.43%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    E ++  + G+EQ +  SK   H  + S+  N D+ L+KLKS+  LN +V  ++LP          ++SGWG   S+G S P VL+ +   ++SD  C  AY G     M CA     GKDSCQGDSGGP+   G L GIVSWG  GCA    PGVY KV  ++ WI +T
Sbjct:   69 IQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-SGCAQKNKPGVYTKVCNYVSWIKQT 242          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|2499864|sp|Q90629.1|TRY3_CHICK (RecName: Full=Trypsin II-P29; Flags: Precursor)

HSP 1 Score: 134.035 bits (336), Expect = 3.632e-38
Identity = 69/153 (45.10%), Postives = 96/153 (62.75%), Query Frame = 0
Query:   26 SKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            S I  H K+ S   N D+ L+KL S+++ +  ++P+ALP    +   + ++SGWG   SNG + P +L+ +   ++SD++C +AY G     MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA  GYPGVY KV  ++DWI ET
Sbjct:   93 SVIIRHPKYSSITLNNDIMLIKLASAVEYSADIQPIALPSSCAKAGTECLISGWGNTLSNGYNYPELLQCLNAPILSDQECQEAYPGDITSNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-IGCALKGYPGVYTKVCNYVDWIQET 244          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|547699|sp|P35588.1|HYPB_HYPLI (RecName: Full=Hypodermin-B; Short=HB; Flags: Precursor)

HSP 1 Score: 133.65 bits (335), Expect = 5.008e-38
Identity = 79/155 (50.97%), Postives = 90/155 (58.06%), Query Frame = 0
Query:   25 VSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPV-LRSVTVHVVSDEDCSDAYFG---STDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            VS    HEK+ +    YDV LLKL S L     VK + L ++      D VVSGWGTI  N P  PV LRSV V +VS E C    +G   +   TMICA A GKD+CQGDSGGPL     LVG+VSWG  GCA PG+PGVY  VS    WI E 
Sbjct:   99 VSNFKIHEKYDAMIMWYDVALLKLSSKLTYGATVKNIELAKETPPDNADAVVSGWGTIYENYPYMPVQLRSVDVKIVSREVCRSDEYGYGNAIGPTMICAYAVGKDACQGDSGGPLVVGEALVGVVSWG-EGCAYPGFPGVYTDVSVVRSWITEN 252          
BLAST of EMLSAG00000000023 vs. SwissProt
Match: gi|136429|sp|P00761.1|TRYP_PIG (RecName: Full=Trypsin; Flags: Precursor)

HSP 1 Score: 132.494 bits (332), Expect = 7.331e-38
Identity = 71/175 (40.57%), Postives = 99/175 (56.57%), Query Frame = 0
Query:    4 VQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXP-VLRSVTVHVVSDEDCSDAYFGSTDETMICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            +Q    EH++  + G+EQ +  +KI  H  F  +  + D+ L+KL S   LN +V  V+LP        + ++SGWG   S+G S P +L+ +   V+SD  C  +Y G     MIC      GKDSCQGDSGGP+  +G L GIVSWG  GCA    PGVY KV  +++WI +T
Sbjct:   54 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWG-YGCAQKNKPGVYTKVCNYVNWIQQT 227          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: EAA12262.3 (AGAP008293-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 142.51 bits (358), Expect = 1.289e-41
Identity = 72/157 (45.86%), Postives = 100/157 (63.69%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDV--VVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY-FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAE 174
            V V++I  H K+  + T+YD  LL+L+S L  ++ V+PVALPE+D+        +VSGWG+  S   S  +LR+  V  V  E+C +AY   +  + M+CA     GKD+CQGDSGGPL  DG L+G+VSWG  GCA PGYPGVY +V+   +W+ E
Sbjct:  108 VNVARIVEHPKYNEYNTDYDYALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWGSTKSATESNAILRAANVPTVDQEECREAYSHDAITDRMLCAGYQQGGKDACQGDSGGPLVADGKLIGVVSWG-SGCAQPGYPGVYARVAVVRNWVRE 263          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: EAL39600.1 (AGAP008295-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 140.584 bits (353), Expect = 7.986e-41
Identity = 76/159 (47.80%), Postives = 98/159 (61.64%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQ--EFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY--FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            VGV +   H ++  +  +YD  L++L++ L  ++ V+PV LPE ++  E      VSGWG   S   S   LR+  V  VS EDCSDAY  FG   + M+CA     GKD+CQGDSGGPL  DG LVG+VSWG  GCA PGYPGVYG+V+   DW+ E 
Sbjct:  117 VGVLRTVEHPQYDGNTIDYDFSLMELETELTFSDAVQPVELPEHEEPVEPGTMATVSGWGNTQSAVESSDFLRAANVPTVSHEDCSDAYMWFGEITDRMLCAGYQQGGKDACQGDSGGPLVADGKLVGVVSWG-YGCAQPGYPGVYGRVASVRDWVREN 274          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: AHN54286.1 (trypsin 29F, isoform D [Drosophila melanogaster])

HSP 1 Score: 138.658 bits (348), Expect = 4.655e-40
Identity = 77/159 (48.43%), Postives = 98/159 (61.64%), Query Frame = 0
Query:   21 QKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFT--GDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY--FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIA 173
            Q VG+ ++  H KF ++  ++D  LL+L+     N     V LPE+D +      V+VSGWG   S   +  VLRSVTV  VS   C++AY  FGS  + M+CA  P  GKD+CQGDSGGPLA DG L G+VSWG  GCA P YPGVY +VS   DWI+
Sbjct:  105 QLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWIS 262          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: AAF52738.1 (trypsin 29F, isoform C [Drosophila melanogaster])

HSP 1 Score: 138.658 bits (348), Expect = 4.655e-40
Identity = 77/159 (48.43%), Postives = 98/159 (61.64%), Query Frame = 0
Query:   21 QKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFT--GDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY--FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIA 173
            Q VG+ ++  H KF ++  ++D  LL+L+     N     V LPE+D +      V+VSGWG   S   +  VLRSVTV  VS   C++AY  FGS  + M+CA  P  GKD+CQGDSGGPLA DG L G+VSWG  GCA P YPGVY +VS   DWI+
Sbjct:  105 QLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWIS 262          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: EAA12264.2 (AGAP008292-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 137.117 bits (344), Expect = 2.348e-39
Identity = 71/159 (44.65%), Postives = 99/159 (62.26%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDV--VVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGS--TDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            + V++I  H  +     +YD  LL+L+S L  + KV+P+ALPE+D+     +  +VSGWG+  S   S  +LR+  V  V+ ++C+ AY  S    E M+CA     GKD+CQGDSGGPL  +  L+G+VSWG  GCA PGYPGVY +V+   DWI ET
Sbjct:  115 IHVARIVQHPDYDQETIDYDYSLLELESVLTFSNKVQPIALPEQDEAVEDGIMTIVSGWGSTKSAIESNAILRAANVPTVNQDECNQAYHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAEDKLIGVVSWG-AGCAQPGYPGVYARVAVVRDWIRET 272          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: AAF58665.1 (lambdaTry [Drosophila melanogaster])

HSP 1 Score: 134.035 bits (336), Expect = 2.696e-38
Identity = 68/176 (38.64%), Postives = 103/176 (58.52%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            E++  +A   +++  +G +Q++ V +I  H K+ +   +YD  +L L    + N+ V+P+ L ++  +    V V+GWGT    G    VL+ V+V+VV + +C +AY       M+CA     GKD+CQGDSGGPL  + TL+GIVSWG  GCA   YPGVY  V   +DW+ ET
Sbjct:   85 ENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWG-TGCAREKYPGVYCSVPDVLDWLVET 259          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: EAA12590.3 (AGAP008296-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 133.65 bits (335), Expect = 3.948e-38
Identity = 70/159 (44.03%), Postives = 97/159 (61.01%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVV--VSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY--FGSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            V V+++  H K+ S   ++D  LL+L+  L  ++ V+PV LP++D+      +  VSGWG   S   S  VLR+  V  V+ ++C+ AY  FG   + M+CA     GKD+CQGDSGGPL  DG LVG+VSWG  GCA  GYPGVY +V+   DW+ E 
Sbjct:  114 VRVARVVQHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGLPKQDETVKDGTMTTVSGWGNTQSAAESNAVLRAANVPTVNQKECNKAYSEFGGVTDRMLCAGYQQGGKDACQGDSGGPLVADGKLVGVVSWG-YGCAQAGYPGVYSRVAVVRDWVREN 271          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: XP_016768064.1 (PREDICTED: trypsin-7 isoform X2 [Apis mellifera])

HSP 1 Score: 130.954 bits (328), Expect = 2.068e-37
Identity = 69/158 (43.67%), Postives = 91/158 (57.59%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVAL-PEKDQEFTGD-VVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGS-TDETMICAA---APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAE 174
            +  ++I  HE++    +++D+ L+KL+  L  N +V P+ L P  D    G   +V+GWG + SNGP    LR V V +VS+  CS  Y        MICA      GKD+CQGDSGGPL Q   L+GIVSWG  GCA P YPGVY +V+    WI E
Sbjct:   79 IKAAEIIIHERYERRSSDFDIALIKLRKPLVYNSRVGPILLAPIADHYMAGSKAMVTGWGALRSNGPLSTKLRKVQVPLVSNVQCSRLYMNRRITARMICAGYVNVGGKDACQGDSGGPLVQHDKLIGIVSWG-FGCARPSYPGVYTRVTVLRSWITE 235          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: XP_006559112.2 (PREDICTED: trypsin-7 isoform X1 [Apis mellifera])

HSP 1 Score: 131.339 bits (329), Expect = 2.662e-37
Identity = 69/158 (43.67%), Postives = 91/158 (57.59%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVAL-PEKDQEFTGD-VVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGS-TDETMICAA---APGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAE 174
            +  ++I  HE++    +++D+ L+KL+  L  N +V P+ L P  D    G   +V+GWG + SNGP    LR V V +VS+  CS  Y        MICA      GKD+CQGDSGGPL Q   L+GIVSWG  GCA P YPGVY +V+    WI E
Sbjct:   98 IKAAEIIIHERYERRSSDFDIALIKLRKPLVYNSRVGPILLAPIADHYMAGSKAMVTGWGALRSNGPLSTKLRKVQVPLVSNVQCSRLYMNRRITARMICAGYVNVGGKDACQGDSGGPLVQHDKLIGIVSWG-FGCARPSYPGVYTRVTVLRSWITE 254          
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Match: EAA12261.3 (AGAP008294-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 130.183 bits (326), Expect = 7.052e-37
Identity = 69/159 (43.40%), Postives = 98/159 (61.64%), Query Frame = 0
Query:   23 VGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQ--EFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYF--GSTDETMICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            V V+++  H  +     +YD  L++L+S L  ++ V+PV+LP++D+  E     +VSGWG   S   S  +LR+  V  V+ ++C+ AY   G   + M+CA     GKD+CQGDSGGPL  DG LVG+VSWG  GCA PGYPGVY +V+   DW+ E 
Sbjct:  108 VRVARVLEHPNYDDSTIDYDFSLMELESELTFSDVVQPVSLPDQDEAVEDGTMTIVSGWGNTQSAAESNAILRAANVPTVNQKECTIAYSSSGGITDRMLCAGYKRGGKDACQGDSGGPLVVDGKLVGVVSWG-FGCAMPGYPGVYARVAVVRDWVREN 265          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|46398231|gb|AAS91793.1| (intestinal trypsin 2 precursor [Lepeophtheirus salmonis])

HSP 1 Score: 343.584 bits (880), Expect = 2.573e-118
Identity = 171/176 (97.16%), Postives = 171/176 (97.16%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            AEDVQ IAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTI SNGPS PVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAETK
Sbjct:   75 AEDVQIIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIASNGPSSPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAETK 249          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|71534672|emb|CAH61269.1| (putative trypsin [Lepeophtheirus salmonis])

HSP 1 Score: 341.658 bits (875), Expect = 1.303e-117
Identity = 170/176 (96.59%), Postives = 170/176 (96.59%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            AEDVQ IAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVV GWGTI SNGPS PVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAETK
Sbjct:   75 AEDVQIIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVXGWGTIASNGPSSPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAETK 249          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|71534669|emb|CAH61460.1| (trypsin [Lepeophtheirus salmonis])

HSP 1 Score: 316.235 bits (809), Expect = 1.842e-107
Identity = 169/176 (96.02%), Postives = 169/176 (96.02%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            AEDVQ IAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTI SNGPS PVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWI E K
Sbjct:   75 AEDVQIIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIASNGPSSPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIVEHK 249          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|31563322|gb|AAP55759.1| (trypsin 1b [Lepeophtheirus salmonis])

HSP 1 Score: 305.064 bits (780), Expect = 7.535e-103
Identity = 148/174 (85.06%), Postives = 157/174 (90.23%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ VS ITYHEKF SHGTNYDVCLLKLKSSL  NEKVKP+ALPEKDQEF GDVVVSGWGTI S+GP  PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAE +
Sbjct:   91 EVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAEHQ 263          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|19031218|gb|AAL71876.1| (trypsin type 2, partial [Lepeophtheirus salmonis])

HSP 1 Score: 304.679 bits (779), Expect = 9.248e-103
Identity = 148/174 (85.06%), Postives = 157/174 (90.23%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ VS ITYHEKF SHGTNYDVCLLKLKSSL  NEKVKP+ALPEKDQEF GDVVVSGWGTI S+GP  PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAE +
Sbjct:   88 EVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAEHQ 260          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|31563316|gb|AAP55756.1| (trypsin 1a [Lepeophtheirus salmonis] >gi|31563318|gb|AAP55757.1| trypsin 1aii [Lepeophtheirus salmonis] >gi|31563320|gb|AAP55758.1| trypsin 1aiii [Lepeophtheirus salmonis] >gi|31563324|gb|AAP55760.1| trypsin 1a [Lepeophtheirus salmonis] >gi|71534674|emb|CAH61461.1| putative trypsin [Lepeophtheirus salmonis])

HSP 1 Score: 304.679 bits (779), Expect = 9.703e-103
Identity = 148/174 (85.06%), Postives = 157/174 (90.23%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ VS ITYHEKF SHGTNYDVCLLKLKSSL  NEKVKP+ALPEKDQEF GDVVVSGWGTI S+GP  PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAE +
Sbjct:   92 EVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAEHQ 264          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|19031216|gb|AAL71875.1| (trypsin type 1, partial [Lepeophtheirus salmonis])

HSP 1 Score: 304.679 bits (779), Expect = 1.045e-102
Identity = 147/174 (84.48%), Postives = 157/174 (90.23%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ VS ITYHEKF SHGTNYDVCLLKLKSSL  NEKVKP+ALPEKDQEF GDVVVSGWGTI S+GP  PVL++VTV VVSDEDCS+AY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAE +
Sbjct:   90 EVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSBAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAEHQ 262          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|19031222|gb|AAL71878.1| (trypsin type 4, partial [Lepeophtheirus salmonis])

HSP 1 Score: 302.753 bits (774), Expect = 3.554e-102
Identity = 147/174 (84.48%), Postives = 156/174 (89.66%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ VS ITYHEKF SHGTNYDVCLLKLKSSL  NEKV P+ALPEKDQEF GDVVVSGWGTI S+GP  PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAE +
Sbjct:   78 EVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVNPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAEHQ 250          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|19031220|gb|AAL71877.1| (trypsin type 3, partial [Lepeophtheirus salmonis])

HSP 1 Score: 301.982 bits (772), Expect = 1.017e-101
Identity = 146/174 (83.91%), Postives = 157/174 (90.23%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQK+ VS ITYHEKF SHGTNYDVCLLKLKSSL  N+KVKP+ALPEK+QEF GDVVVSGWGTI S+GP  PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWIAE +
Sbjct:   88 EVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNKKVKPIALPEKEQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIAEHQ 260          
BLAST of EMLSAG00000000023 vs. nr
Match: gi|31563314|gb|AAP55755.1| (trypsin 1c, partial [Lepeophtheirus salmonis])

HSP 1 Score: 299.671 bits (766), Expect = 8.904e-101
Identity = 146/174 (83.91%), Postives = 155/174 (89.08%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176
            +VQ +A EHDLFS SGDEQ + VS ITYHE F SHGTNYDVCLLKLKSSL  NEKVKP+ALPEKDQEF GDVVVSGWGTI S+GP+ PVL++VTV VVSDEDCSDAY+GS DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCAAPGYPGVYGKVSKFIDWI E K
Sbjct:   90 EVQVVAGEHDLFSTSGDEQTIDVSDITYHEMFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCAAPGYPGVYGKVSKFIDWIVEHK 262          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1259_size52279-snap-gene-0.10 (protein:Tk02678 transcript:maker-scaffold1259_size52279-snap-gene-0.10-mRNA-1 annotation:"anionic trypsin-1 precursor")

HSP 1 Score: 154.066 bits (388), Expect = 4.366e-46
Identity = 89/174 (51.15%), Postives = 106/174 (60.92%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGT-NYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGD--VVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGST-DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            D++  A EH L +  G EQ   VSKI  HE +G+ G  + DVCLLKL   LDLN KV    LP +  E+  +  +VVSGWGT+ + G S   L SVTV  V D  C D YF  T D++MICA   G DSCQGDSGGPL  DG   G+VSWG  GCA    PGVY + S F+DWI
Sbjct:  200 DLRVNAGEHSLSNSDGTEQLRDVSKIIGHEDYGTPGQFSNDVCLLKLSKPLDLNGKVDAAKLPSQGDEYDSNTKIVVSGWGTLSAGGSSPDTLYSVTVPFVEDSVCDDNYFLETIDDSMICAGEEGVDSCQGDSGGPLTCDGVHCGVVSWG-YGCAGRNQPGVYAQTSYFVDWI 372          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1289_size50518-snap-gene-0.10 (protein:Tk08062 transcript:maker-scaffold1289_size50518-snap-gene-0.10-mRNA-1 annotation:"Trypsin-1")

HSP 1 Score: 149.058 bits (375), Expect = 4.430e-45
Identity = 84/174 (48.28%), Postives = 106/174 (60.92%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHG-TNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGD--VVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAY-FGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            ++  IA EH L +I G EQ   VSKI  HE +G+ G  + D+CLLKL   L+LN++V    LP + +E+  +  +VVSGWGT+ S G S  VL SVTV  V D  C D Y     D++M+CA   G DSCQ DSGGPL  DG   G+VSWG  GC     PGVY + S FI+WI
Sbjct:  102 ELMVIAGEHSLSNIDGTEQLRYVSKIISHEDYGTPGPVSNDICLLKLSEPLELNDEVAATKLPAQGEEYDSNSTMVVSGWGTLSSGGSSPDVLMSVTVPFVEDSVCQDNYPLAIIDDSMLCAGEEGVDSCQEDSGGPLTCDGVHCGVVSWG-SGCGGVNQPGVYAQTSYFINWI 274          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold270_size230592-snap-gene-1.27 (protein:Tk10976 transcript:maker-scaffold270_size230592-snap-gene-1.27-mRNA-1 annotation:"trypsin-like serine proteinase 1")

HSP 1 Score: 144.436 bits (363), Expect = 1.441e-43
Identity = 82/175 (46.86%), Postives = 106/175 (60.57%), Query Frame = 0
Query:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTN-YDVCLLKLKSSLDLNEKVKPVALP---EKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFG-STDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            D Q IA EH+L    G+EQ   V++I  HE +G   T+  D+CLLKL  +LD N  V    +P   + D +    +VVSGWGT+   G S   L SV V  V+D+DC  +Y   + D++MIC+   G DSCQGDSGGP+  DG   GIVSWG   CA+ GYPGVY + S F+DWI
Sbjct:   83 DFQVIAGEHNLRKDEGNEQTREVTEIIMHETYGDPTTHSNDICLLKLDVALDFNGLVDAAPMPTQGQDDYDENTKIVVSGWGTLKPGGSSPDELYSVVVPFVNDDDCRISYGADAIDDSMICSGEEGVDSCQGDSGGPMTCDGAHCGIVSWGVS-CASAGYPGVYVQTSYFVDWI 256          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1142_size59991-snap-gene-0.13 (protein:Tk01292 transcript:maker-scaffold1142_size59991-snap-gene-0.13-mRNA-1 annotation:"trypsin partial")

HSP 1 Score: 141.739 bits (356), Expect = 8.308e-42
Identity = 76/175 (43.43%), Postives = 110/175 (62.86%), Query Frame = 0
Query:    2 EDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFT--GDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFG-STDETMICAAAPGKDSCQGDSGGPLA-QDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            E++   A +H+LF   G EQ +GV+++  HE +       D+C+LK+   L++N+ V+ + LP+  Q +       +SGWG +  +GP+  VL S TV +VSDE+C DAY   +  ++MICA    +DSCQGDSGGP+  +DG + GIVSWG  GC   GYPGV  +VS F+DWI
Sbjct:  156 EELLISAGDHNLFVDEGTEQAMGVAQLVIHEDYDPLTVVNDICILKVDGQLEMNDNVQSLPLPDPMQTYAPGTQATLSGWGYLAVDGPAPDVLYSTTVAIVSDEECKDAYGAENISDSMICAGGGAQDSCQGDSGGPMTCEDGRICGIVSWG-FGCGV-GYPGVNTEVSYFVDWI 328          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold531_size145796-snap-gene-0.21 (protein:Tk12609 transcript:maker-scaffold531_size145796-snap-gene-0.21-mRNA-1 annotation:"Trypsin-1")

HSP 1 Score: 140.969 bits (354), Expect = 1.373e-40
Identity = 83/176 (47.16%), Postives = 103/176 (58.52%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGT-NYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGD--VVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGST-DETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            A D++  A EH L +  G EQ   VSKI  H  +G  G  + D+CLLKL   L+L+  V    LP + +E+  D  ++VSGWGT+ + G S   L SV V  V D  C   Y+    D+TM+CA   G DSCQGDSGGPL  DG   G+VSWG  GCA  G PGVY K S F+DWI
Sbjct:  267 ASDMRVNAGEHSLSNNDGTEQLRDVSKIIGHGSYGIPGRFSNDICLLKLSEPLNLDGMVDAAKLPAQGEEYGSDNTLIVSGWGTLSAGGISPDALHSVVVPFVPDGVCRGNYYLEIIDKTMMCAGKEGVDSCQGDSGGPLTCDGVHCGVVSWG-YGCAGLGQPGVYAKTSYFVDWI 441          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold539_size142544-snap-gene-0.29 (protein:Tk01727 transcript:maker-scaffold539_size142544-snap-gene-0.29-mRNA-1 annotation:"intestinal trypsin 5 precursor")

HSP 1 Score: 128.257 bits (321), Expect = 7.584e-37
Identity = 74/184 (40.22%), Postives = 107/184 (58.15%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGD-EQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNE-KVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTD--ETMICAAAPGKDSCQGDSGGPLA-----QDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            ++++  IA  H L +   + EQK GV +I  HE++ S     D+CLL++    +L + KV+   +P K+++F G   VSGWGT    G S P L+ V V +VS   C +A +G+ +   TM CA   G DSCQGDSGGPL       +  L G+VSWG  GCA  G+PGVY +++ F+ WI + 
Sbjct:   93 SKEIVAIAGRHCLDAHHENGEQKRGVKEIIIHEQWRSSTVENDICLLRVGKKFNLWKGKVREALMPYKNEQFEGRAEVSGWGTTSYGGNSSPSLQVVDVPIVSQRVC-EASYGAENIFSTMFCAGEKGNDSCQGDSGGPLVCIDGFGNKILCGVVSWG-KGCAREGFPGVYTRIASFMPWITKV 274          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold17_size721972-snap-gene-5.11 (protein:Tk09975 transcript:maker-scaffold17_size721972-snap-gene-5.11-mRNA-1 annotation:"hepatopancreas partial")

HSP 1 Score: 123.635 bits (309), Expect = 1.900e-35
Identity = 79/178 (44.38%), Postives = 100/178 (56.18%), Query Frame = 0
Query:    8 AAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQ--EFTGDVVVSGWGTIXSNGP-SXPVLRSVTVHVVSDEDCSDAYFGSTD--ETMICA---AAPGKDSCQGDSGGPLAQDG--TLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            A + D +   G EQ + V  I  H ++ +     D+CLL+LK S   +E V PV LPE  Q  E    V V+G+G     G  +   LR V + VVSDE+C+ AY    +  E+MICA      G D+CQGDSGGP    G  T VG+VSWG  GCA  GYPGV  +VS F+DWI ET
Sbjct:   86 AGDVDTYVNEGTEQHIDVKTIIQHPEYSAQTFANDICLLELKESFVFDENVGPVTLPEPMQPIEAGSSVTVTGYGVTREGGIFTSEFLRKVDLPVVSDEECAAAYVDMNEVIESMICAGDIVNGGIDACQGDSGGPYVITGTNTQVGVVSWG-RGCAEVGYPGVNTEVSYFLDWIQET 262          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold186_size273091-snap-gene-1.33 (protein:Tk00906 transcript:maker-scaffold186_size273091-snap-gene-1.33-mRNA-1 annotation:"PREDICTED: trypsin-7-like")

HSP 1 Score: 116.701 bits (291), Expect = 1.296e-32
Identity = 67/186 (36.02%), Postives = 98/186 (52.69%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTG---DVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAP--GKDSCQGDSGGPL------AQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            + ++  +  + DL     +E++    +I  H  + SH  + D+ L+KL   + L+  V+P+A+ + + E         V+GWG +   GP   +LR V V ++  +DC  AY     +  ICA  P  GKDSCQGDSGGPL           L+GIVS G  GCA   YPGVY KV K+ +WI +T
Sbjct:   94 SRELSIVTGDLDLQRTEPEEKRWKACRIKKHPYYSSHNVDNDIALIKLCKRVPLSYAVQPIAMGDNNPESVSPGQRSTVAGWGVLSEGGPLSTILRYVPVEIIDPQDCQQAYHW-VSKNQICAGLPLGGKDSCQGDSGGPLWWVEPVTHVRRLIGIVSNG-KGCARKHYPGVYTKVGKYFNWIIQT 277          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold329_size204955-snap-gene-1.24 (protein:Tk00277 transcript:maker-scaffold329_size204955-snap-gene-1.24-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_196039")

HSP 1 Score: 113.62 bits (283), Expect = 4.277e-31
Identity = 65/176 (36.93%), Postives = 94/176 (53.41%), Query Frame = 0
Query:   10 EHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALP----EKDQEFTGDVVVS-GWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICA--AAPGKDSCQGDSGGPL------AQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWI 172
            E DL    G  ++  V     H  F  +G   DV + +L   +D +  ++P+ LP     + Q +  ++ V+ GWGT    G     LR V + V ++++C DAYF    E  +CA  A  G+D+CQGDSGGPL           LVG+VS+G   CA PGYPGVY +++ F+DWI
Sbjct:  134 EWDLSDQDGYSEEFRVVDFKAHPNFQPNGFYNDVAVFRLDQPVDFSAHIQPICLPYSQFHRSQSYVNELPVALGWGTTYYGGDEVSKLRGVPLPVWTNKECDDAYFQPITEVFLCAGYADGGRDACQGDSGGPLMLYDEDTNSWMLVGLVSFGNR-CAEPGYPGVYTRITHFMDWI 308          
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold122_size333723-snap-gene-0.17 (protein:Tk04108 transcript:maker-scaffold122_size333723-snap-gene-0.17-mRNA-1 annotation:"plasminogen activator spa")

HSP 1 Score: 112.849 bits (281), Expect = 1.104e-30
Identity = 71/190 (37.37%), Postives = 99/190 (52.11%), Query Frame = 0
Query:    1 AEDVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDL-NEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYF-------GSTDETMICAAAP--GKDSCQGDSGGPLA---QDG--TLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAET 175
            A+ +  +A +H+L +    EQ   V  +  H ++  +    D+ LL+L +   L N +V P+ LP+ +Q      V SGWGT    G    +L  V + ++ +E C   Y        G   + MICA     G+DSCQGDSGGPLA    DG  TL G+VSWG  GCA P  PGVY  V  ++DWIA+ 
Sbjct:  143 ADQIVLVAGDHNLVTFERSEQVSRVKTVKAHLQYNRNSFENDIALLELTTPFHLDNNRVGPICLPQ-EQSSKDLAVASGWGTTEEGGSLPQILNRVGLPILPNELCQGMYESEYPGTGGFVRDGMICAGFENGGRDSCQGDSGGPLACKQSDGSYTLCGLVSWGF-GCARPNLPGVYTDVYDYLDWIADN 330          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000023 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-1.549e-4852.54symbol:Q52V24 "Hepatopancreas trypsin" species:671... [more]
-4.868e-4145.14symbol:Prss1 "Anionic trypsin-1" species:10116 "Ra... [more]
-4.868e-4145.14symbol:Prss1 "protease, serine, 1 (trypsin 1)" spe... [more]
-1.559e-3848.43symbol:Try29F "Trypsin 29F" species:7227 "Drosophi... [more]
-4.975e-3845.10symbol:PRSS2 "Uncharacterized protein" species:903... [more]
-1.811e-3742.29symbol:LOC679835 "similar to Anionic trypsin II pr... [more]
-2.239e-3742.29symbol:LOC100365995 "rCG28262-like" species:10116 ... [more]
-2.239e-3742.29symbol:Try4 "trypsin 4" species:10116 "Rattus norv... [more]
-4.138e-3741.71symbol:LOC683849 "RCG64545" species:10116 "Rattus ... [more]
-4.410e-3741.71symbol:Try10 "Protein Try10" species:10116 "Rattus... [more]

Pages

back to top
BLAST of EMLSAG00000000023 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592778099|gb|GAXK01176469.1|6.059e-2945.25TSA: Calanus finmarchicus comp3490_c0_seq1 transcr... [more]
gi|592757377|gb|GAXK01197036.1|3.670e-2839.77TSA: Calanus finmarchicus comp2639531_c0_seq1 tran... [more]
gi|592778098|gb|GAXK01176470.1|8.849e-2840.76TSA: Calanus finmarchicus comp3490_c3_seq1 transcr... [more]
gi|592765461|gb|GAXK01189107.1|2.682e-2539.13TSA: Calanus finmarchicus comp970163_c0_seq1 trans... [more]
gi|592784512|gb|GAXK01170056.1|3.200e-2543.53TSA: Calanus finmarchicus comp156_c3_seq1 transcri... [more]
gi|592762833|gb|GAXK01191580.1|1.798e-2440.11TSA: Calanus finmarchicus comp41520_c1_seq1 transc... [more]
gi|592762835|gb|GAXK01191578.1|3.944e-2440.11TSA: Calanus finmarchicus comp41520_c0_seq2 transc... [more]
gi|592784513|gb|GAXK01170055.1|4.049e-2442.69TSA: Calanus finmarchicus comp156_c1_seq1 transcri... [more]
gi|592885372|gb|GAXK01073003.1|4.301e-2438.41TSA: Calanus finmarchicus comp811858_c0_seq1 trans... [more]
gi|592859852|gb|GAXK01097710.1|4.508e-2442.57TSA: Calanus finmarchicus comp38035_c0_seq1 transc... [more]

Pages

back to top
BLAST of EMLSAG00000000023 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000000232.010e-122100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:1582... [more]
EMLSAP000000048286.420e-10585.06pep:novel supercontig:LSalAtl2s:LSalAtl2s254:39724... [more]
EMLSAP000000109257.300e-10283.33pep:novel supercontig:LSalAtl2s:LSalAtl2s730:28349... [more]
EMLSAP000000109241.552e-9283.91pep:novel supercontig:LSalAtl2s:LSalAtl2s730:25918... [more]
EMLSAP000000000251.962e-9183.33pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:6858... [more]
EMLSAP000000028361.445e-8576.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1638:1395... [more]
EMLSAP000000078863.161e-6758.29pep:novel supercontig:LSalAtl2s:LSalAtl2s464:52646... [more]
EMLSAP000000048262.631e-5353.16pep:novel supercontig:LSalAtl2s:LSalAtl2s254:38295... [more]
EMLSAP000000054161.943e-5247.70pep:novel supercontig:LSalAtl2s:LSalAtl2s2918:1117... [more]
EMLSAP000000035103.629e-4045.03pep:novel supercontig:LSalAtl2s:LSalAtl2s191:40498... [more]

Pages

back to top
BLAST of EMLSAG00000000023 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|136424|sp|P00765.1|TRYP_ASTAS1.100e-4751.12RecName: Full=Trypsin-1; AltName: Full=Trypsin I[more]
gi|136409|sp|P00762.1|TRY1_RAT2.614e-4245.14RecName: Full=Anionic trypsin-1; AltName: Full=Ani... [more]
gi|97537546|sp|P35041.2|TRY7_ANOGA2.659e-4145.86RecName: Full=Trypsin-7; Flags: Precursor[more]
gi|97537501|sp|P35036.2|TRY2_ANOGA1.648e-4047.80RecName: Full=Trypsin-2; AltName: Full=Antryp2; Fl... [more]
gi|97537521|sp|P35038.2|TRY4_ANOGA4.844e-3944.65RecName: Full=Trypsin-4; Flags: Precursor[more]
gi|2851507|sp|P00763.2|TRY2_RAT3.032e-3841.14RecName: Full=Anionic trypsin-2; AltName: Full=Ani... [more]
gi|205371855|sp|P00760.3|TRY1_BOVIN3.451e-3841.14RecName: Full=Cationic trypsin; AltName: Full=Beta... [more]
gi|2499864|sp|Q90629.1|TRY3_CHICK3.632e-3845.10RecName: Full=Trypsin II-P29; Flags: Precursor[more]
gi|547699|sp|P35588.1|HYPB_HYPLI5.008e-3850.97RecName: Full=Hypodermin-B; Short=HB; Flags: Precu... [more]
gi|136429|sp|P00761.1|TRYP_PIG7.331e-3840.57RecName: Full=Trypsin; Flags: Precursor[more]

Pages

back to top
BLAST of EMLSAG00000000023 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EAA12262.31.289e-4145.86AGAP008293-PA [Anopheles gambiae str. PEST][more]
EAL39600.17.986e-4147.80AGAP008295-PA [Anopheles gambiae str. PEST][more]
AHN54286.14.655e-4048.43trypsin 29F, isoform D [Drosophila melanogaster][more]
AAF52738.14.655e-4048.43trypsin 29F, isoform C [Drosophila melanogaster][more]
EAA12264.22.348e-3944.65AGAP008292-PA [Anopheles gambiae str. PEST][more]
AAF58665.12.696e-3838.64lambdaTry [Drosophila melanogaster][more]
EAA12590.33.948e-3844.03AGAP008296-PA [Anopheles gambiae str. PEST][more]
XP_016768064.12.068e-3743.67PREDICTED: trypsin-7 isoform X2 [Apis mellifera][more]
XP_006559112.22.662e-3743.67PREDICTED: trypsin-7 isoform X1 [Apis mellifera][more]
EAA12261.37.052e-3743.40AGAP008294-PA [Anopheles gambiae str. PEST][more]

Pages

back to top
BLAST of EMLSAG00000000023 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|46398231|gb|AAS91793.1|2.573e-11897.16intestinal trypsin 2 precursor [Lepeophtheirus sal... [more]
gi|71534672|emb|CAH61269.1|1.303e-11796.59putative trypsin [Lepeophtheirus salmonis][more]
gi|71534669|emb|CAH61460.1|1.842e-10796.02trypsin [Lepeophtheirus salmonis][more]
gi|31563322|gb|AAP55759.1|7.535e-10385.06trypsin 1b [Lepeophtheirus salmonis][more]
gi|19031218|gb|AAL71876.1|9.248e-10385.06trypsin type 2, partial [Lepeophtheirus salmonis][more]
gi|31563316|gb|AAP55756.1|9.703e-10385.06trypsin 1a [Lepeophtheirus salmonis] >gi|31563318|... [more]
gi|19031216|gb|AAL71875.1|1.045e-10284.48trypsin type 1, partial [Lepeophtheirus salmonis][more]
gi|19031222|gb|AAL71878.1|3.554e-10284.48trypsin type 4, partial [Lepeophtheirus salmonis][more]
gi|19031220|gb|AAL71877.1|1.017e-10183.91trypsin type 3, partial [Lepeophtheirus salmonis][more]
gi|31563314|gb|AAP55755.1|8.904e-10183.91trypsin 1c, partial [Lepeophtheirus salmonis][more]

Pages

back to top
BLAST of EMLSAG00000000023 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
maker-scaffold1259_size52279-snap-gene-0.104.366e-4651.15protein:Tk02678 transcript:maker-scaffold1259_size... [more]
maker-scaffold1289_size50518-snap-gene-0.104.430e-4548.28protein:Tk08062 transcript:maker-scaffold1289_size... [more]
maker-scaffold270_size230592-snap-gene-1.271.441e-4346.86protein:Tk10976 transcript:maker-scaffold270_size2... [more]
maker-scaffold1142_size59991-snap-gene-0.138.308e-4243.43protein:Tk01292 transcript:maker-scaffold1142_size... [more]
maker-scaffold531_size145796-snap-gene-0.211.373e-4047.16protein:Tk12609 transcript:maker-scaffold531_size1... [more]
maker-scaffold539_size142544-snap-gene-0.297.584e-3740.22protein:Tk01727 transcript:maker-scaffold539_size1... [more]
maker-scaffold17_size721972-snap-gene-5.111.900e-3544.38protein:Tk09975 transcript:maker-scaffold17_size72... [more]
maker-scaffold186_size273091-snap-gene-1.331.296e-3236.02protein:Tk00906 transcript:maker-scaffold186_size2... [more]
maker-scaffold329_size204955-snap-gene-1.244.277e-3136.93protein:Tk00277 transcript:maker-scaffold329_size2... [more]
maker-scaffold122_size333723-snap-gene-0.171.104e-3037.37protein:Tk04108 transcript:maker-scaffold122_size3... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1005supercontigLSalAtl2s1005:1582..2451 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Noteintestinal trypsin 2 precursor [Lepeophtheirus salmonis]
Logic nameensemblgenomes
Descriptionaugustus_masked-LSalAtl2s1005-processed-gene-0.0
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000023 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000023EMLSAT00000000023-695870Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1005:1582..2451+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000023-682789 ID=EMLSAG00000000023-682789|Name=EMLSAG00000000023|organism=Lepeophtheirus salmonis|type=gene|length=870bp|location=Sequence derived from alignment at LSalAtl2s1005:1582..2451+ (Lepeophtheirus salmonis)
GCCGAAGACGTTCAAAYCATTGCTGCTGAACACGATCTCTTCTCTATAAG TGGAGATGAACAAAAGGTTGGTGTATCAAAAATCACCTACCACGAGAAGT TTGGATCCCATGGCACCAACTATGACGTTTGTCTTTTGAAATTGAAGTCC TCCTTGGACCTCAACGAGTAAGAACTTTCTCATACAATTTTTGTTTTTGT CAATAATTGATAACTCTTCATATTTTCTAGGAAAGTCAAGCCWGTTGCTC TCCCAGAAAAGGACCAAGAATTCACTGGTGATGTTGTTGTGTCTGGRTGG GGAACTATCKCCTCCAATGGCCCATCTTSTCCAGTCCTTAGATCAGTTAC CGTCCACGTTGTTTCTGATGAGGGTGAGACTATAATTATATTTTTACCTT GAAAACGAATTTACCTCTGTAATGTTTAATATAATAGACTGTAGCGATGC CTACTTTGGATCTACTGATGAGACCATGATCTGTGCTGCTGCTCCAGGAA AGGACTCCTGCCAAGGTGACTCTGGTGGTCCATTGGCTCAAGATGGAACC TTAGTTGGTATTGTTTCTTGGGGATANNNTGGTTGTGCTGCTCCTGGATA CCCAGGTGTCTACGGCAAGGTCTCCAAGTTTATTGACTGGATCGCTGAAA CAAAATAATTTATTAGGTTATTGATTTTGAACTTTTGAAATATAATATTT TCAAAAAATTGATTGTTTGTTGTATATCTCCAGATGAAATTGACAATAGG TGGAGCAAGGTGGATTCAGTGTAAAACACAGGATAAAATCAAATCAGGAA AACAAATTAAAAAATAAAATGTATAGAAAATGAGTAACAGGACGGGATTA CTTTAAAAAACTTGGGGGGG
back to top
Add to Basket