EMLSAG00000000038, EMLSAG00000000038-682804 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000038 vs. C. finmarchicus
Match: gi|592798741|gb|GAXK01155827.1| (TSA: Calanus finmarchicus comp5837363_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.8834 bits (76), Expect = 1.515e-2 Identity = 17/53 (32.08%), Postives = 30/53 (56.60%), Query Frame = 0 Query: 19 DIEIAAIQSVQQVLPDTYVSTCFFQFNKAVMDQIAKKGAKTLTEQNNWGFHFV 71 D E++ I+SV ++L + CFF F+KA+ ++ + KT E + HF+ Sbjct: 153 DFELSIIKSVDEMLG-VEIDGCFFHFSKALKSKVDRSRFKTRYEMDEKFQHFI 308
BLAST of EMLSAG00000000038 vs. C. finmarchicus
Match: gi|592816689|gb|GAXK01137879.1| (TSA: Calanus finmarchicus comp6461465_c0_seq1 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 2.443e-2 Identity = 16/56 (28.57%), Postives = 32/56 (57.14%), Query Frame = 0 Query: 16 MMLDIEIAAIQSVQQVLPDTYVSTCFFQFNKAVMDQIAKKGAKTLTEQNNWGFHFV 71 ++ D E+ ++S+ ++L +T + CFF K ++ KKG KT E +++ F+ Sbjct: 356 VLCDFELNILKSIDEML-ETDIFGCFFHHKKCFQRKVDKKGFKTRYENDDYFHEFI 520
BLAST of EMLSAG00000000038 vs. C. finmarchicus
Match: gi|592937249|gb|GAXK01021304.1| (TSA: Calanus finmarchicus comp7477627_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 2.904e-2 Identity = 16/50 (32.00%), Postives = 26/50 (52.00%), Query Frame = 0 Query: 16 MMLDIEIAAIQSVQQVLPDTYVSTCFFQFNKAVMDQIAKKGAKTLTEQNN 65 M D E+ SV P C+F F++ V ++ KKG +T+ E+N+ Sbjct: 39 FMCDFELLIRSSVLLYYPSLKTLGCYFHFSQLVWRRVQKKGFQTIYEKND 188
BLAST of EMLSAG00000000038 vs. C. finmarchicus
Match: gi|592848957|gb|GAXK01108587.1| (TSA: Calanus finmarchicus comp9004441_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 9.393e-1 Identity = 12/31 (38.71%), Postives = 16/31 (51.61%), Query Frame = 0 Query: 30 QVLPDTYVSTCFFQFNKAVMDQIAKKGAKTL 60 Q PD C F F KAV +++K G K + Sbjct: 248 QFFPDVKPKGCHFHFAKAVFSKVSKNGLKPV 340
BLAST of EMLSAG00000000038 vs. C. finmarchicus
Match: gi|592872512|gb|GAXK01085050.1| (TSA: Calanus finmarchicus comp4685881_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.816e+0 Identity = 17/68 (25.00%), Postives = 32/68 (47.06%), Query Frame = 0 Query: 16 MMLDIEIAAIQSVQQVLPDTYVSTCFFQFNKAVMDQIAKKGAKTLTEQNNWGFHFVVDYQYPSHTILE 83 ++ D E+ ++S+ V+ + CFF K ++ +KG KT+ E + F+ SH +E Sbjct: 331 VLCDFELNILKSID-VMLQCPILGCFFHHKKCFQRKVDRKGFKTMYENDEHFKSFINQCSSLSHLPIE 531
BLAST of EMLSAG00000000038 vs. L. salmonis peptides
Match: EMLSAP00000000038 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1006:37164:39919:-1 gene:EMLSAG00000000038 transcript:EMLSAT00000000038 description:"snap_masked-LSalAtl2s1006-processed-gene-0.11") HSP 1 Score: 184.882 bits (468), Expect = 7.790e-62 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 0 Query: 1 MWSIIKEYVGHGPSEMMLDIEIAAIQSVQQVLPDTYVSTCFFQFNKAVMDQIAKKGAKTLTEQNNWGFHFVVDYQYPSHTILELDVC 87 MWSIIKEYVGHGPSEMMLDIEIAAIQSVQQVLPDTYVSTCFFQFNKAVMDQIAKKGAKTLTEQNNWGFHFVVDYQYPSHTILELDVC Sbjct: 1 MWSIIKEYVGHGPSEMMLDIEIAAIQSVQQVLPDTYVSTCFFQFNKAVMDQIAKKGAKTLTEQNNWGFHFVVDYQYPSHTILELDVC 87 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000038 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000038 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 5
BLAST of EMLSAG00000000038 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000038 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000038 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000038 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000038 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1006:37164..39919- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000038-682804 ID=EMLSAG00000000038-682804|Name=EMLSAG00000000038|organism=Lepeophtheirus salmonis|type=gene|length=2756bp|location=Sequence derived from alignment at LSalAtl2s1006:37164..39919- (Lepeophtheirus salmonis)back to top Add to Basket
|