EMLSAG00000000097, EMLSAG00000000097-682863 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000097
Unique NameEMLSAG00000000097-682863
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:DDB_G0295485 "EGF-like domain-containing protein" species:44689 "Dictyostelium discoideum" [GO:0008150 "biological_process" evidence=ND] [GO:0005575 "cellular_component" evidence=ND] [GO:0016020 "membrane" evidence=IEA] [GO:0007596 "blood coagulation" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005201 "extracellular matrix structural constituent" evidence=IEA] [GO:0004888 "transmembrane signaling receptor activity" evidence=IEA] InterPro:IPR000742 InterPro:IPR001491 InterPro:IPR001881 InterPro:IPR002909 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF01833 Pfam:PF07645 PRINTS:PR00907 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 dictyBase:DDB_G0295485 InterPro:IPR000152 GO:GO:0007165 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0016020 GO:GO:0005509 GO:GO:0007596 GO:GO:0005578 InterPro:IPR014756 SUPFAM:SSF81296 InterPro:IPR013032 GO:GO:0004888 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 EMBL:AAFI02000080 GO:GO:0005201 KO:K17307 PANTHER:PTHR24039 RefSeq:XP_001733016.1 ProteinModelPortal:B0G154 EnsemblProtists:DDB0235380 GeneID:8625292 KEGG:ddi:DDB_G0295485 OMA:QVCTNSA ProtClustDB:CLSZ2497268 PRO:PR:B0G154 Uniprot:B0G154)

HSP 1 Score: 418.313 bits (1074), Expect = 5.182e-119
Identity = 283/702 (40.31%), Postives = 369/702 (52.56%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGT---ACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C  +C    G +  C C+ G+ L  D + C D++EC  +   C+ +CTN  G++ C C  G+ S GT    C DINEC  NNG   C   C N  G + C C    G  L   D  TC     C  NNGGC+  C +S     C C  GY L  D KTC DINEC    I     C N  GS  C C SGY   G  C DI+EC T +  C   C N+ G   C+C +G+ L  D+  C D +EC  +NGGC QVC N  G+F C C  G+ L+TD  TCTD+NEC     N G    C N+ GSF C C+ GF L  +  SC DINEC +  +CG+ +C N+ G+Y+C C SGY F  S C+DI+EC +  CG   C N    Y CSC SGY    + C D DEC  DN  G    C N  GSF C C  G+   +    C DINE   +++ CG   +C N+ GS++C C  G+    +    CID DEC +     S+ C N++G F C C++G+ L+     +C+DI+EC  NNG C Q C NI GS  C C  G+  ++    C   DEC  +   NG C Q+CIN  G  +C CN G+ ++ Q+ + C D +EC  NNG CQH C N  G   CSC+ G+  ++ N +KC     CS +NGGC  +C  T S     C C SGF L  +  +C  I
Sbjct:  367 CNQVCTNSAG-SFACSCNSGYSLGTDKKTCADINECSTNNGGCNQVCTNSAGSFSCSCNSGY-SLGTDQKTCADINECSTNNGG--CNQICTNSVGSFSCSCN--SGYSLG-TDKKTCTDINECSTNNGGCNQVCTNSAGSFSCSCNQGYLLGTDQKTCADINEC-DQKICGTANCTNTVGSYQCSCPSGYSFTGSSCVDIDECSTNNGGCAQVCTNSAGGFSCSCNSGYILSTDKKNCNDINECSTNNGGCSQVCTNSAGSFSCSCNSGYLLSTDKKTCTDKNECLTN--NGGCTQVCTNSVGSFSCSCNSGFILNSNKLSCDDINEC-DQKICGTANCTNIPGSYQCSCPSGYSFTGSGCIDIDECDQKICGTANCTNSPGSYQCSCPSGYSFTGSSCIDIDECSADNG-GCSQICTNSVGSFSCSCNSGFTLNSNKLSCDDINE--CDQNICGT-ANCANSPGSYQCSCPNGYSFTGSG---CIDIDECSTDNGGCSQICTNSVGSFSCSCDSGYTLNVDNKKSCDDIDECISNNGGCDQKCANIPGSFGCYCNSGFALNKNNKTCDDIDECSTN---NGDCGQICINQIGSYQCSCNLGFTLN-QNNKNCDDIDECLTNNGDCQHVCKNLQGSFQCSCNSGYLLNQDN-KKCDDIDECSTDNGGCIQVC--TNSVGSFSCSCNSGFTLNENKLSCDDI 1043          

HSP 2 Score: 410.223 bits (1053), Expect = 2.193e-116
Identity = 297/833 (35.65%), Postives = 393/833 (47.18%), Query Frame = 0
Query:  405 SRPSCDPDVQE----KKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE-GDD---CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGYV---DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQND-------------------SNI------------------CIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDER---------------------------------------GNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI------GGICSSAPRPSNGYYRCNKKKVSGYFVK 1135
            + PSC  D+ E       C H C    G + TC C  G+ LN D + C D++EC  +   C+ +CTN  G++ C CR G+T  +    CVDINEC  NNG   C   C N  G + C C    G  L + D  +C     C  NNGGC+  C +S     C C  GY L  D KTC DINEC T +  C   C N  GS  C C+SGY  G D   C+DINEC T +  C+  C N+ GS  C+C +G+ L  D+  C D +EC  +NGGC Q+C N  G+F C C  G+ L TD  TCTD NEC+     C     C N+ GSF C C+ G+ L  D  +C DINEC +  +CG+ +C N  G+Y+C C SGY F  S+C+DI+EC  N  G  + C N + G+SCSC+SGY+   D  N C D +EC  +N  G    C N  GSF C C  GY        C D NE       C     C N+ GSF C C+ GFI + N                    +NI                  CID DEC    C  + C N+ G ++C C +G++ +    ++C DI+EC+ +NG CSQ+C N +GS  C C  G+  +                                           C   DEC      NGGC Q+C N  G   C C+ GY ++  + + C D +EC  NNGGC   C N  G   C C+ GF  + KN + C     CS NNG C  IC +      ++C C  GF L  + + C  I       G C    +   G ++C+    SGY + 
Sbjct:  186 TAPSC-TDINECSTSNGGCAHNCANTAG-SFTCSCRAGYTLNSDKKSCTDINECSTNNGGCNQVCTNSAGSFACSCRAGYTLGTDKKTCVDINECSTNNGG--CAHNCANTAGSFTCSC--RAGYTL-NSDKKSCTDINECSTNNGGCNQVCTNSAGSFACSCNAGYSLGTDKKTCTDINECSTNNGGCNQVCTNSAGSFACSCNSGYSLGTDKKTCADINECSTNNGGCNQVCTNSAGSFSCSCNSGYSLGTDQKTCADINECSTNNGGCNQICTNSVGSFSCSCNSGYSLGTDKKTCTDINECSTNNGGCNQV--CTNSAGSFSCSCNQGYLLGTDQKTCADINEC-DQKICGTANCTNTVGSYQCSCPSGYSFTGSSCVDIDECSTNNGGCAQVCTNSAGGFSCSCNSGYILSTDKKN-CNDINECSTNNG-GCSQVCTNSAGSFSCSCNSGYLLSTDKKTCTDKNECLTNNGGCTQV--CTNSVGSFSCSCNSGFILNSNKLSCDDINECDQKICGTANCTNIPGSYQCSCPSGYSFTGSGCIDIDECDQKICGTANCTNSPGSYQCSCPSGYSFT---GSSCIDIDECSADNGGCSQICTNSVGSFSCSCNSGFTLNSNKLSCDDINECDQNICGTANCANSPGSYQCSCPNGYSFTGSGCIDIDEC---STDNGGCSQICTNSVGSFSCSCDSGYTLNVDNKKSCDDIDECISNNGGCDQKCANIPGSFGCYCNSGFALN-KNNKTCDDIDECSTNNGDCGQICINQIG--SYQCSCNLGFTLNQNNKNCDDIDECLTNNGDCQHVCKNLQGSFQCSCN--SGYLLN 993          

HSP 3 Score: 340.887 bits (873), Expect = 6.861e-94
Identity = 254/667 (38.08%), Postives = 326/667 (48.88%), Query Frame = 0
Query:  531 TCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE-GDD---CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGY-KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNEC-------------------------TINNGGC------------QHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIG----GICSSAP-RPSNGYYRCNKKKVSGYFVKGTKC 1139
            +C     C  +NGGC+H C ++     C C  GY L+ D K+C DINEC T +  C   C N  GS  C C +GY  G D   C DINEC T +  C HNC NT GS  C+C+AG+ L  D+  C D +EC  +NGGC QVC N  G+F C C  G+ L TD  TCTD NEC+     C     C N+ GSF C C+ G+ L  D  +C DINEC+ +    +  C N  G++ C C+SGY       TC DINEC  N  G  + C N    +SCSC+SGY +  D   C D +EC  +N  G    C N  GSF C C  GY        C DINE   ++  CG   +C N  GS++C C  G+    +    C+D DEC ++    ++ C N+ GGF C C +G+ LS    N C DINEC+ NNG CSQVC N  GS  C C  GY    ++  C  K+EC  +   NGGC Q+C N  G   C CN G+I++S +   C D NEC                         +    GC               C N  G + CSC  G+         C+    CS +NGGCS IC  T S     C C SGF L ++  +C  I      IC +A    S G Y+C+     GY   G+ C
Sbjct:  189 SCTDINECSTSNGGCAHNCANTAGSFTCSCRAGYTLNSDKKSCTDINECSTNNGGCNQVCTNSAGSFACSCRAGYTLGTDKKTCVDINECSTNNGGCAHNCANTAGSFTCSCRAGYTLNSDKKSCTDINECSTNNGGCNQVCTNSAGSFACSCNAGYSLGTDKKTCTDINECSTNNGGCNQV--CTNSAGSFACSCNSGYSLGTDKKTCADINECSTNNGGCNQVCTNSAGSFSCSCNSGYSLGTDQKTCADINECSTNNGGCNQICTNSVGSFSCSCNSGYSLGTDKKTCTDINECSTNNG-GCNQVCTNSAGSFSCSCNQGYLLGTDQKTCADINE--CDQKICGT-ANCTNTVGSYQCSCPSGYSFTGSS---CVDIDECSTNNGGCAQVCTNSAGGFSCSCNSGYILSTDKKN-CNDINECSTNNGGCSQVCTNSAGSFSCSCNSGYLLSTDKKTCTDKNECLTN---NGGCTQVCTNSVGSFSCSCNSGFILNS-NKLSCDDINECDQKICGTANCTNIPGSYQCSCPSGYSFTGSGCIDIDECDQKICGTANCTNSPGSYQCSCPSGYS---FTGSSCIDIDECSADNGGCSQIC--TNSVGSFSCSCNSGFTLNSNKLSCDDINECDQNICGTANCANSPGSYQCSCPN--GYSFTGSGC 834          

HSP 4 Score: 305.449 bits (781), Expect = 1.352e-82
Identity = 222/599 (37.06%), Postives = 292/599 (48.75%), Query Frame = 0
Query:  601 CDSGYEGD--DCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPC---------------------------------------GPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGY-KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACS---VNNGGCSHICKSTESGLHHRCMCPSGFKLK----TDARTC-KPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKC 1139
            C SGY G    C+DINEC T +  C HNC NT GS  C+C+AG+ L  D+  C D +EC  +NGGC QVC N  G+F C C+ G+ L TD  TC D NEC+    N G   +C NT GSF C C  G+ L  D  SC DINEC+ +    +  C N  G++ C C++GY       TC DINEC  N  G  + C N +  ++CSC+SGY +  D   C D +EC  +N  G    C N  GSF C C  GY        C DINE S     C                                       G +  C N+ GSF C C+QG++    D   C D +EC    C  + C NT+G ++C C +G++ +    ++C DI+EC+ NNG C+QVC N  G   C C  GY    ++ NC   +EC  +   NGGC Q+C N  G   C CN GY++ S D + C DKNEC  NNGGC   C N +G  +CSC+ GF  +  N   C     C         C++I  S      ++C CPSG+        D   C + I G  +    P  G Y+C+    SGY   G+ C
Sbjct:  179 CPSGYTGTAPSCTDINECSTSNGGCAHNCANTAGSFTCSCRAGYTLNSDKKSCTDINECSTNNGGCNQVCTNSAGSFACSCRAGYTLGTDKKTCVDINECSTN--NGGCAHNCANTAGSFTCSCRAGYTLNSDKKSCTDINECSTNNGGCNQVCTNSAGSFACSCNAGYSLGTDKKTCTDINECSTNNGGCNQVCTNSAGSFACSCNSGYSLGTDKKTCADINECSTNNG-GCNQVCTNSAGSFSCSCNSGYSLGTDQKTCADINECSTNNGGCNQICTNSVGSFSCSCNSGYSLGTDKKTCTDINECSTNNGGCNQVCTNSAGSFSCSCNQGYLLGT-DQKTCADINECDQKICGTANCTNTVGSYQCSCPSGYSFT---GSSCVDIDECSTNNGGCAQVCTNSAGGFSCSCNSGYILSTDKKNCNDINECSTN---NGGCSQVCTNSAGSFSCSCNSGYLL-STDKKTCTDKNECLTNNGGCTQVCTNSVGSFSCSCNSGFILN-SNKLSCDDINECDQKICGTANCTNIPGS------YQCSCPSGYSFTGSGCIDIDECDQKICGTANCTNSP--GSYQCSCP--SGYSFTGSSC 755          

HSP 5 Score: 206.453 bits (524), Expect = 4.543e-52
Identity = 150/397 (37.78%), Postives = 196/397 (49.37%), Query Frame = 0
Query:  756 YECKCDSGYIFHNSTCLDINECIRN--PCGHGECINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIG----GICSSAP-RPSNGYYRCNKKKVSGYFVKGTKC 1139
            Y   C SGY     +C DINEC  +   C H  C N +  ++CSC +GY ++ D   C D +EC  +N  G    C N  GSF C C  GY        C DINE S     C  +  C N  GSF C C  G+  +  D   C D +EC  ++   +  C N+ G F C C  G++L      TC DINEC+ NNG C+QVC N  GS  C C  GY    ++  C   +EC  +   NGGC Q+C N  G   C CN GY + + D + C D NEC+ NNGGC   C N +G  +CSC+ G+     + + C     CS NNGGC+ +C  T S     C C  G+ L TD +TC  I      IC +A    + G Y+C+    SGY   G+ C
Sbjct:  175 YSAVCPSGYTGTAPSCTDINECSTSNGGCAH-NCANTAGSFTCSCRAGYTLNSDKKSCTDINECSTNNG-GCNQVCTNSAGSFACSCRAGYTLGTDKKTCVDINECSTNNGGCAHN--CANTAGSFTCSCRAGYTLNS-DKKSCTDINECSTNNGGCNQVCTNSAGSFACSCNAGYSLGTD-KKTCTDINECSTNNGGCNQVCTNSAGSFACSCNSGYSLGTDKKTCADINECSTN---NGGCNQVCTNSAGSFSCSCNSGYSLGT-DQKTCADINECSTNNGGCNQICTNSVGSFSCSCNSGYSLG-TDKKTCTDINECSTNNGGCNQVC--TNSAGSFSCSCNQGYLLGTDQKTCADINECDQKICGTANCTNTVGSYQCSCP--SGYSFTGSSC 556          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:frac "faulty attraction" species:7227 "Drosophila melanogaster" [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0007412 "axon target recognition" evidence=IMP] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 EMBL:AE014296 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR000436 Pfam:PF00084 SMART:SM00032 SUPFAM:SSF57535 PROSITE:PS50923 GO:GO:0007412 InterPro:IPR009030 SUPFAM:SSF57184 GeneTree:ENSGT00740000115224 InterPro:IPR003410 Pfam:PF02494 PROSITE:PS50825 UniGene:Dm.9540 GeneID:38850 KEGG:dme:Dmel_CG7526 CTD:38850 FlyBase:FBgn0035798 EMBL:BT133156 RefSeq:NP_001137905.1 RefSeq:NP_648137.3 RefSeq:NP_996014.2 SMR:Q9VS89 MINT:MINT-773988 EnsemblMetazoa:FBtr0290277 EnsemblMetazoa:FBtr0301221 EnsemblMetazoa:FBtr0301222 UCSC:CG7526-RA InParanoid:Q9VS89 OMA:NLRSVVW GenomeRNAi:38850 NextBio:810703 Uniprot:Q9VS89)

HSP 1 Score: 290.812 bits (743), Expect = 3.482e-78
Identity = 241/715 (33.71%), Postives = 327/715 (45.73%), Query Frame = 0
Query:  521 GTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ--CLNKCMNVPGSAYC------------------------------------KCDSGYE----GDDCSDINECET---QDL----ICDHNCINTEGSAHCTCKAGFDLMDETE------CFDKDECEMDNGGCEQVCNNL-EGTFQCGCKPGFHLNTDNLTC-TDENECTI--GIANCGIYGDCINTPG--SFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-----NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQG----------------FIHDQNDS-----NICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECT-INNGGCQHACINKLGGHTCSCHLGF---------------------------KPDEKNP-------EKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            G  L   D  +C+  + C  +NGGCS  C +   +  C C +GY LDE  K+CVDINEC   ++   C   C N+PGS  C                                     C+SG++    G DC DINECE    +DL    +C   C NT GS  CTC  G+ L+++        C D +  +++   C   C +L EG+++C C  G+ L+ D  +C   E+ C+   G+  C   G C+ +    SF C C  G+     SC DI+EC   T   S +C N  G Y+C+C  G  +    TCL  N C  N  G  +    + G  C+C  G+ +  D   C D DECL +N  G    C N PGS+ C CA GYE        G C DI+E S     C     C N +GS+ C+C  G                FI D   S     + C+D DEC   +  C H  C+N  GGF+C C  G+ALSE +  TC+DI+EC  +NG CSQ+C+N  G   C C  G++    G  C   DEC    +  G C  +CIN+ G   C C  GY + ++D   C+D +EC  + +GGC H CINK G   C C LG+                            P E NP       +KCV    C   NGGCSH C +TE     +C CP G++L +D +TC+ I
Sbjct:  279 GYTLDPNDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSP-GTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNG-GCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHF-CQNEPGGFQCACPLGYALSEDM-RTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDEC---SQDYGNCSDICINLLGTHACACERGYEL-AKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSF--KCSCPPGYELDSDQKTCQDI 983          

HSP 2 Score: 270.396 bits (690), Expect = 8.806e-72
Identity = 237/722 (32.83%), Postives = 324/722 (44.88%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPEL---CDHICTNKPGTYMC------------------------------------DCRLGF--TSQGTACVDINECLLN-----NGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISD-----EACQVNNGGCSHECIHSYNQIF-CLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPG---------SAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME-----DSCMDINECTNSTLCGSGS--CNNLEGTYECKCDSGYIF------------------------HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDVDNV--CRDYDECLHDNPCGVGGKCN----NKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC---LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGC-QHACINKLGGHTC 1045
            C C +G++L++ G+ C D++EC + PEL   C   C N PG+Y C                                     C  GF  ++ GT C DINEC ++     + +  CQ +C+N  G ++C C  + G  L + D  +C  D     E  Q+N   C+HEC       + C+CP GYEL ED  +C+ + E      + + KC   PG         S  C C +GY  E   C DI+EC     +C H C NT G   C C  G +L++E  C  ++ CE++N GCEQ+C    G   C C+ GF L+ D  +C D +EC +   N G    C N PGS+ C C  G+EL++       C DI+EC+  T   S    C NL G+Y C C  GY                             TCLDI+EC      C H  C NE  G+ C+C  GY   +++  C+D DECL  N     G+C+    N+PG F C C  G+E       C DI+E S +   C     C+N  G+  C C +G+     D   C+D DEC   LS  C H EC N  G FEC C  G+ L++   +    +  C       +  C  I       C  GY       C   DEC   ++ NGGC   C N  G  KC C PGY +DS D + C D +EC  +   C    CIN++GG  C
Sbjct:  316 CSCQEGYYLDESGKSCVDINECAN-PELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTC--VEGYHLLE-DQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCL-VQESPCSTEKGVEKCS--PGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGV-CACREGFRLSADGKSCEDVDECLVN--NGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHF-CQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSN-----GQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCS--DICINLLGTHACACERGY-ELAKDKLSCLDVDECAGLLSGGCSH-ECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPI------ECNPGYTLGSDDKCVDIDEC---QKQNGGCSHRCSNTEGSFKCSCPPGYELDS-DQKTCQDIDECDQDKTSCITGTCINEIGGFRC 1007          

HSP 3 Score: 214.927 bits (546), Expect = 1.032e-54
Identity = 154/418 (36.84%), Postives = 211/418 (50.48%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGT-----ACVDINECLLNNGHGPCQDE--CKNVDGGYQCECGGLPGTQLSDKDN---------------------HTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECE-MDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL-MEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRN--PCGHGECINESPGYSC 796
            CE IC   +G    C C +GF L+ DG+ CEDVDEC+ +   C  +C N PG+Y C C  G+           C DI+EC     HG C D+  C+N++G Y C C   PG  L   ++                     HTC+  + C + NG CSH C +      C CP GY L ED +TC DI+EC+  + QC   C+N PG   C C++G+E    G  C+DI+EC      C   CIN  G+  C C+ G++L  D+  C D DEC  + +GGC   C N  GTF+CGC  G+ LN D  +C+        +  C   G   +  G    EC+PG+ L  +D C+DI+EC       S  C+N EG+++C C  GY   +   TC DI+EC ++   C  G CINE  G+ C
Sbjct:  603 CEQICLTARGGV--CACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECS-QRTHG-CSDQMLCENLNGSYTCLCP--PGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSP------ALVGCPP-GTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRC 1007          

HSP 4 Score: 196.438 bits (498), Expect = 4.832e-49
Identity = 154/482 (31.95%), Postives = 212/482 (43.98%), Query Frame = 0
Query:  432 TCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTY---------------------------------------MCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE--CIHSYNQIFCLCPDGYELDED----------------------WKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTL-CGSGSCNNLEGTYECKCDSGYIF-HNSTCLDINECIRN--PCGHGECINESPGYSCSCHSGY-VDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCD 837
            +C C  G+  ++   C+D+DEC +D  LC H C N PG Y                                       +C CR GF  ++ G +C D++ECL+NNG   CQ  C+N+ G Y C C         D     C   + C     GCS +  C +      CLCP GY L  D                        TC+DI+EC   +  C + C N PG   C C  GY   +    C DI+EC   +  C   C+N  G   C C+ GF+L  D   C D DEC  D G C  +C NL GT  C C+ G+ L  D L+C D +EC  G+ + G   +CIN  G+F C C  G+ L +D       C+ + + C  G+  + +G    +C+ GY    +  C+DI+EC +    C H  C N    + CSC  GY +D D   C+D DEC  D    + G C N+ G F C+
Sbjct:  536 SCICPTGY-RSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGG--CQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLDVDECA-GLLSGGCSHECINKAGTFECGCPLGYILNDDG----RSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSH-RCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRCE 1008          

HSP 5 Score: 194.512 bits (493), Expect = 2.329e-48
Identity = 177/567 (31.22%), Postives = 241/567 (42.50%), Query Frame = 0
Query:  636 CTCKAGFDL--MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC------------------------------------ECHPGFELMEDS--CMDINECT--------NSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINECIRNP------CGHGECINESPG-YSCSCHSGYVDVDNVCRDYDECL-HDNPCGV-GGKCNNKPG---------SFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDE----RGNCFLKDECRLSRRPNG-GCQQLCINIPGGLKCECNPGYIV---------------------DSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C C+ G+ L   D   C D DEC   NGGC ++C NL G ++C C+ G++L+    +C D NEC     +    G C N PGS+ C                                     C+ GF+L  D   C DINEC         N+ +C    C N  G++ C C  GY       S  LD    + NP      C H EC +   G Y C C  GY     +  D   CL  ++PC    G     PG         SF C C  GY  +   C DI+E + +   C     C N  G ++C C +G    +  + +  +  E  ++ C    C    GG  C C  GF LS     +CED++EC +NNG C QVC N+ GS+ C C  GY+  +    RG CF  DEC  S+R +G   Q LC N+ G   C C PGY +                     ++     C+D +EC++ NG C H C N+ GG  C+C LG+   E +   C     C  +NG CS +C +   G    C C +GF+L  D   C  I
Sbjct:  274 CDCREGYTLDPNDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVC-QQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAH-ECQDLPEGSYRCVCPKGY----ELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCS--HTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGC-EQICLTARGGV-CACREGFRLSAD-GKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDEC--SQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSE-DMRTCQDIDECLDSNGQCSQLCLNQPGGF--ACACETGFELTPDGFGCADI 824          

HSP 6 Score: 101.679 bits (252), Expect = 5.201e-20
Identity = 72/254 (28.35%), Postives = 103/254 (40.55%), Query Frame = 0
Query: 1110 ICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMN---------CPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEW---KRIRVNP-------PKCNPTFN----------------RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIP 1328
            +C     P NG   CN+ +        ++C++ C  G++  G   + C  NG W G E   C  +N         CP L P  NG I P +C    S  G  C   CN G+  TG   T C  L  W     +   P        + +P +N                RP I+CP +++  L    +  +V + +P+TNV   R V + P WA  L+G +  G H V FR   P   K +  C  +I VK   P
Sbjct: 1109 LCPRFQAPRNGKSHCNRYRHKQKLFYYSRCRISCNSGYILQGPEIKSCDANGIWEGPETK-CVAINQPRAQSPGICPALKPAQNGVILPASCTQGPSRFGDVCRLQCNAGFVSTGSLLTACMMLQGWSFGADLNCQPFGNGLLGNQLSPMWNSPKTVTPHQIQNVEQIRPYINCPENVVILLHAGEQKAHVTLQRPQTNVKNGRLV-AHPAWAGQLQGHLPAGVHKVDFRVNDPET-KLTIKCHTIITVKAATP 1359          

HSP 7 Score: 51.9878 bits (123), Expect = 5.608e-5
Identity = 26/76 (34.21%), Postives = 36/76 (47.37%), Query Frame = 0
Query: 1330 TVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLK 1405
            T   CP S   YL   Q ++ + W+EP F+   K+  +  S  PG  F  G H I Y A+  DG    C F I ++
Sbjct: 1464 TSNYCPPSIEVYLKENQNLRSVVWDEPRFEG--KLLKIYKSHFPGSLFKVGDHAIKYEATTTDGKTLSCTFFIYVR 1537          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:FBN3 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0005201 "extracellular matrix structural constituent" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF07645 PIRSF:PIRSF036312 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 GO:GO:0005578 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 GO:GO:0005201 Gene3D:3.90.290.10 InterPro:IPR017878 PANTHER:PTHR24039 Pfam:PF00683 SUPFAM:SSF57581 PROSITE:PS51364 OrthoDB:EOG7RV9F6 TreeFam:TF316849 GeneTree:ENSGT00740000114996 CTD:84467 EMBL:AADN03008932 RefSeq:XP_418173.4 UniGene:Gga.5009 Ensembl:ENSGALT00000000433 GeneID:395079 KEGG:gga:395079 Uniprot:E1C5P6)

HSP 1 Score: 270.396 bits (690), Expect = 2.163e-71
Identity = 261/760 (34.34%), Postives = 348/760 (45.79%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH--ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDE-TECFDKDEC----EMDNGGCEQ-----------VCNNLEG----------------TFQCGCKPGF-HLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDEC---LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPC-FHSECKNTLGGFECLCETGFALS---EILP--------NTC----------EDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            CEC  G+ L+  G C   +EC + P +C H  C +  G+Y+C C  GF + G  T C+DI+EC       PC +  CKN  G Y C C   PG +L+   N+ C+  + C    G      +CI+S     CLC +GY+   D K CVDINECV+    C    C N+ GS  C C  GYE   D+C DINECE +  IC    C NT GS  C C  GF L D    CFD  +       DNG C              C+ + G                 FQ  C  G   +     T  D NEC+  +  C I G CINT GSF CEC  G+ L     +C+D +EC+    CG+G+C N+ G +EC CD G+      TC DINEC  NP  C    CIN    Y C+C SGY   D+  +CRD DEC   LHD     G  C N  G+F C C PG + +     C D NE   +   C P+G C+N  GS+ C C++GF    + +  CID      F E L + C   S  +N +   EC C +G +     E+ P          C           DI+EC +    C    C+N +GS  C C  GY  D  G  C   DEC  S +P   C  +C N  G  +C C  GY++  +D ++C D +EC+     CQ  C+N +GG  C C  GF    ++   C+    C+     C    +   +   + C C  GF L +    C+ +
Sbjct: 1974 CECSTGYKLSPSGACVGRNECQEIPNVCSHGDCVDTEGSYICICHNGFKATGEQTMCMDIDEC----DRQPCGNGTCKNTVGSYNCLC--FPGFELTH--NNDCMDIDECSSMLGQVCRNGQCINSIGSFQCLCQEGYDRTPDGKNCVDINECVSLPGTCSPGTCQNLEGSFRCICPPGYEVQNDNCIDINECEEEPNICLFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGNVAFQELCPYGHGAIPGPGDTREDVNECSENLGVC-INGACINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCTNVVGGFECACDEGFEPGPMMTCEDINECASNPLLCAF-RCINTFGSYECTCPSGYALRDDRRMCRDLDECAEGLHDCE-SRGMLCKNLIGTFMCICPPGMQRRPDGEGCTDENECRTKPGIC-PNGRCINTVGSYRCDCNEGFEVSPSGTE-CIDTRQGFCFTEVLQTMCQMSSTNRNLVTKSECCCNSGRSWGPQCELCPLLGTAQYKKMCPHGPGYSTDGRDIDECKVLPNLCKNGQCINSIGSFRCHCRLGYTADITGTACVDLDECNQSPKP---CNFICKNTEGSYQCSCPRGYVL-QEDGKICKDLDECSTKQHNCQFLCVNVIGGFNCKCPPGFT---QHHSSCIDNNECTAQPSLCGAKGQCLNTPGSYNCECQKGFSLDSSGVNCEDV 2713          

HSP 2 Score: 256.914 bits (655), Expect = 2.537e-67
Identity = 267/813 (32.84%), Postives = 371/813 (45.63%), Query Frame = 0
Query:  410 DPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLPGTQLS-------DKDNHTC---ISDEACQVNNGGCS--HECIHSYN----------QIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYEGDD----CSDI-----------NECETQDLICDHN---CINTEGSA----------------HCTCKAGFDLMDETECF-------DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNV--CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECAL--NNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKP----------IGGICSSAPRPSNGYYRCN 1125
            +PD+     CE++    +G +  C C+ G+  +  G+ C DVDEC  +  LCD+ +C N PG+Y C C  GF   ++   C DINEC  N    PC +  C+N  G + CEC   PG++L        D    TC   I D  C+VN  G +   EC  +            +I   CP GY   +   TC D+NEC      C N +C+N  GS  C+C  G   D     C D+           +EC T+ L   +    C  + GSA                   C  G    +  +         D +EC++ +G C    C N  G+F+C C  GF L+ +   CTD +EC I    CG +G C+NTPGSF CEC  G+E   +M  +CMDINEC  +  LC  G C N +G++EC C  G+      +TC+DINEC    N C +G C+N    Y C+C  G+    +   C D DEC   N  G    C+N  GS++C C+ GY        C DI+E     D C   G C N  G + C+C  GF+    D   CID +EC  +P  C H EC+NT G F C C+ G+ + +     C DI+EC +  +N D    C+N+ GS  C+C  G+  D    C   DEC  +          CIN PG  +C C  G+   + D   C D +EC  N   C++  C+N  GG+ C C +GF P E + + C     C+  N      C++       RC C  G++L      C            I G+C + P    G Y CN
Sbjct:  873 NPDICPNGMCENL----RG-SYRCICNLGYESDPTGKNCVDVDECTVNRLLCDNGLCRNTPGSYTCTCPKGFVFRTETDTCEDINECTSN----PCVNGVCRNNAGSFACECS--PGSKLDPSGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDTACPRGYARMKGV-TCEDVNECDVFPGVCPNGRCVNTAGSFRCECPEGLTLDGTARTCVDVRVEQCYMKWDEDEC-TEPLPGKYRIDMCCCSVGSAWGIDCEECPKVGSNEYKAICPRGPGFANRGDVLSGRPFYKDVNECKVFSGLCTHGTCRNTIGSFRCICGNGFALDAEERNCTDIDECRISPDLCG-HGTCVNTPGSFECECFEGYESGFMMMKNCMDINECERDPLLCRGGICMNTDGSFECICPPGHELTSEGNTCIDINECSLSDNLCRNGRCVNVIGTYQCACDPGFQATPDRQGCVDIDECTITNG-GCDTHCSNSEGSYECSCSEGYALMPDKRSCADIDECEDNPDIC-DGGQCTNIPGEYRCLCFDGFMASL-DMKTCIDVNECDLNPNICLHGECENTKGSFICHCQLGYFVKKGT-TGCTDIDECEIGAHNCDMHASCINVPGSFKCKCRTGWLGDGL-KCNDLDEC-ATEEHKCNLNANCINTPGSYRCACREGF---NGDGFSCSDVDECADNVNLCENGQCLNAPGGYRCECEMGFNPTEDS-KACQDIDECTFQNICVFGTCQNLPG--MFRCACDDGYELDRSGGNCTDINECADPVNCINGLCVNTP----GSYLCN 1655          

HSP 3 Score: 248.825 bits (634), Expect = 9.250e-65
Identity = 226/649 (34.82%), Postives = 316/649 (48.69%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINEC-TNSTLCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCG-PHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL-CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSC 1047
            C C +GF L+ ++  C D+DEC   P+LC H  C N PG++ C+C  G+ S       C+DINEC    LL  G       C N DG ++C C   PG +L+ + N TCI    C +++  C +  C++      C C  G++   D + CVDI+EC   +  C   C N  GS  C C  GY    +   C+DI+ECE    ICD   C N  G   C C  GF   +D   C D +EC+++   C    C N +G+F C C+ G+ +      CTD +EC IG  NC ++  CIN PGSF C+C  G+      C D++EC T    C  + +C N  G+Y C C  G+     +C D++EC  N   C +G+C+N   GY C C  G+   ++   C+D DEC   N C V G C N PG F C C  GYE     G C DINE +   DP    +G CVN  GS+ C C Q F  + N + + C+D        CF        GG  C  E G  ++    + C     C+L    G+  ++C     + Y   C   EG++ +      L+D       P G CQ   C+N  G  +CEC  GY ++ +D R+C D +EC+ + G C    C N LG +TC C
Sbjct: 1196 CICGNGFALDAEERNCTDIDECRISPDLCGHGTCVNTPGSFECECFEGYESGFMMMKNCMDINECERDPLLCRG-----GICMNTDGSFECIC--PPGHELTSEGN-TCIDINECSLSDNLCRNGRCVNVIGTYQCACDPGFQATPDRQGCVDIDECTITNGGCDTHCSNSEGSYECSCSEGYALMPDKRSCADIDECEDNPDICDGGQCTNIPGEYRCLCFDGFMASLDMKTCIDVNECDLNPNICLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECEIGAHNCDMHASCINVPGSFKCKCRTGWLGDGLKCNDLDECATEEHKCNLNANCINTPGSYRCACREGFNGDGFSCSDVDECADNVNLCENGQCLNAPGGYRCECEMGFNPTEDSKACQDIDECTFQNIC-VFGTCQNLPGMFRCACDDGYELDRSGGNCTDINECA---DPVNCINGLCVNTPGSYLCNCPQDF--ELNPTGVGCVDTR---VGNCFLDTQDRGDGGISCSAEIGVGVTRA--SCC-----CSLGRAWGNPCELCPPANTTEYKTLCPGGEGFRPNPI-TVILEDIDECQELP-GLCQGGNCVNTFGSFQCECPLGYYLN-EDTRICEDIDECSAHIGICGPGTCYNTLGNYTCVC 1817          

HSP 4 Score: 236.498 bits (602), Expect = 5.284e-61
Identity = 246/756 (32.54%), Postives = 347/756 (45.90%), Query Frame = 0
Query:  449 DVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGT--ACVDINECLLNNGHGPCQ--DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ-CLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQ-DLIC-DHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCE-QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEG--TYECKC------------------DSGYIFHNSTCL--------------DINECIRN--PCGHGECINESPGYSCSCHSGY-VDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE-FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS------ECKNTLGGFECLCETGFALSEILPN--TCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKD---------ERGNCF---LKDECRLSR----------------RPNGGCQQLCINIPGGL---KCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            D+DEC + P +C + +C N+ G++ C+C +GF+       C DI+EC  ++G   CQ   +C N+ G Y+CEC    G +LS   +  C+    CQ     CSH +C+ +     C+C +G++   +   C+DI+EC   D Q C N  C N  GS  C C  G+E    +DC DI+EC +    +C +  CIN+ GS  C C+ G+D   D   C D +EC    G C    C NLEG+F+C C PG+ +  DN  C D NEC      C ++G C NTPGSF C C PGF L ++   C D  +    T   +G C+  +   T + +C                    G +     C               D+NEC  N   C +G CIN    + C C  GY +D   V C D DEC   NPCG  G C N  G F+C C  G+E      C DINE +     C     C+N  GS+EC C  G+   ++D  +C D DEC      H        CKN +G F C+C  G    +  P+   C D NEC    G C +  C+N +GS+ C C EG++            +G CF   L+  C++S                 R  G   +LC  +        C   PGY  D +      D +EC +    C++  CIN +G   C C LG+  D      CV    C+ +   C+ ICK+TE    ++C CP G+ L+ D + CK +
Sbjct: 1906 DIDECSEIPAICTNGVCINQIGSFRCECPIGFSYNNILLICEDIDEC--SSGENLCQRNADCINIPGSYRCECS--TGYKLS--PSGACVGRNECQEIPNVCSHGDCVDTEGSYICICHNGFKATGEQTMCMDIDEC---DRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDIDECSSMLGQVCRNGQCINSIGSFQCLCQEGYDRTPDGKNCVDINECVSLPGTCSPGTCQNLEGSFRCICPPGYEVQNDN--CIDINECEEEPNIC-LFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGNVAFQELCPYGHGAIPGPGDTREDVNECSENLGVCINGACINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCG-NGTCTNVVGGFECACDEGFEPGPMMTCEDINECASNPLLCAFR--CINTFGSYECTCPSGYAL-RDDRRMCRDLDECAEG--LHDCESRGMLCKNLIGTFMCICPPGM---QRRPDGEGCTDENECRTKPGICPNGRCINTVGSYRCDCNEGFEVSPSGTECIDTRQGFCFTEVLQTMCQMSSTNRNLVTKSECCCNSGRSWGPQCELCPLLGTAQYKKMCPHGPGYSTDGR------DIDECKVLPNLCKNGQCINSIGSFRCHCRLGYTADITG-TACVDLDECNQSPKPCNFICKNTEG--SYQCSCPRGYVLQEDGKICKDL 2631          

HSP 5 Score: 229.565 bits (584), Expect = 6.869e-59
Identity = 222/660 (33.64%), Postives = 299/660 (45.30%), Query Frame = 0
Query:  435 CHDGFFLNDDGECEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTA--CVDIN--ECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCV------DINECVTGDIQCLN-KCMNVPGSAYCKCDSGYEGD----DCSDINECETQDLICDHN-CINTEGSAHCTCKAGFD--LMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNV--CRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS--PC-FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNP 1058
            C  G+       CEDV+EC   P +C +  C N  G++ C+C  G T  GTA  CVD+   +C +       +DEC             LPG    D     C    A  ++   C     + Y  I   CP G                 D+NEC      C +  C N  GS  C C +G+  D    +C+DI+EC     +C H  C+NT GS  C C  G++   M    C D +ECE D   C   +C N +G+F+C C PG  L ++  TC D NEC++    C   G C+N  G++ C C PGF+   D   C+DI+ECT +       C+N EG+YEC C  GY       +C DI+EC  NP  C  G+C N    Y C C  G++   ++  C D +EC L+ N C + G+C N  GSF C C  GY  K G   C DI+E  +    C  H  C+N  GSF+C C  G++ D    N   D DEC +    C  ++ C NT G + C C  GF        +C D++ECA N   C    C+N  G + C C  G+   E    C   DEC        G    C N+PG  +C C+ GY +D      C D NEC          C+N  G + C+C   F   E NP
Sbjct: 1039 CPRGYARMKGVTCEDVNECDVFPGVCPNGRCVNTAGSFRCECPEGLTLDGTARTCVDVRVEQCYMKWD----EDECTEP----------LPGKYRIDM--CCCSVGSAWGIDCEECPKVGSNEYKAI---CPRGPGFANRGDVLSGRPFYKDVNECKVFSGLCTHGTCRNTIGSFRCICGNGFALDAEERNCTDIDECRISPDLCGHGTCVNTPGSFECECFEGYESGFMMMKNCMDINECERDPLLCRGGICMNTDGSFECICPPGHELTSEGNTCIDINECSLSDNLC-RNGRCVNVIGTYQCACDPGFQATPDRQGCVDIDECTITNGGCDTHCSNSEGSYECSCSEGYALMPDKRSCADIDECEDNPDICDGGQCTNIPGEYRCLCFDGFMASLDMKTCIDVNECDLNPNIC-LHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECEIGAHNCDMHASCINVPGSFKCKCRTGWLGDGLKCN---DLDECATEEHKCNLNANCINTPGSYRCACREGFNGDGF---SCSDVDECADNVNLCENGQCLNAPGGYRCECEMGFNPTEDSKACQDIDECTFQNICVFG---TCQNLPGMFRCACDDGYELDRSGGN-CTDINECADPVNCINGLCVNTPGSYLCNCPQDF---ELNP 1664          

HSP 6 Score: 217.238 bits (552), Expect = 3.338e-55
Identity = 239/768 (31.12%), Postives = 324/768 (42.19%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDE--------CKNVDGGYQCECGGLPGTQLSDK----------------DNHTCISDEACQVNNGGCS-------------HECIHSYNQIFC-LCPDGY-ELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGD-CINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKP--GSFD----CDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS--PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLK------TDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKG 1136
            C C +G+    DG+ C D++ECV  P  C    C N  G++ C C  G+  Q   C+DINEC         ++E        C N  G +QC C   PG  LSD                 DN  C   +A       C                C    N  F  LCP G+  +     T  D+NEC      C+N  C+N  GS  C+C  GY     G +C D +EC   +   +  C N  G   C C  GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C D +EC  G+ +C   G  C N  G+F C C PG +   D   C D NEC T   +C +G C N  G+Y C C+ G+    S      ECI      G C  E     C   S   ++        EC  ++    G +C   P  G+      C   PGY        DI+E  +  + C  +G C+N+ GSF C C  G+  D   +  C+D DEC  S  PC +  CKNT G ++C C  G+ L E     C+D++EC+    +C  +CVN++G   C+C  G+ +    +C   +EC       G   Q C+N PG   CEC  G+ +DS     C D +EC  N+  CQH C N LGG+ C C  G+        +CV    CS      S  C +T      +C+CPSGF          D   C   G  CS     ++G Y C      GYF  G
Sbjct: 2097 CLCQEGYDRTPDGKNCVDINECVSLPGTCSPGTCQNLEGSFRCICPPGYEVQNDNCIDINEC---------EEEPNICLFGTCTNTPGSFQCVC--PPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGNVAFQELCPYGHGAIPGPGDTREDVNECSENLGVCINGACINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCTNVVGGFECACDEGFEPGPMMTCEDINECASNPLLCAFRCINTFGSYECTCPSGYALRDDRRMCRDLDECAEGLHDCESRGMLCKNLIGTFMCICPPGMQRRPDGEGCTDENECRTKPGICPNGRCINTVGSYRCDCNEGFEVSPSG----TECIDTR--QGFCFTEVLQTMCQMSSTNRNL----VTKSECCCNSGRSWGPQCELCPLLGTAQYKKMCPHGPGYSTDG---RDIDECKVLPNLC-KNGQCINSIGSFRCHCRLGYTADITGT-ACVDLDECNQSPKPC-NFICKNTEGSYQCSCPRGYVLQED-GKICKDLDECSTKQHNCQFLCVNVIGGFNCKCPPGFTQ-HHSSCIDNNECTAQPSLCGAKGQ-CLNTPGSYNCECQKGFSLDSSGVN-CEDVDECDGNH-RCQHGCQNVLGGYRCGCPQGYV-QHYQWNQCVDENECSSPTACGSASCYNTLGSF--KCVCPSGFDFDQAFGGCQDVDECSAGGSPCSYGCSNTDGGYLCGCP--GGYFRAG 2827          

HSP 7 Score: 215.312 bits (547), Expect = 1.408e-54
Identity = 242/754 (32.10%), Postives = 325/754 (43.10%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLPGTQLSDK---DNH---TCISDEACQVNNGGCSH---------ECI-----HSYNQ------------IFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTD-----------ENECTIGIANCGIYGDCINTPGSFY------CE----CHPGFELMED-SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDIN-ECIRNPCGHGECINESPGY----SCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFD-CDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRR--PNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            C C+ GF +  DG+ C D DEC       + +C N+ G++ C C+ GF     G  CVDI+EC      G C +  C N +G ++CEC G     +  +   D H   TC       +  G C+          EC      H + +               LC  G  +  D +   DINEC      C N  C N+ GS  C C+ GYE    G +C D++EC    L+CD+  C NT GS  CTC  GF    ET+ C D +EC   N     VC N  G+F C C PG  L+     C D           +  C + I    +  +C  T G+ +      CE    C  G+  M+  +C D+NEC     +C +G C N  G++ C+C  G     +  TC+D+  E         EC    PG      C C  G         D +EC           C   PG  +  D   G  F      D+NE  +    C  HG C N  GSF C+C  GF  D  + N C D DEC  SP  C H  C NT G FEC C  G+    ++   C DINEC  +   C   +C+N  GS  C C  G++    GN C   +EC LS     NG     C+N+ G  +C C+PG+   + D + CVD +ECTI NGGC   C N  G + CSC  G+   PD+++   C     C  N   C    + T     +RC+C  GF    D +TC
Sbjct:  698 CICNAGFEITPDGKNCVDHDECATTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCVDIDEC---ETPGICMNGWCINTEGSFRCECLGGLAIGVDGRVCVDTHMRSTCYGG----IKKGTCARPFPGAVTKSECCCANPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADGR---DINECALNPDICPNGMCENLRGSYRCICNLGYESDPTGKNCVDVDECTVNRLLCDNGLCRNTPGSYTCTCPKGFVFRTETDTCEDINEC-TSNPCVNGVCRNNAGSFACECSPGSKLDPSGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDTACPRGYARMKGVTCEDVNECDVFPGVCPNGRCVNTAGSFRCECPEGLTLDGTARTCVDVRVEQCYMKWDEDECTEPLPGKYRIDMCCCSVGSAWG----IDCEECPKVGSNEYKAICPRGPGFANRGDVLSGRPFY----KDVNECKVFSGLC-THGTCRNTIGSFRCICGNGFALDAEERN-CTDIDECRISPDLCGHGTCVNTPGSFECECFEGYESGFMMMKNCMDINECERDPLLCRGGICMNTDGSFECICPPGHELTSEGNTCIDINECSLSDNLCRNG----RCVNVIGTYQCACDPGFQA-TPDRQGCVDIDECTITNGGCDTHCSNSEGSYECSCSEGYALMPDKRS---CADIDECEDNPDICDGG-QCTNIPGEYRCLCFDGFMASLDMKTC 1421          

HSP 8 Score: 214.927 bits (546), Expect = 2.168e-54
Identity = 246/800 (30.75%), Postives = 335/800 (41.88%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVD--INECLLNNGHGPCQDECKNVDGGYQCE------------CGGL-----------------------PGTQLSDKDNHTCISDEA--CQVNNGGC-SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGYE----GDDCSDINE----------CE-------TQDLICDHNCINTEGSAHC----------------TCKAGFDL-MDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELM-EDSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINEC----ALNNGDCSQVCVNILGSHYCRCY----EGYKK-----DERGNCFLKDECRL----------SRRPNGGCQQ--------LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C C DG+ L+   G C D++EC D     + +C N PG+Y+C+C   F     G  CVD  +  C L+      QD     DGG  C             C  L                       PG +    +  T I ++   CQ   G C    C++++    C CP GY L+ED + C DI+EC      C    C N  G+  C C   Y     G++C D+ +          CE       T+ + C    I    +  C                    GF + +   +  D DEC      C   VC N  G+F+C C  GF  N   L C D +EC+ G   C    DCIN PGS+ CEC  G++L    +C+  NEC     +C  G C + EG+Y C C +G+      + C+DI+EC R PCG+G C N    Y+C C  G+ +  +N C D DEC  +    C   G+C N  GSF C C  GY+       C DINE       C P G C N +GSF C+C  G+   QND+  CID +EC   P  C    C NT G F+C+C  GF LS+     C D  +       +NG CS           C C     EG+        + GN   ++ C            +R     C +         CIN  G  +CEC  GY +D      CVD +EC+I N      C N +GG  C+C  GF+P       C     C+ N   C+  C +T     + C CPSG+ L+ D R C+ +
Sbjct: 1613 CACDDGYELDRSGGNCTDINECADPVNCINGLCVNTPGSYLCNCPQDFELNPTGVGCVDTRVGNCFLDT-----QDR---GDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPPANTTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPLGYYLNEDTRICEDIDECSAHIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTCENELSFNMTKKMCCCSYNIGKAWNKPCEPCPTPASPEYQILCGNQAPGFIIDIHTGKPIDIDECSEIPAICTNGVCINQIGSFRCECPIGFSYNNILLICEDIDECSSGENLCQRNADCINIPGSYRCECSTGYKLSPSGACVGRNECQEIPNVCSHGDCVDTEGSYICICHNGFKATGEQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDIDECSSMLGQVC-RNGQCINSIGSFQCLCQEGYDRTPDGKNCVDINECVSLPGTCSP-GTCQNLEGSFRCICPPGY-EVQNDN--CIDINECEEEPNICLFGTCTNTPGSFQCVCPPGFVLSDN-GRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGNVAFQELCPYGHGAIPGPGDTREDVNECSENLGVCINGACINTDGSFRCECPFGYNLDYTGVN-CVDTDECSIGNPCGNGTCTNVVGGFECACDEGFEPGPM--MTCEDINECASNPLLCAFRCINTFG--SYECTCPSGYALRDDRRMCRDL 2393          

HSP 9 Score: 212.231 bits (539), Expect = 1.239e-53
Identity = 251/830 (30.24%), Postives = 351/830 (42.29%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQGT--ACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE-GDDCSDINECETQDLICDHNCINTEGSAHC-------TCKAGF-DLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECIRNPCGHGECINESPGYSCSCH-------SGYVDVDNVCRDYDECLHDNPCGVG-------GKCNNKPGS----------FDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID--FDECLSSPCFHSECKNTLGGF----ECLCETGFALS---------------EILPNT---------------CEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY---------IVD----SQDPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            CEC+ G+  +  GEC DVDEC   P  C H  C N PG+Y C C  GF S  T  AC+DI+EC++N     C++  C N DG +QC C    G +++  D   C+  + C   N   +  CI+      C+C  G+ L  + + CVDI+EC T  I C+N  C+N  GS  C+C  G   G D                 C++T   + C       TC   F   + ++EC   +        C+         FQ  C  G  +  D     D NEC +    C   G C N  GS+ C C+ G+E      +C+D++ECT N  LC +G C N  G+Y C C  G++F     TC DINEC  NPC +G C N +  ++C C        SG + VD++       + D  C V         +C    G+           D  C  GY   K   C D+NE  +    C P+G CVN  GSF C C +G   D   +  C+D   ++C        EC   L G      C C  G A                  I P                  +D+NEC + +G C+   C N +GS  C C  G+  D E  NC   DECR+S  P+      C+N PG  +CEC  GY          +D     +DP L                             C+D NEC++++  C++  C+N +G + C+C  GF+  PD +    CV    C++ NGGC   C ++E    + C C  G+ L  D R+C  I           GG C++ P    G YRC
Sbjct:  617 CECNMGYKQDVRGECIDVDECSSSP--CVHGDCVNTPGSYHCKCHEGFQSTPTKQACIDIDECIMNGVM--CRNGRCVNTDGSFQCICNA--GFEIT-PDGKNCVDHDECATTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCVDIDECETPGI-CMNGWCINTEGSFRCECLGGLAIGVD--------------GRVCVDTHMRSTCYGGIKKGTCARPFPGAVTKSECCCANPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADG---RDINECALNPDIC-PNGMCENLRGSYRCICNLGYESDPTGKNCVDVDECTVNRLLCDNGLCRNTPGSYTCTCPKGFVFRTETDTCEDINECTSNPCVNGVCRNNAGSFACECSPGSKLDPSGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDTACPRGYARMKGVTCEDVNECDVFPGVC-PNGRCVNTAGSFRCECPEGLTLD-GTARTCVDVRVEQCYMKW-DEDECTEPLPGKYRIDMCCCSVGSAWGIDCEECPKVGSNEYKAICPRGPGFANRGDVLSGRPFYKDVNECKVFSGLCTHGTCRNTIGSFRCICGNGFALDAEERNCTDIDECRIS--PDLCGHGTCVNTPGSFECECFEGYESGFMMMKNCMDINECERDPLLCRGGICMNTDGSFECICPPGHELTSEGNTCIDINECSLSDNLCRNGRCVNVIGTYQCACDPGFQATPDRQG---CVDIDECTITNGGCDTHCSNSEG--SYECSCSEGYALMPDKRSCADIDECEDNPDICDGGQCTNIP----GEYRC 1406          

HSP 10 Score: 201.83 bits (512), Expect = 2.048e-50
Identity = 234/777 (30.12%), Postives = 329/777 (42.34%), Query Frame = 0
Query:  448 EDVDECVDDPELCDHI-CTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGH-GPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN-NGGCSHECIHSYNQIFCLCPDGYELDEDW-KTC-------------------------------VDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETECFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS-CMDINECTN--STLCGSGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC---SHICKSTESGLHHRCMCPSGFKLK------TDARTCKPIGGICSSAPRPSN--GYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKC 1157
            ED+DEC + P LC    C N  G++ C+C LG+        C DI+EC  + G  GP    C N  G Y C C      Q++  +N   +    C  N N  C +E   +  +  C C   Y + + W K C                               +DI+EC      C N  C+N  GS  C+C  G+  ++    C DI+EC + + +C  N  CIN  GS  C C  G+ L     C  ++EC E+ N      C + EG++ C C  GF    +   C D +EC      CG  G C NT GS+ C C PGFEL  ++ CMDI+EC++    +C +G C N  G+++C C  GY        C+DINEC+  P  C  G C N    + C C  GY   ++ C D +EC  +    + G C N PGSF C C PG+   +    C D  +             C     + +C   + F   +          E    PC     +  +  F+ LC  G        +T ED+NEC+ N G C +  C+N  GS  C C  GY  D  G NC   DEC +      G    C N+ GG +C C+ G+  +      C D NEC  N   C   CIN  G + C+C  G+   +     C     C+     C     +CK+        C+CP G + +      TD   C+   GIC +  R  N  G YRC+  +       GT+C +  R+GF  T  +   C
Sbjct: 1747 EDIDECQELPGLCQGGNCVNTFGSFQCECPLGYYLNEDTRICEDIDECSAHIGICGP--GTCYNTLGNYTCVCP-PEYMQVNGGNNCMDMRKSVCYRNYNDTCENELSFNMTKKMCCC--SYNIGKAWNKPCEPCPTPASPEYQILCGNQAPGFIIDIHTGKPIDIDECSEIPAICTNGVCINQIGSFRCECPIGFSYNNILLICEDIDECSSGENLCQRNADCINIPGSYRCECSTGYKLSPSGACVGRNECQEIPNVCSHGDCVDTEGSYICICHNGFKATGEQTMCMDIDECD--RQPCG-NGTCKNTVGSYNCLCFPGFELTHNNDCMDIDECSSMLGQVCRNGQCINSIGSFQCLCQEGYDRTPDGKNCVDINECVSLPGTCSPGTCQNLEGSFRCICPPGYEVQNDNCIDINECEEEPNICLFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSF-----------CFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGNV-AFQELCPYGHGAIPGPGDTREDVNECSENLGVCINGACINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNG---TCTNVVGGFECACDEGF--EPGPMMTCEDINECASNPLLCAFRCINTFGSYECTCPSGYALRDDR-RMCRDLDECAEGLHDCESRGMLCKNLIGTFM--CICPPGMQRRPDGEGCTDENECRTKPGICPNG-RCINTVGSYRCDCNEGFEVSPSGTEC-IDTRQGFCFTEVLQTMC 2493          

HSP 11 Score: 172.17 bits (435), Expect = 1.927e-41
Identity = 176/517 (34.04%), Postives = 231/517 (44.68%), Query Frame = 0
Query:  586 CLN-KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNPC----GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNP-CGVGGKCNNKP----GSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDERGNC---FLKDECRLSRRPNGGCQQLCINIPGG-LKCECNPGYI-----------VDSQDPR--------LCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPD 1054
            CLN +C+  P S  C+C+ GY+ D   +C D++EC +   +   +C+NT GS HC C  GF      + C D DEC M+   C    C N +G+FQC C  GF +  D   C D +EC     N  + G CIN  GSF C C PGF L  +   C+DI+EC    +C +G C N EG++ C+C  G         C+D +  +R+ C      G C    PG                    EC   NP  G G  C   P      F   C+ G         DINE +L  D C P+G C N  GS+ C+C+ G+  D    N C+D DEC  +   C +  C+NT G + C C  GF       +TCEDINEC  N   NG    VC N  GS  C C  G K D  G      +K  C L+ + +G C+   +NI G  LK EC                +D+  PR         C D NEC +  G C +  C+N  G   C C  G   D
Sbjct:  603 CLNGRCIPTPSSYRCECNMGYKQDVRGECIDVDECSSSPCV-HGDCVNTPGSYHCKCHEGFQSTPTKQACIDIDECIMNGVMCRNGRCVNTDGSFQCICNAGFEITPDGKNCVDHDECA--TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCVDIDECETPGICMNGWCINTEGSFRCECLGGLAIGVDGRVCVDTH--MRSTCYGGIKKGTCARPFPGAV---------------TKSECCCANPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADG-RDINECALNPDIC-PNGMCENLRGSYRCICNLGYESDPTGKN-CVDVDECTVNRLLCDNGLCRNTPGSYTCTCPKGFVF-RTETDTCEDINECTSNPCVNG----VCRNNAGSFACECSPGSKLDPSGTICVDSMKGTCWLNIQ-DGRCE---VNINGATLKSECCATLGAAWGSPCERCEIDTACPRGYARMKGVTCEDVNECDVFPGVCPNGRCVNTAGSFRCECPEGLTLD 1087          

HSP 12 Score: 137.502 bits (345), Expect = 6.855e-31
Identity = 142/477 (29.77%), Postives = 204/477 (42.77%), Query Frame = 0
Query:  741 STLCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF----LKDECRLSRRPNGGCQQLCINIPGGLKCE----CNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKC 1203
            + LC +G C     +Y C+C+ GY       C+D++EC  +PC HG+C+N    Y C CH G+        C D DEC+ +      G+C N  GSF C C  G+E      + ++           +G C+N DGSF+C+C  GF+   N    C+D DEC +   C +  C NT G F C C  G A+                  G   +VCV+        CY G KK      F     K EC  +  P+ G  + C   P     E    C+ G  + + D R   D NEC +N   C +  C N  G + C C+LG++ D    + CV    C+VN   C + +C++T     + C CP GF  +T+  TC+ I   C+S P   NG  R N    +     G+K          P+G I    +    W   +D  CEV        ++   +  E C T  +  GS C
Sbjct:  600 TNLCLNGRCIPTPSSYRCECNMGYKQDVRGECIDVDECSSSPCVHGDCVNTPGSYHCKCHEGFQSTPTKQACIDIDECIMNGVMCRNGRCVNTDGSFQCICNAGFEITPDGKNCVDHDECATTNMCLNGMCINEDGSFKCICKPGFVLAPN-GRYCVDIDECETPGICMNGWCINTEGSFRCECLGGLAI------------------GVDGRVCVDT--HMRSTCYGGIKKGTCARPFPGAVTKSECCCA-NPDHGFGEPCQPCPAKNSAEFQALCSSGIGI-TADGR---DINECALNPDICPNGMCENLRGSYRCICNLGYESDPTG-KNCVDVDECTVNRLLCDNGLCRNTPG--SYTCTCPKGFVFRTETDTCEDI-NECTSNP-CVNGVCRNNAGSFACECSPGSK--------LDPSGTICVDSMKGTCWLNIQDGRCEVN-------INGATLKSECCATLGAAWGSPC 1030          

HSP 13 Score: 51.9878 bits (123), Expect = 6.509e-5
Identity = 36/98 (36.73%), Postives = 49/98 (50.00%), Query Frame = 0
Query:  879 CHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERGN 973
            C +GFI +   +  C D DEC + P  C    C NT+G +EC C  G   SE   + CED++EC   +G C    C N  GS+ C C  G+     G+
Sbjct:  369 CRRGFIPNIR-TGACQDVDECQAIPGLCQGGNCINTVGSYECKCPAGHKQSET-SHRCEDVDECGTISGVCDGGECTNTAGSYVCTCPRGFMTSHDGS 464          

HSP 14 Score: 50.447 bits (119), Expect = 2.202e-4
Identity = 35/101 (34.65%), Postives = 53/101 (52.48%), Query Frame = 0
Query:  721 CHPGF--ELMEDSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDE 814
            C  GF   +   +C D++EC     LC  G+C N  G+YECKC +G+    ++  C D++EC  I   C  GEC N +  Y C+C  G++   +  R  D+
Sbjct:  369 CRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSYECKCPAGHKQSETSHRCEDVDECGTISGVCDGGECTNTAGSYVCTCPRGFMTSHDGSRCIDQ 469          

HSP 15 Score: 48.9062 bits (115), Expect = 5.987e-4
Identity = 34/87 (39.08%), Postives = 45/87 (51.72%), Query Frame = 0
Query:  844 FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQND-SNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALS 927
             + G C D++E       C   G+C+N  GS+EC C  G  H Q++ S+ C D DEC  +S  C   EC NT G + C C  GF  S
Sbjct:  377 IRTGACQDVDECQAIPGLC-QGGNCINTVGSYECKCPAG--HKQSETSHRCEDVDECGTISGVCDGGECTNTAGSYVCTCPRGFMTS 460          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:fbn2b "fibrillin 2b" species:7955 "Danio rerio" [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA] [GO:0005201 "extracellular matrix structural constituent" evidence=IEA] [GO:0003007 "heart morphogenesis" evidence=IMP] [GO:0003250 "regulation of cell proliferation involved in heart valve morphogenesis" evidence=IGI] [GO:0060958 "endocardial cell development" evidence=IGI] [GO:0001570 "vasculogenesis" evidence=IMP] [GO:0048570 "notochord morphogenesis" evidence=IGI;IMP] [GO:0003160 "endocardium morphogenesis" evidence=IMP] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF07645 PIRSF:PIRSF036312 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 ZFIN:ZDB-GENE-090112-3 GO:GO:0005509 GO:GO:0003007 GO:GO:0005578 InterPro:IPR013032 PROSITE:PS00022 GO:GO:0001570 PROSITE:PS01186 eggNOG:NOG12793 PROSITE:PS00010 GO:GO:0003160 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 GO:GO:0005201 GO:GO:0048570 HOGENOM:HOG000231768 HOVERGEN:HBG005643 Gene3D:3.90.290.10 InterPro:IPR017878 PANTHER:PTHR24039 Pfam:PF00683 SUPFAM:SSF57581 PROSITE:PS51364 GO:GO:0060958 GO:GO:0003250 EMBL:EU449516 RefSeq:NP_001129262.1 UniGene:Dr.51457 ProteinModelPortal:B6CS38 STRING:7955.ENSDARP00000013105 GeneID:571786 KEGG:dre:571786 CTD:571786 NextBio:20890698 Uniprot:B6CS38)

HSP 1 Score: 268.47 bits (685), Expect = 6.552e-71
Identity = 271/781 (34.70%), Postives = 343/781 (43.92%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH--ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDE-TECFDKDEC----EMDNGGCE----------QVCNNL------------------EGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYV--DVDNVCRDYDECLH--DNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPCFHSEC-KNTLGGFECLCETGFALSEI-----LPNTCE----------------DINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI---GG--ICSSAPRPSNGYYRC 1124
            CEC  GF L+  G C D +EC + P +C H  C +  G++ C C  GF  T   T C+DI+EC       PC +  CKN  G Y C C   PG +L+   N+ C+  + C V+        +CI++     CLC DGY L  D K CVDINECVT    C    C N+ GS  C C  GYE   D C DINEC  +  IC    C NT GS  C C+ GF L D    CFD  E       + G C           + C +L                  E  F   C  G           D NEC      CG  G CINT GSF CEC  G+ L     +C+D +EC+    CG+G+C+N+ G +EC C  G+      TC DINEC  NP  C    C+N    Y C C +GYV  D + +CRD DEC    D+    G  C N+ G+F C C PG   +     C D+NE   +   C  +G CVN  GS+ C C++GF      +  CID      F E L + C  S   +NT+   EC C  G     +     LP T +                DINEC +    C    C+N +GS  C C  GY  D  G +C   DEC  S +P   C  LC N  G   C C  GYI+   D + C D +EC+     CQ  C+N +GG TC C  GF    ++   C+    CS     C        S     C C  GF L      C  +   GG   C    +   G YRC
Sbjct: 1836 CECSAGFKLSPSGACIDRNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMDIDEC----DRQPCGNGTCKNTVGSYNCLC--FPGFELTH--NNDCMDIDECSVHASQVCRNGQCINNMGSFKCLCLDGYNLTPDGKNCVDINECVTLPGACQPGTCQNLDGSFRCICPPGYEVQNDKCVDINECNVEPNICQFGTCKNTPGSFQCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGREDMNECVENPEICG-NGLCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCSNVPGGFECSCQEGFEPGPMMTCEDINECAVNPLLCAF-RCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMTRRPDGEGCMDLNECRSKPGIC-KNGRCVNTVGSYRCECNEGFEASATGTE-CIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDGRDINECEVMPNLCKNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDECSQSPKP---CNFLCKNTEGSYLCSCPRGYILQP-DGKTCKDLDECSTKQHNCQFLCVNTIGGFTCKCPSGFT---QHQTACIDNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCDDVDECGGNHRCQHGCQNMMGGYRC 2597          

HSP 2 Score: 261.151 bits (666), Expect = 1.274e-68
Identity = 257/753 (34.13%), Postives = 354/753 (47.01%), Query Frame = 0
Query:  449 DVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGT--ACVDINECLLNNGHGPCQ--DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ-CLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQ-DLIC-DHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCE-QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCN--NLEGTYECKC-------------------DSGYIFHNSTC-------------LDINECIRNP--CGHGECINESPGYSCSCHSGY-VDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE-FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS----PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKK---------DERGNCF---LKDECRLSR----------------RPNGGCQQLCINIPGGLK----CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            D+DEC + P +C + +C N+ G++ C+C +GF+       C DI+EC  N+G   CQ    C N+ G Y+CEC    G +LS      CI    CQ     CSH ECI +     CLC +G++   D   C+DI+EC   D Q C N  C N  GS  C C  G+E    +DC DI+EC      +C +  CIN  GS  C C  G++L  D   C D +EC    G C+   C NL+G+F+C C PG+ +  D   C D NEC +    C  +G C NTPGSF C C PGF L ++   C D  E    T   +G C+      T + KC                   D+     ++ C              D+NEC+ NP  CG+G CIN    + C C  GY +D   V C D DEC   NPCG  G C+N PG F+C C  G+E      C DINE ++    C     CVN  GS+EC+C  G++  ++D+ +C D DEC             CKN +G F C+C  G          C D+NEC    G C    CVN +GS+ C C EG++          + +G CF   L+  C+ S                 R  G   +LC  +PG ++    C   PGY  D +      D NEC +    C++  CIN +G   C C++G+  D      C+    CS +   C+ +CK+TE    + C CP G+ L+ D +TCK +
Sbjct: 1768 DIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLICEDIDEC--NSGDNLCQRNANCINIPGSYRCECSA--GFKLSPSG--ACIDRNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMDIDEC---DRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDIDECSVHASQVCRNGQCINNMGSFKCLCLDGYNLTPDGKNCVDINECVTLPGACQPGTCQNLDGSFRCICPPGYEVQNDK--CVDINECNVEPNIC-QFGTCKNTPGSFQCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGREDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCG-NGTCSNVPGGFECSCQEGFEPGPMMTCEDINECAVNPLLCAFR--CVNTFGSYECMCPTGYVL-RDDNRMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMTRRPD-GEGCMDLNECRSKPGICKNGRCVNTVGSYRCECNEGFEASATGTECIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCP-LPGTIQYKKMCPLGPGYTTDGR------DINECEVMPNLCKNGQCINSVGSFRCHCNVGYTNDFTG-TSCIDMDECSQSPKPCNFLCKNTEG--SYLCSCPRGYILQPDGKTCKDL 2493          

HSP 3 Score: 259.225 bits (661), Expect = 4.450e-68
Identity = 268/817 (32.80%), Postives = 377/817 (46.14%), Query Frame = 0
Query:  410 DPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTA--CVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLPGTQLSDKDNHTC-----------ISDEACQVNNGGCS--HECIHSYNQIFCLCPDGYELDEDWK---------TCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHN--------------CINTEGSA----------------HCTCKAGFDLMDETECF-------DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIR--NPCGHGECINESPGYSCSCHSGY-VDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECAL--NNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN----GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKP----------IGGICSSAPRPSNGYYRCN 1125
            DPD+ +   CE++    +G +  C C+ G+  +  G+ C D++EC+ +  LCD+ +C N PG+Y C C  GF+ +  +  C DINEC  N    PC +  C+N+ G + CEC    G++L D  N  C           I D  C+VN  G +   EC  +    +    +  E+D              C DINEC      C N +C+N  GS  C+C  G      G  C D+   E   +  D +              C  T G+A                   C  G  + +  +         D +EC++  G C    C N  G+F+C C  GF L  +   CTD +ECTI    CG +G C+NTPGSF CEC  G+E   +M  +CMDI+EC  +  LC  G+C N EG+YEC C  G+      S C D+NEC    N C HG+C+N    Y CSC +GY V  D   C D DEC   N  G    C N  GS++C C+ GY        C DI+E     D C   G C N  G + C+C+ GF+    D   CID +EC  +P  C H +C+NT G F C C+ G+ + +     C D++EC +  +N D    CVN  GS  CRC +G++ D    C   DEC ++   N      C+N PG  +C C  G+   + D   C D +EC  N   C++  C+N  GG+ C C +GF P E + + C     C+  N    G C ++      G+  RC+C  G++L      C            I G+C + P    G Y CN
Sbjct:  735 DPDICQNGICENL----RG-SYRCICNIGYESDASGKNCVDINECLVNRLLCDNGMCRNTPGSYTCSCPKGFSFKADSETCEDINECDSN----PCINGICRNIAGSFNCECS--HGSKL-DSTNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSECCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFPGVCTNGRCVNTQGSFRCECPEGLTLDGAGRTCVDVRS-EQCYMKWDEDECVEPLPGRYRVDMCCCTVGAAWGVDCEACPKPNTNEFKTICPRGPGIANRGDILTGRPFYKDVNECKVFRGLCTHGTCRNTIGSFKCRCDSGFALTMEERNCTDIDECTISPDLCG-HGVCVNTPGSFECECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCLNTEGSYECDCPPGHQLSTEASACEDVNECQLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQGCVDIDECTIMNG-GCDTHCTNSEGSYECSCSEGYALMPDLRTCADIDECEDTPDIC-DGGQCTNIPGEYRCLCYDGFMASM-DMRTCIDVNECDLNPNICLHGDCENTKGSFICHCQLGYFVKK-GSTGCTDVDECEIGAHNCDLHAACVNAPGSFKCRCRDGWEGDGI-KCIDVDEC-VTEEHNCNPNAECLNTPGSYRCSCKEGF---NGDGFSCSDMDECADNVNLCENGQCLNAPGGYRCECEMGFTPTE-DSKACQDIDECNFQNICVFGSCQNL-----PGM-FRCVCDYGYELDRSGGNCTDINECFDPVNCINGVCVNLP----GSYLCN 1517          

HSP 4 Score: 252.292 bits (643), Expect = 6.954e-66
Identity = 228/649 (35.13%), Postives = 316/649 (48.69%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQV-CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINEC-TNSTLCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCG-PHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL-CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQ-HACINKLGGHTCSC 1047
            C C  GF L  ++  C D+DEC   P+LC H +C N PG++ C+C  G+ S       C+DI+EC    LL  G       C N +G Y+C+C   PG QLS  +   C     CQ+++  C H +C++      C C  GY++  D + CVDI+EC   +  C   C N  GS  C C  GY    +   C+DI+ECE    ICD   C N  G   C C  GF   MD   C D +EC+++   C    C N +G+F C C+ G+ +   +  CTD +EC IG  NC ++  C+N PGSF C C  G+E     C+D++EC T    C  +  C N  G+Y C C  G+     +C D++EC  N   C +G+C+N   GY C C  G+   ++   C+D DEC   N C V G C N PG F C C  GYE     G C DINE     DP    +G CVN  GS+ C C   F  + N S + C+D        CF        GG  C  E G  ++    + C     C+L    G+  ++C  +  + Y   C   EG++ +      L+D       P G CQ   C+N  G  +CEC  GY ++ ++ R+C D +ECT + G C    C N LG +TC C
Sbjct: 1058 CRCDSGFALTMEERNCTDIDECTISPDLCGHGVCVNTPGSFECECFDGYESGFMMMKNCMDIDECERDPLLCRG-----GTCLNTEGSYECDC--PPGHQLS-TEASACEDVNECQLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQGCVDIDECTIMNGGCDTHCTNSEGSYECSCSEGYALMPDLRTCADIDECEDTPDICDGGQCTNIPGEYRCLCYDGFMASMDMRTCIDVNECDLNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGAHNCDLHAACVNAPGSFKCRCRDGWEGDGIKCIDVDECVTEEHNCNPNAECLNTPGSYRCSCKEGFNGDGFSCSDMDECADNVNLCENGQCLNAPGGYRCECEMGFTPTEDSKACQDIDECNFQNIC-VFGSCQNLPGMFRCVCDYGYELDRSGGNCTDINECF---DPVNCINGVCVNLPGSYLCNCPPDF--ELNPSGVGCVDT---RVGNCFLDTLDRGDGGISCSAEIGVGVTRA--SCC-----CSLGGAWGNPCELCPFVNSTEYKTLCPGGEGFRPNPI-TVILEDIDECQELP-GLCQGGNCVNTFGSFQCECPAGYYLN-EETRICEDIDECTAHIGICGPGTCYNTLGNYTCVC 1679          

HSP 5 Score: 239.58 bits (610), Expect = 5.905e-62
Identity = 247/748 (33.02%), Postives = 332/748 (44.39%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEA---CQVNNGGCSHECIHSYNQIFC----------------------------LCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYG-DCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGY--IFHNSTCLD------INECIRNPCGHGE-----------CINESPGYSCSCH----SGYVDVDNVC----------RDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS---ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF 1095
            C C DG+ L  DG+ C D++ECV  P  C    C N  G++ C C  G+  Q   CVDINEC  N     CQ   CKN  G +QC C   PG  LSD       + E+    +   G CS     +  +  C                            LCP G+E     +   D+NECV     C N  C+N  GS  C+C  GY     G +C D +EC   +   +  C N  G   C+C+ GF+      C D +EC ++   C   C N  G+++C C  G+ L  DN  C D++EC  G+ +C   G  C N  G+F C C PG     D   CMD+NEC +   +C +G C N  G+Y C+C+ G+      + C+D        E ++  C               C N   G+   C      G +    +C          RD +EC +  N C   G+C N  GSF C C  GY  +F    C D++E S    PC  +  C N +GS+ C C +G+I  Q D   C D DEC +    H+    C NT+GGF C C +GF   +     C D NEC+     C     C+N  GS  C C +G+  D  G NC   DEC  + R    CQ  C N+ GG +C C  GY+   Q  + CVD+NECT N      +C N LG + C C  GF   E     C     CS+ N  CS+ C +T+ G  + C CP GF
Sbjct: 1959 CLCLDGYNLTPDGKNCVDINECVTLPGACQPGTCQNLDGSFRCICPPGYEVQNDKCVDINEC--NVEPNICQFGTCKNTPGSFQCIC--QPGFVLSDNGRRCFDTRESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGREDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCSNVPGGFECSCQEGFEPGPMMTCEDINECAVNPLLCAFRCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMTRRPDGEGCMDLNECRSKPGICKNGRCVNTVGSYRCECNEGFEASATGTECIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDGRDINECEVMPNLC-KNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDECSQSPKPC--NFLCKNTEGSYLCSCPRGYIL-QPDGKTCKDLDECSTKQ--HNCQFLCVNTIGGFTCKCPSGFTQHQT---ACIDNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCDDVDECGGNHR----CQHGCQNMMGGYRCGCPQGYVQHYQWNQ-CVDENECTGNQVCGSASCYNTLGSYKCVCPSGFD-FEATAGGCQDVNECSMGNNPCSYGCSNTDGG--YLCGCPGGF 2685          

HSP 6 Score: 231.106 bits (588), Expect = 2.398e-59
Identity = 198/585 (33.85%), Postives = 284/585 (48.55%), Query Frame = 0
Query:  448 EDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDL-MDETECFD--------------------------KDECEMDNG-GCEQVCN--NLEGTFQ----CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP-CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            ED++ECV++PE+C + +C N  G++ C+C  G+     G  CVD +EC + N   PC +  C NV GG++C C  G  PG  +      TC     C VN   C+  C++++    C+CP GY L +D + C D +EC  G   C ++   C N  G+  C C  G     +G+ C D+NEC ++  IC +  C+NT GS  C C  GF+     TEC D                          K EC  + G G   +C    L GT Q    C   PG+   TD     D NEC + + N    G CIN+ GSF C C+ G+  +    SC+D++EC+ S    +  C N EG+Y C C  GYI      TC D++EC  +       C+N   G++C C SG+      C D +EC +  N CG    C N PGSF+C+C  G+        C D++E          HG C N  G + C C QG++      N C+D +EC  +  C  + C NTLG ++C+C +GF   E     C+D+NEC++ N  CS  C N  G + C C  G+ +  +G+C 
Sbjct: 2130 EDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGN---PCGNGTCSNVPGGFECSCQEGFEPGPMM------TCEDINECAVNPLLCAFRCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMTRRPDGEGCMDLNECRSKPGICKNGRCVNTVGSYRCECNEGFEASATGTECIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGY--TTDG---RDINECEV-MPNLCKNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDECSQSPKPCNFLCKNTEGSYLCSCPRGYILQPDGKTCKDLDECSTKQHNCQFLCVNTIGGFTCKCPSGFTQHQTACIDNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCDDVDECGGNHRC--QHG-CQNMMGGYRCGCPQGYVQ-HYQWNQCVDENECTGNQVCGSASCYNTLGSYKCVCPSGFDF-EATAGGCQDVNECSMGNNPCSYGCSNTDGGYLCGCPGGFYRAGQGHCI 2694          

HSP 7 Score: 208.379 bits (529), Expect = 1.863e-52
Identity = 238/756 (31.48%), Postives = 329/756 (43.52%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEA-----CQVNNGGCSHECIHSYNQIFCLCPD-------------GYELDEDWKTCV----------DINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTD-----------ENECTIGIANCGIYGDCINTPGSFY------CE----CHPGFELMED-SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDI-NECIRNPCGHGECINESPGY----SCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFD-CDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACS----VNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C C+ GF ++ DG+ C D DEC       + +C N+ G++ C C+ GF     G  C DI+EC  +   G C +  C N +G ++CEC   PG  + D D   C+           +  G CS     +  +  C C +              +   E    C           DINEC      C N  C N+ GS  C C+ GYE    G +C DINEC    L+CD+  C NT GS  C+C  GF    ++E C D +EC+  N     +C N+ G+F C C  G  L++ N  C D           +  C + I    +  +C +T G+ +      CE    C  GF  M+   C DINEC     +C +G C N +G++ C+C  G     +  TC+D+ +E         EC+   PG      C C  G         D + C   N       C   PG  +  D   G  F      D+NE  + +  C  HG C N  GSF+C C  GF     + N C D DEC  SP  C H  C NT G FEC C  G+    ++   C DI+EC  +   C    C+N  GS+ C C  G++   E   C   +EC+LS      C+   C+N+ G  +C C  GY V + D + CVD +ECTI NGGC   C N  G + CSC  G+   PD +    C     C     + +GG     + T     +RC+C  GF    D RTC  +
Sbjct:  560 CICNAGFEISPDGKNCIDHDECATTNMCLNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECHTS---GICMNGRCVNTEGSFRCEC--PPGLAI-DVDGRVCVDTHMRTTCYGAIKMGVCSRPFPGAVTKSECCCANPEHGFGEPCQPCPAFNSAEFQAVCSSGPGITTDGRDINECALDPDICQNGICENLRGSYRCICNIGYESDASGKNCVDINECLVNRLLCDNGMCRNTPGSYTCSCPKGFSFKADSETCEDINECD-SNPCINGICRNIAGSFNCECSHGSKLDSTNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSECCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFPGVCTNGRCVNTQGSFRCECPEGLTLDGAGRTCVDVRSEQCYMKWDEDECVEPLPGRYRVDMCCCTVGAAWG----VDCEACPKPNTNEFKTICPRGPGIANRGDILTGRPFY----KDVNECKVFRGLC-THGTCRNTIGSFKCRCDSGFALTMEERN-CTDIDECTISPDLCGHGVCVNTPGSFECECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCLNTEGSYECDCPPGHQLSTEASACEDVNECQLSDNL---CKHGQCVNMVGTYQCSCETGYQV-TPDRQGCVDIDECTIMNGGCDTHCTNSEGSYECSCSEGYALMPDLR---TCADIDECEDTPDICDGG-----QCTNIPGEYRCLCYDGFMASMDMRTCIDV 1286          

HSP 8 Score: 206.068 bits (523), Expect = 8.260e-52
Identity = 258/843 (30.60%), Postives = 351/843 (41.64%), Query Frame = 0
Query:  450 VDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTA-CVDINECLLNNGHGPCQD-ECKNVDGGYQCECG-GLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFD---KDEC--EMDNGGC-----------EQVCNNLE---------------GTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE--LMEDSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSC-HSGYVDVDN-VCRDYDEC-----LHDNPCGVG-------GKCNNKPGS----------FDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF----HSECKNTLGGF----ECLCETGFALSEIL-----PNTCE-------------------------DINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY---------IVD----SQDPRLCV-----------------------------DKNECTINNGGCQHA-CINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            +D C     LC +  C   P +Y C+C +G+       C+D++EC+ N    PC + +C N  G Y C+C  G  GT         CI  + C VN   C +  C+++     C+C  G+E+  D K C+D +EC T ++ CLN  C+N  GS  C C  G+     G  C+DI+EC T  +  +  C+NTEGS  C C  G  + +D   C D   +  C   +  G C           E  C N E                 FQ  C  G  + TD     D NEC +    C   G C N  GS+ C C+ G+E      +C+DINEC  N  LC +G C N  G+Y C C  G+ F   + TC DINEC  NPC +G C N +  ++C C H   +D  N VC D  +      + D  C V         +C +  G+           D  C+ G+   K   C DINE  +    C  +G CVN  GSF C C +G   D      C+D     S  C+      EC   L G      C C  G A          PNT E                         D+NEC +  G C+   C N +GS  CRC  G+    E  NC   DEC +S    G    +C+N PG  +CEC  GY          +D     +DP LC                              D NEC +++  C+H  C+N +G + CSC  G++  PD +    CV    C++ NGGC   C ++E    + C C  G+ L  D RTC  I           GG C++ P    G YRC
Sbjct:  455 IDVCKHFTNLCLNGRCIPTPTSYRCECNMGYRQDVRGECIDVDECVSN----PCVNGDCVNTQGSYHCKCHEGYQGTPTK----QACIDIDECIVNGVMCRNGRCVNTDGSFQCICNAGFEISPDGKNCIDHDECATTNM-CLNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECHTSGICMNGRCVNTEGSFRCECPPGLAIDVDGRVCVDTHMRTTCYGAIKMGVCSRPFPGAVTKSECCCANPEHGFGEPCQPCPAFNSAEFQAVCSSGPGITTDG---RDINECALDPDIC-QNGICENLRGSYRCICNIGYESDASGKNCVDINECLVNRLLCDNGMCRNTPGSYTCSCPKGFSFKADSETCEDINECDSNPCINGICRNIAGSFNCECSHGSKLDSTNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSECCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFPGVC-TNGRCVNTQGSFRCECPEGLTLD-GAGRTCVDV---RSEQCYMKWDEDECVEPLPGRYRVDMCCCTVGAAWGVDCEACPKPNTNEFKTICPRGPGIANRGDILTGRPFYKDVNECKVFRGLCTHGTCRNTIGSFKCRCDSGFALTMEERNCTDIDECTISPDLCG--HGVCVNTPGSFECECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCLNTEGSYECDCPPGHQLSTEASACEDVNECQLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQG---CVDIDECTIMNGGCDTHCTNSEG--SYECSCSEGYALMPDLRTCADIDECEDTPDICDGGQCTNIP----GEYRC 1268          

HSP 9 Score: 206.068 bits (523), Expect = 8.330e-52
Identity = 242/785 (30.83%), Postives = 330/785 (42.04%), Query Frame = 0
Query:  448 EDVDECVDDPELCDHI-CTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGH-GPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN-NGGCSHECIHSYNQIFCLCPDGYELDEDW----KTC----------------------------VDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYEGDD----CSDINECETQDLIC--DHNCINTEGSAHCTCKAGFDLMDETECFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS-CMDINECT--NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEX----SLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLH-HRCMCPSGFKLKTDARTCKPIG------GICSSAPRPSN--GYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGT 1162
            ED+DEC + P LC    C N  G++ C+C  G+    +   C DI+EC  + G  GP    C N  G Y C C      Q++  +N   +    C  N N  C +E   +  +  C C   Y + + W    + C                            +DI+EC      C N  C+N  GS  C+C  G+  ++    C DI+EC + D +C  + NCIN  GS  C C AGF L     C D++EC E+ N      C + +G+F+C C  GF    D   C D +EC      CG  G C NT GS+ C C PGFEL  ++ CMDI+EC+   S +C +G C N  G+++C C  GY        C+DINEC+  P  C  G C N    + C C  GY   ++ C D +EC +  N C   G C N PGSF C C PG+   +    C D  E       E   C        N    +C C              +   E    PC           F  LC  G   +   P   ED+NEC  N   C   +C+N  GS  C C  GY  D  G NC   DEC +      G    C N+PGG +C C  G+  +      C D NEC +N   C   C+N  G + C C  G+   + N   C     C+     C+    + ++ +    C+CP G   + D   C  +       GIC +  R  N  G YRC   +       GT+C +  RKGF  T  +   C  + T
Sbjct: 1609 EDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGICGP--GTCYNTLGNYTCVCP-PEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMCCC--AYNVGKAWNRPCEACPTPATSEYQLLCGNQAPGFIIDIHTGKPIDIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQRNANCINIPGSYRCECSAGFKLSPSGACIDRNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMDIDECD--RQPCG-NGTCKNTVGSYNCLCFPGFELTHNNDCMDIDECSVHASQVCRNGQCINNMGSFKCLCLDGYNLTPDGKNCVDINECVTLPGACQPGTCQNLDGSFRCICPPGYEVQNDKCVDINECNVEPNICQF-GTCKNTPGSFQCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKCSVPKP--RNTTKAKCCCS-------------LLPGEGWGDPCELCPRDTEEAAFHTLCPYGHE-AVPKPEGREDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNG---TCSNVPGGFECSCQEGF--EPGPMMTCEDINECAVNPLLCAFRCVNTFGSYECMCPTGYVLRDDN-RMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMTRRPDGEGCMDLNECRSKPGICKNG-RCVNTVGSYRCECNEGFEASATGTEC-IDNRKGFCFTEVLQTMCQQSST 2360          

HSP 10 Score: 177.948 bits (450), Expect = 3.831e-43
Identity = 209/691 (30.25%), Postives = 295/691 (42.69%), Query Frame = 0
Query:  446 ECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGF--TSQGTACVD--INECLLNNGHGPCQDECKNVDGGYQCEC--------GGLPG---TQLSDKDNHTCISDEACQVNNGGCSHE---------------------------CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNPC----GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDE---------RGNCFLK-DECRLSRRPNGG-CQQLCINIPGGL------KCECNPGYI--VDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPD 1054
            +CED+DEC     +CD   CTN  G+Y+C C  G+  ++ G+ CVD  I  C  +  +G C  E        QC C        G +P     + SD+    CI        NGG  H+                             H++           ++ +  +T +D+ +  T    CLN +C+  P S  C+C+ GY  D   +C D++EC +   + + +C+NT+GS HC C  G+     +  C D DEC ++   C    C N +G+FQC C  GF ++ D   C D +EC     N  + G CIN  GSF C C PGF L  +   C DI+EC  S +C +G C N EG++ C+C  G         C+D +  +R  C      G C    P        G V     C    E     PC      N+      C   PG         DINE +L+ D C  +G C N  GS+ C+C+ G+  D +  N C+D +ECL +   C +  C+NT G + C C  GF+  +    TCEDINEC  N   NG    +C NI GS  C C  G K D          +G C+L   + R     NG   +  C +  G        +CE +P            +C D NEC +  G C +  C+N  G   C C  G   D
Sbjct:  284 KCEDIDECATISGVCDGGECTNTAGSYVCTCPRGYITSTDGSRCVDHRIGTCFSSLANGRCASELSGQYTKMQCCCDTGRCWALGHIPEMCPVRGSDEYRRLCIQRLPFGTGNGGIIHDGNGGLNIGGYGKGPSQNGNGGGGYIYGSEHTFTNGNGNGGQKIQISQLNETTIDVCKHFTN--LCLNGRCIPTPTSYRCECNMGYRQDVRGECIDVDECVSNPCV-NGDCVNTQGSYHCKCHEGYQGTPTKQACIDIDECIVNGVMCRNGRCVNTDGSFQCICNAGFEISPDGKNCIDHDECA--TTNMCLNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECHTSGICMNGRCVNTEGSFRCECPPGLAIDVDGRVCVDTH--MRTTCYGAIKMGVCSRPFP--------GAVTKSECCCANPEHGFGEPCQPCPAFNSAEFQAVCSSGPGITTDG---RDINECALDPDIC-QNGICENLRGSYRCICNIGYESDASGKN-CVDINECLVNRLLCDNGMCRNTPGSYTCSCPKGFSF-KADSETCEDINECDSNPCING----ICRNIAGSFNCECSHGSKLDSTNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSECCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFPGVCTNGRCVNTQGSFRCECPEGLTLD 949          

HSP 11 Score: 131.339 bits (329), Expect = 5.890e-29
Identity = 140/482 (29.05%), Postives = 199/482 (41.29%), Query Frame = 0
Query:  741 STLCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP-CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNGGCQQLCINIPG------GLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKC 1203
            + LC +G C     +Y C+C+ GY       C+D++EC+ NPC +G+C+N    Y C CH GY        C D DEC+ +      G+C N  GSF C C  G+E      + I+           +G C+N DGSF+C+C  GF    N    C D DEC +S  C +  C NT G F C C  G A+         D++          +VCV+      C     Y   + G C         K EC  +  P  G  + C   P          C   PG   D +      D NEC ++   CQ+  C N  G + C C++G++ D    + CV    C VN   C + +C++T     + C CP GF  K D+ TC+ I   C S P   NG  R     ++G F     C+         T  +    +    W   +D  CEV        ++   +  E C T  +  GS C
Sbjct:  462 TNLCLNGRCIPTPTSYRCECNMGYRQDVRGECIDVDECVSNPCVNGDCVNTQGSYHCKCHEGYQGTPTKQACIDIDECIVNGVMCRNGRCVNTDGSFQCICNAGFEISPDGKNCIDHDECATTNMCLNGMCINEDGSFKCICKPGFALAPN-GRYCTDIDECHTSGICMNGRCVNTEGSFRCECPPGLAI---------DVD---------GRVCVDTHMRTTC-----YGAIKMGVCSRPFPGAVTKSECCCA-NPEHGFGEPCQPCPAFNSAEFQAVCSSGPGITTDGR------DINECALDPDICQNGICENLRGSYRCICNIGYESDASG-KNCVDINECLVNRLLCDNGMCRNTPG--SYTCSCPKGFSFKADSETCEDI-NECDSNP-CINGICR----NIAGSF----NCECSHGSKLDSTNTVCVDSMKGTCWLNIQDGRCEVN-------INGATLKSECCSTLGAAWGSPC 892          

HSP 12 Score: 109.383 bits (272), Expect = 2.224e-22
Identity = 82/247 (33.20%), Postives = 106/247 (42.91%), Query Frame = 0
Query:  414 QEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECG---GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFD 652
            Q  K C  +C   +G +  C C  G+ L  DG+ C+D+DEC      C  +C N  G + C C  GFT   TAC+D NEC         +  C N  G + CEC     L  T L+  D   C  +  CQ       H C +      C CP GY     W  CVD NEC    +     C N  GS  C C SG++       C D+NEC   +  C + C NT+G   C C  GF    +  C +
Sbjct: 2457 QSPKPCNFLCKNTEG-SYLCSCPRGYILQPDGKTCKDLDECSTKQHNCQFLCVNTIGGFTCKCPSGFTQHQTACIDNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCDDVDECGGNHRCQ-------HGCQNMMGGYRCGCPQGYVQHYQWNQCVDENECTGNQVCGSASCYNTLGSYKCVCPSGFDFEATAGGCQDVNECSMGNNPCSYGCSNTDGGYLCGCPGGFYRAGQGHCIN 2695          

HSP 13 Score: 55.0694 bits (131), Expect = 8.198e-6
Identity = 50/135 (37.04%), Postives = 63/135 (46.67%), Query Frame = 0
Query:  678 CKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME--DSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLD--INECIRNPCGHGECINESPG----YSCSCHSG 801
            C+ GF  N     C D +EC      C   G+CINT GS+ C+C  G    E    C DI+EC T S +C  G C N  G+Y C C  GYI     S C+D  I  C  +   +G C +E  G      C C +G
Sbjct:  230 CRRGFIPNIRTGACQDVDECQAVPGLCA-GGNCINTVGSYECKCPAGHRQSETNQKCEDIDECATISGVCDGGECTNTAGSYVCTCPRGYITSTDGSRCVDHRIGTCFSSL-ANGRCASELSGQYTKMQCCCDTG 362          

HSP 14 Score: 48.9062 bits (115), Expect = 6.437e-4
Identity = 33/87 (37.93%), Postives = 45/87 (51.72%), Query Frame = 0
Query:  844 FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALS 927
             + G C D++E       C   G+C+N  GS+EC C  G  H Q+++N  C D DEC  +S  C   EC NT G + C C  G+  S
Sbjct:  238 IRTGACQDVDECQAVPGLCA-GGNCINTVGSYECKCPAG--HRQSETNQKCEDIDECATISGVCDGGECTNTAGSYVCTCPRGYITS 321          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:si:ch73-105b23.1 "si:ch73-105b23.1" species:7955 "Danio rerio" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 ZFIN:ZDB-GENE-081107-41 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 InterPro:IPR024731 Pfam:PF12947 Gene3D:2.40.155.10 InterPro:IPR023413 OrthoDB:EOG7RV9F6 TreeFam:TF316849 GeneTree:ENSGT00740000114998 EMBL:CU570977 ProteinModelPortal:F1QW35 Ensembl:ENSDART00000123587 OMA:CNETDDC Uniprot:F1QW35)

HSP 1 Score: 266.159 bits (679), Expect = 8.120e-71
Identity = 238/688 (34.59%), Postives = 314/688 (45.64%), Query Frame = 0
Query:  432 TCECHDGFFLNDDGECEDVDECVDDPELCDHI--------------------------------------------CTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD--CSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ--VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF-ELMEDSCMDINECTNSTLC-GSGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-IRNPCG-HGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNP-CGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDP-CGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE--CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV--CVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL--CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN-----NGGCQHACINKLGGHTCSCHLGF 1051
             C C+ G+  N +  C DVDEC + P +C  +                                            CTN PG+Y C C  GF   G ACVDINEC   N   P    C N+ G Y+C C  G  G      D + C +D  C          C+++    FC C  GY   ++   CVD++EC  G       C N+PGS  C C +G++GD   C D++EC T+   C  N  CIN+ G  +C+C  G+     ++C D +EC +DNGGC+    C+N +G++ C C  GF L  ++ TC D +EC +    CG    C N  GS+ C+C  GF  +++D C DINEC     C  + +C NL G+Y C C SG+  +  TC DINEC +   C  H  C N    Y C CH G+      C D DEC   N  C     C N  G++ C C  G    N  C      SLE DP C PHG C  +   F+CVC  GF   + D   C D DEC  + C   E  C N  G FEC C+ G++ +      C D++EC     +CS+   CVN +GSH C C  G+  D + NC   +EC      NGGC  +  C N PG  KC C  G      D   C D +EC  N     N      C N  G + C C  G+
Sbjct:   93 VCTCNSGYKGNGNYLCLDVDECSETPGVCSALLGYKGCKNLQGTYTCLCNSGYQSNGQTCVDINECQINFCSPFADCTNLPGSYRCTCPEGFNGNGLACVDINECDRKNSCDP-NALCTNLLGSYKCSCRSGFLGIGTKCTDINECATDNICPA-----VAACVNTAGSFFCDCGQGYNFTQNQ--CVDLDECAIGLCSPYASCENMPGSYKCSCIAGFKGDGLVCEDVDECVTEKR-CHVNALCINSPGKYNCSCMVGYTGNGVSQCTDINECLVDNGGCKNRATCSNSKGSYSCICPSGFRL-VNHTTCQDIDECQLPEKVCGTNEQCTNLEGSYSCQCKAGFSRIIDDFCSDINECDIQKPCHQNATCLNLVGSYSCTCKSGFKGNGVTCEDINECALGGICHLHANCYNYIGEYLCVCHQGFTGDGVTCTDVDECYVSNATCPGISVCVNSLGAYVCSCLNGTVAYNNTCV---FPSLECDPACHPHGLCHPSPSGFQCVCDVGF---KGDGLTCSDIDECEENVCPEKETQCVNNPGSFECTCKEGYSFNGT---KCTDLDECESGVSNCSKFAQCVNTVGSHLCFCLSGFTGDGK-NCSDINECHFQ---NGGCHPVASCTNSPGSFKCTCPLGMTGSGFD---CQDVDECNANSTLPHNCSLLSTCHNTEGSYICKCMEGY 754          

HSP 2 Score: 252.292 bits (643), Expect = 1.845e-66
Identity = 259/794 (32.62%), Postives = 355/794 (44.71%), Query Frame = 0
Query:  432 TCECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCI-----SDEACQVNNGGCSHECIHSYNQIF-CLCPDGYELDEDWKTCVDINEC---VTGDIQCLNKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDH--NCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQV--CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIA---NCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSG-SCNNLEGTYECKCDSGYIFHNSTCLDINEC--IRNPCG-HGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--------SSPCF-----------------------------------HSECKNTLGGFECLCETGFALSEILPNTCEDINECAL--NNGDCSQ-VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQ--QLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGC--QHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC--SHICKSTESGLHHRCMCPSGFKLKT----------DARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCK 1140
            +C C  GF  N    CED++EC        H  C N  G Y+C C  GFT  G  C D++EC ++N   P    C N  G Y C C  L GT      N+TC+      D AC        H   H     F C+C  G++   D  TC DI+EC   V  + +   +C+N PGS  C C  GY   G  C+D++ECE+    C     C+NT GS  C C +GF   D   C D +EC   NGGC  V  C N  G+F+C C  G  +      C D +EC        NC +   C NT GS+ C+C  G+     +C D++EC   ++CG+  +C N  GT+ C C  G ++   TC+   +C    N C  + EC N      CSC  G+      C+D DEC     C     C N  GSF CDC  GY++    C DINE S+    C  +  C N  G + C C+ GFI+  N  ++C+D DEC         +S C                                    HS C NTLG F CLC+ GF L+      CEDI+EC+   N   C+   C+N +GS  C C  G++ +   +CF  DEC  S+  +  CQ    C NIPG  KC C+ G++++  +   C D +EC  ++  C     CIN +G   C C  GFK D     KC     C ++NG C    +C +      + C CP G + ++          +  TC P+     +    + G + C  +   GY   GT CK
Sbjct:  461 SCTCKSGFKGNGV-TCEDINECALGGICHLHANCYNYIGEYLCVCHQGFTGDGVTCTDVDECYVSNATCPGISVCVNSLGAYVCSC--LNGTVAY---NNTCVFPSLECDPACH------PHGLCHPSPSGFQCVCDVGFK--GDGLTCSDIDECEENVCPEKE--TQCVNNPGSFECTCKEGYSFNGTKCTDLDECESGVSNCSKFAQCVNTVGSHLCFCLSGF-TGDGKNCSDINECHFQNGGCHPVASCTNSPGSFKCTCPLG--MTGSGFDCQDVDECNANSTLPHNCSLLSTCHNTEGSYICKCMEGYWGNGFTCSDLDECFPPSICGNNMTCQNFPGTFTCTCTLGLVYDLGTCVTEKDCKNATNACNIYAECKNVHGSNYCSCMKGFHGNGRDCKDLDECSQIGACPNLSNCFNTEGSFHCDCLQGYQYNGTHCDDINECSVGNFSCPVNSTCYNEVGGYNCSCNNGFIYSYN--SVCLDVDECATGKAQCPNASNCHNTVGSYYCECWDGYIGNQTICEDVNECLNNSRCSDHSICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSICTNGTCLNTIGSFGCVCDMGFRSNGT-SCFDIDECSGSQNES-ICQLHSTCSNIPGSYKCHCDSGFLLNRTE---CQDIDECLADDSPCTANSVCINSVGSFRCLCASGFKEDGL---KCTDINEC-LSNGTCRPDQVCINKPG--SYLCSCPPGHQEESGNCIDNNECANNTTCHPL-----ARCWNTVGTFTCQCRL--GYVGNGTYCK 1215          

HSP 3 Score: 249.21 bits (635), Expect = 1.742e-65
Identity = 227/707 (32.11%), Postives = 315/707 (44.55%), Query Frame = 0
Query:  463 ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINEC-----VTGDIQCLNKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCE--QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGH--GECINESPGYSCSCHSGYV-DVDNVCRDYDECLHDN-PCGVGGKCNNKPGSFDCDCAPGYEFKN-GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCEDINECAL----------------------------------------NNGDCS--QVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGC---QHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            +CTN  G+Y C C+ G++  G  C DINEC  NNG       C N DGG  C C  G  G      D++ C     C  N       C ++     C C  GY+ + ++  C+D++EC     V   +     C N+ G+  C C+SGY+  G  C DINEC+        +C N  GS  CTC  GF+  +   C D +EC+  N  C+   +C NL G+++C C+ GF        CTD NEC      C     C+NT GSF+C+C  G+   ++ C+D++EC         SC N+ G+Y+C C +G+      C D++EC+     H    CIN    Y+CSC  GY  +  + C D +ECL DN  C     C+N  GS+ C C  G+   N   C DI+E  L +  CG +  C N +GS+ C C  GF    +D   C D +EC +  PC   + C N +G + C C++GF  + +   TCEDINECAL                                        +N  C    VCVN LG++ C C  G         F   EC  +  P+G    LC   P G +C C+ G+     D   C D +EC  N   C   +  C+N  G   C+C  G+     N  KC     C      CS   +   +   H C C SGF    D + C  I
Sbjct:    3 VCTNTLGSYTCSCQNGYSGDGFQCQDINECQTNNGDCHANALCTNKDGGRDCSCRSGFSGNGFQCTDDNECARPGICHWN-----ATCTNNPGSYVCTCNSGYKGNGNY-LCLDVDECSETPGVCSALLGYKGCKNLQGTYTCLCNSGYQSNGQTCVDINECQINFCSPFADCTNLPGSYRCTCPEGFN-GNGLACVDINECDRKNS-CDPNALCTNLLGSYKCSCRSGFL--GIGTKCTDINECATDNI-CPAVAACVNTAGSFFCDCGQGYNFTQNQCVDLDECAIGLCSPYASCENMPGSYKCSCIAGFKGDGLVCEDVDECVTEKRCHVNALCINSPGKYNCSCMVGYTGNGVSQCTDINECLVDNGGCKNRATCSNSKGSYSCICPSGFRLVNHTTCQDIDECQLPEKVCGTNEQCTNLEGSYSCQCKAGFSRIIDD--FCSDINECDIQKPCHQNATCLNLVGSYSCTCKSGFKGNGV---TCEDINECALGGICHLHANCYNYIGEYLCVCHQGFTGDGVTCTDVDECYVSNATCPGISVCVNSLGAYVCSCLNGTVAYNNTCVFPSLECDPACHPHG----LCHPSPSGFQCVCDVGF---KGDGLTCSDIDECEENV--CPEKETQCVNNPGSFECTCKEGYS---FNGTKCTDLDECESGVSNCSKFAQCVNTVGSHLCFCLSGF--TGDGKNCSDI 679          

HSP 4 Score: 248.825 bits (634), Expect = 1.884e-65
Identity = 246/731 (33.65%), Postives = 346/731 (47.33%), Query Frame = 0
Query:  440 FLNDDGECEDVDECVDD--PELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCS--HECIHSYNQIFCLCPDGYELDEDWKTCVDINEC-----VTGDIQCLNKCMNVPGSAYCKCDSGYEGDD--CSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCE--QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECT--NSTLCGSGSCNNLEGTYECKCDSGYIF-HNSTCLDINECIRNPCGHGECINES------PGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF---KNGXCHDINEXSL-EKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP----C-FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCS--QVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQ--QLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQ--HACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF----KLKTDARTCKPIGGICSSAPRPSN--GYYRC 1124
            F  D   C D+DEC ++  PE  +  C N PG++ C C+ G++  GT C D++EC     +     +C N  G + C C  G  G      D   C     C   NGGC     C +S     C CP G  +      C D++EC     +  +   L+ C N  GS  CKC  GY G+   CSD++EC     IC +N  C N  G+  CTC  G  + D   C  + +C+     C     C N+ G+  C C  GFH N  +  C D +EC+  I  C    +C NT GSF+C+C  G++     C DINEC+  N +   + +C N  G Y C C++G+I+ +NS CLD++EC     G  +C N S        Y C C  GY+    +C D +ECL+++ C     C N  GSF C C  G+      +  C DI+E S  +      +G C+N  GSF CVC  GF   +++   C D DEC  S     C  HS C N  G ++C C++GF L+      C+DI+EC  ++  C+   VC+N +GS  C C  G+K+D    C   +EC      NG C+  Q+CIN PG   C C PG+  +S +   C+D NEC  NN  C     C N +G  TC C LG+     N   C     CS ++  C    K   +   + C+C +GF     +  D   C+   GIC  A    N  G ++C
Sbjct:  588 FKGDGLTCSDIDECEENVCPEK-ETQCVNNPGSFECTCKEGYSFNGTKCTDLDECESGVSNCSKFAQCVNTVGSHLCFCLSGFTG------DGKNCSDINECHFQNGGCHPVASCTNSPGSFKCTCPLG--MTGSGFDCQDVDECNANSTLPHNCSLLSTCHNTEGSYICKCMEGYWGNGFTCSDLDECFPPS-ICGNNMTCQNFPGTFTCTCTLGL-VYDLGTCVTEKDCKNATNACNIYAECKNVHGSNYCSCMKGFHGNGRD--CKDLDECSQ-IGACPNLSNCFNTEGSFHCDCLQGYQYNGTHCDDINECSVGNFSCPVNSTCYNEVGGYNCSCNNGFIYSYNSVCLDVDECAT---GKAQCPNASNCHNTVGSYYCECWDGYIGNQTICEDVNECLNNSRCSDHSICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSICTNGTCLNTIGSFGCVCDMGF---RSNGTSCFDIDECSGSQNESICQLHSTCSNIPGSYKCHCDSGFLLNRT---ECQDIDECLADDSPCTANSVCINSVGSFRCLCASGFKEDGL-KCTDINECL----SNGTCRPDQVCINKPGSYLCSCPPGHQEESGN---CIDNNECA-NNTTCHPLARCWNTVGTFTCQCRLGYV---GNGTYCKDIDECSTSSSRCHKSSKCINTPGSYVCVCAAGFVALGSVCVDLDECQANRGICHPAATCYNSIGGFQC 1283          

HSP 5 Score: 237.654 bits (605), Expect = 5.936e-62
Identity = 238/700 (34.00%), Postives = 329/700 (47.00%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI--CTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECG-GLPGTQLSDKDNHTCISDEACQVNNGGCS--HECIHSYNQIFCLCPDGYELDEDWK---TCVDINECVTGDIQCLNK--CMNVPGSAYCKCDSG--YEGDDCSDINECETQDLICD--HNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQV--CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS-CMDINEC-TNSTLCGSGS-CNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYV---DVDNVCRDYDECLHDNPCGV--GGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDP--CGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPC-FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC--SQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL--CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA--CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF 1095
            C C +G+  N   +C D+DEC      C     C N  G+++C C  GFT  G  C DINEC   NG       C N  G ++C C  G+ G+    +D   C ++     N   CS    C ++     C C +GY     W    TC D++EC    I C N   C N PG+  C C  G  Y+   C    +C+     C+    C N  GS +C+C  GF   +  +C D DEC    G C  +  C N EG+F C C  G+  N  +  C D NEC++G  +C +   C N  G + C C+ GF    +S C+D++EC T    C + S C+N  G+Y C+C  GYI + + C D+NEC+ N     H  C+N    + C C  G+      D  C D DEC + +   +   G C N  GSF C C  G+      C DI+E S  ++   C  H  C N  GS++C C  GF+ ++ +   C D DECL+  SPC  +S C N++G F CLC +GF    +    C DINEC L+NG C   QVC+N  GS+ C C  G++ +E GNC   +EC      N  C  L  C N  G   C+C  GY+    +   C D +EC+ ++  C  +  CIN  G + C C  GF         CV    C  N G C        S    +C C +G+
Sbjct:  622 CTCKEGYSFNGT-KCTDLDECESGVSNCSKFAQCVNTVGSHLCFCLSGFTGDGKNCSDINECHFQNGGCHPVASCTNSPGSFKCTCPLGMTGSGFDCQDVDECNANSTLPHN---CSLLSTCHNTEGSYICKCMEGY-----WGNGFTCSDLDECFPPSI-CGNNMTCQNFPGTFTCTCTLGLVYDLGTCVTEKDCKNATNACNIYAECKNVHGSNYCSCMKGFH-GNGRDCKDLDECSQI-GACPNLSNCFNTEGSFHCDCLQGYQYNGTH--CDDINECSVGNFSCPVNSTCYNEVGGYNCSCNNGFIYSYNSVCLDVDECATGKAQCPNASNCHNTVGSYYCECWDGYIGNQTICEDVNECLNNSRCSDHSICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSICTNGTCLNTIGSFGCVCDMGFRSNGTSCFDIDECSGSQNESICQLHSTCSNIPGSYKCHCDSGFLLNRTE---CQDIDECLADDSPCTANSVCINSVGSFRCLCASGFKEDGL---KCTDINEC-LSNGTCRPDQVCINKPGSYLCSCPPGHQ-EESGNCIDNNECA----NNTTCHPLARCWNTVGTFTCQCRLGYV---GNGTYCKDIDECSTSSSRCHKSSKCINTPGSYVCVCAAGFVAL---GSVCVDLDECQANRGICHPAATCYNSIGGFQCQCGNGW 1289          

HSP 6 Score: 233.032 bits (593), Expect = 1.745e-60
Identity = 264/851 (31.02%), Postives = 368/851 (43.24%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI--CTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQ--DECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ--VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINEC--TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDIN-ECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFH--SECKNTLGGFECLCETGFALSEILPNTCEDINECALNNG---DCSQV--CVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQ--HACINKLGGHTCSCHLGFKP---DEKNPEKCVKAKAC-SVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHN-----------GNISPETCMTDSSP--RGSKC-------------LFTCNNGYQITGVKKTRCTRLSE 1226
            C C  GF L    +C D++EC  D  +C  +  C N  G++ CDC  G+      CVD++EC +    G C     C+N+ G Y+C C  G  G  L  +D   C++++ C VN       CI+S  +  C C  GY        C DINEC+  +  C N+  C N  GS  C C SG+       C DI+EC+  + +C  N  C N EGS  C CKAGF  + +  C D +EC++    C Q   C NL G++ C CK GF  N   +TC D NEC +G   C ++ +C N  G + C CH GF     +C D++EC  +N+T  G   C N  G Y C C +G + +N+TC+  + EC      HG C     G+ C C  G+      C D DEC  +       +C N PGSF+C C  GY F    C D++E       C     CVN  GS  C C  GF  D  +   C D +EC   +   H  + C N+ G F+C C  G   S      C+D++EC  N+    +CS +  C N  GS+ C+C EGY  +    C   DEC        G    C N PG   C C  G + D      CV + +C      C     C N  G + CSC  GF     D K+ ++C +  AC +++N      C +TE   H  C C  G++           G  C      S G + C         V G  C   C  GF+ +         N      ++ A     CP     HN           G I  +T   D +     S+C             +  C++G+ + G   T+C  + E
Sbjct:  218 CSCRSGF-LGIGTKCTDINECATD-NICPAVAACVNTAGSFFCDCGQGYNFTQNQCVDLDECAI----GLCSPYASCENMPGSYKCSCIAGFKGDGLVCEDVDECVTEKRCHVN-----ALCINSPGKYNCSCMVGY-TGNGVSQCTDINECLVDNGGCKNRATCSNSKGSYSCICPSGFRLVNHTTCQDIDECQLPEKVCGTNEQCTNLEGSYSCQCKAGFSRIIDDFCSDINECDIQKP-CHQNATCLNLVGSYSCTCKSGFKGN--GVTCEDINECALG-GICHLHANCYNYIGEYLCVCHQGFTGDGVTCTDVDECYVSNATCPGISVCVNSLGAYVCSCLNGTVAYNNTCVFPSLECDPACHPHGLCHPSPSGFQCVCDVGFKGDGLTCSDIDECEENVCPEKETQCVNNPGSFECTCKEGYSFNGTKCTDLDECESGVSNCSKFAQCVNTVGSHLCFCLSGFTGDGKN---CSDINECHFQNGGCHPVASCTNSPGSFKCTCPLGMTGSGF---DCQDVDECNANSTLPHNCSLLSTCHNTEGSYICKCMEGYWGNGF-TCSDLDECFPPSIC--GNNMTCQNFPGTFTCTCTLGLVYD---LGTCVTEKDCKNATNACNIYAECKNVHGSNYCSCMKGFHGNGRDCKDLDECSQIGACPNLSN------CFNTEGSFH--CDCLQGYQYN---------GTHCDDINECSVGNFSCPVNSTCYNEVGGYNCS--CNNGFIYS--------YNSVCLDVDECATGKAQCPNASNCHNTVGSYYCECWDGYIGNQTICEDVNECLNNSRCSDHSICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDE 1013          

HSP 7 Score: 208.379 bits (529), Expect = 7.510e-53
Identity = 184/518 (35.52%), Postives = 241/518 (46.53%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDD---PELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYCKCDSGYEGDD--CSDINECETQDLICDHN-CINTEGSAHCTCKAGFDL--MDETECFDKDECEM-DNGGC--EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIAN---CGIYGDCINTPGSFYCECHPGFELMEDSCMDINECT--NSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGE--CINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF---HSECKNTLGGFECLCETGFALS 927
            C C  GF  N   +C+D+DEC      P L +  C N  G++ CDC  G+   GT C DINEC + N   P    C N  GGY C C                        NNG      I+SYN +                C+D++EC TG  QC N   C N  GS YC+C  GY G+   C D+NEC       DH+ C+NT GS  C C  GF L    +T+C D DEC   DNG       C N  G+F C C  GF  N    +C D +EC+ G  N   C ++  C N PGS+ C C  GF L    C DI+EC   +S    +  C N  G++ C C SG+      C DINEC+ N     +  CIN+   Y CSC  G+ +    C D +EC ++  C    +C N  G+F C C  GY      C DI+E S     C     C+N  GS+ CVC  GF+      ++C+D DEC ++       + C N++GGF+C C  G+  S
Sbjct:  829 CSCMKGFHGNGR-DCKDLDECSQIGACPNLSN--CFNTEGSFHCDCLQGYQYNGTHCDDINECSVGNFSCPVNSTCYNEVGGYNCSC------------------------NNGF-----IYSYNSV----------------CLDVDECATGKAQCPNASNCHNTVGSYYCECWDGYIGNQTICEDVNECLNNSRCSDHSICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSICTNGTCLNTIGSFGCVCDMGFRSN--GTSCFDIDECS-GSQNESICQLHSTCSNIPGSYKCHCDSGFLLNRTECQDIDECLADDSPCTANSVCINSVGSFRCLCASGFKEDGLKCTDINECLSNGTCRPDQVCINKPGSYLCSCPPGHQEESGNCIDNNECANNTTCHPLARCWNTVGTFTCQCRLGYVGNGTYCKDIDECSTSSSRCHKSSKCINTPGSYVCVCAAGFVA---LGSVCVDLDECQANRGICHPAATCYNSIGGFQCQCGNGWDAS 1292          

HSP 8 Score: 157.147 bits (396), Expect = 5.064e-37
Identity = 151/456 (33.11%), Postives = 203/456 (44.52%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELC--DHICTNKPGTYMCDCRLGFT-SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKT-CVDINECVT---GDIQCLNKCMNVPGSAYCKCDSGYE--GDDCSDINECE--TQDLICD--HNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGC--EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPC---GHGECINESPGYSCSCHSGYVDVDNVCRDYDEC-----------------------------------------------LHDNPC 821
            C+C  G+  N    C+D++EC      C  +  C N+ G Y C C  GF  S  + C+D++EC       P    C N  G Y CEC  G  G Q   +D + C+++  C  ++      C+++     CLC DG+ L+    T C DI+EC     G I     C+N  GS  C CD G+   G  C DI+EC     + IC     C N  GS  C C +GF L++ TEC D DEC  D+  C    VC N  G+F+C C  GF    D L CTD NEC +    C     CIN PGS+ C C PG +    +C+D NEC N+T C     C N  GT+ C+C  GY+ + + C DI+EC  +        +CIN    Y C C +G+V + +VC D DEC                                               L  N C
Sbjct:  869 CDCLQGYQYNGT-HCDDINECSVGNFSCPVNSTCYNEVGGYNCSCNNGFIYSYNSVCLDVDECATGKAQCPNASNCHNTVGSYYCECWDGYIGNQTICEDVNECLNNSRCSDHS-----ICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSICTNGTCLNTIGSFGCVCDMGFRSNGTSCFDIDECSGSQNESICQLHSTCSNIPGSYKCHCDSGF-LLNRTECQDIDECLADDSPCTANSVCINSVGSFRCLCASGFK--EDGLKCTDINEC-LSNGTCRPDQVCINKPGSYLCSCPPGHQEESGNCIDNNECANNTTCHPLARCWNTVGTFTCQCRLGYVGNGTYCKDIDECSTSSSRCHKSSKCINTPGSYVCVCAAGFVALGSVCVDLDECQANRGICHPAATCYNSIGGFQCQCGNGWDASVGNGRGMGGCIDQNECLSPNVC 1314          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:FBN3 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0005201 "extracellular matrix structural constituent" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF00008 Pfam:PF07645 PIRSF:PIRSF036312 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 GO:GO:0005578 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 GO:GO:0005201 InterPro:IPR024731 Pfam:PF12947 Gene3D:3.90.290.10 InterPro:IPR017878 PANTHER:PTHR24039 Pfam:PF00683 SUPFAM:SSF57581 PROSITE:PS51364 OrthoDB:EOG7RV9F6 TreeFam:TF316849 GeneTree:ENSGT00740000114996 OMA:SCARPFP EMBL:DAAA02019509 EMBL:DAAA02019510 Ensembl:ENSBTAT00000035613 Uniprot:F1MZD0)

HSP 1 Score: 266.544 bits (680), Expect = 3.004e-70
Identity = 267/813 (32.84%), Postives = 370/813 (45.51%), Query Frame = 0
Query:  410 DPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDE-CKNVDGGYQCECG-----GLPGTQLSDKDNHTC---ISDEACQVNNGGCS--HECIHSYNQIFC----------LCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGY----EGDDCSDI-----------NECETQDL---ICDHNCINTEGSAHCTCKA-----------------GF---DLMDETECF-DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNV--CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN----GGCSHICKSTESGLHHRCMCPSGFKLK------TDARTCKP----IGGICSSAPRPSNGYYRCN 1125
            DPDV     CE++    +G +  C C+ G+    DG EC DVDEC  +  LCD+  C N PG+Y C C  GF+ +     C DI+ECL N    PC +  C+N+ G Y CEC      G  GT   D    TC   I D  C+ N  G +   EC  +    +            C  G+   +   +C D+NEC      C N +C+N  GS  C+C  G      G  C D+           +EC    L     D  C     +   TC+A                 GF   D +     + D +EC+   G C    C N  G+F+C C  GF L+T    CTD +EC I    CG  G C+NTPGSF CEC  G+E   ++  +CMD++EC  +  LC  G+C N +G+YEC+C  G+      + C D++EC  +   C HG+C+N    + CSC++G+    +   C D DEC   N  G    C N  GS+ C+C PGY        C D++E     D C   G C N  G   C+C+ GF+    D  +C+D DEC  +P  C H  C+NT G F C C+ G+ + +     C D++EC L    C     C+N  GS  C C  G+  D    C   DEC  S+      +  C+N PG  +C C  G+   S D   C D++EC  N   C++  C+N  GG+ C C +GF P  K+   C     C + N    G C ++      G+  RC+C  G++L       TD   C      I G+C + P    G Y CN
Sbjct:  772 DPDVCANGMCENL----RG-SYRCICNLGYEAVADGRECTDVDECALNSLLCDNGRCRNSPGSYSCSCPQGFSFRPDTETCEDIDECLSN----PCVNGVCRNLAGSYACECAPGSRLGPSGTMCLDSTKGTCWLKIQDGRCEANLHGATLRSECCATLGTAWGSPCERCDMDRACARGFARVKGL-SCEDVNECEVFPGVCPNGRCINTAGSFRCECPEGLILDTSGRLCIDMRLELCFLRWEEDECGAALLGKYRMDVCCCTVGAAWGTTCEACPEPESPAFTSLCPRGLGFASRDFLSGRPFYKDVNECKAFPGLCAHGTCRNTVGSFRCSCAGGFALDTQERNCTDIDECRISPDLCG-QGTCVNTPGSFECECLRGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYECQCPPGHALAAEGTACEDVDECSLSDGLCPHGQCVNVIGAFQCSCYAGFQSTPDRQGCVDVDECRTRNG-GCHVHCVNTKGSYQCECGPGYSLMPDGRACEDVDECEQNPDIC-DGGQCTNMPGGHRCLCYDGFVATL-DMRMCVDVDECDLNPHICLHGVCENTRGSFVCHCQLGYIVRKGAMG-CSDVDECQLGGHSCDSHASCLNTPGSFSCSCQPGWVGDGF-KCRDLDEC-ASKEHGCSPRADCLNAPGSYRCACRLGF---SGDGFSCEDRDECAENVALCENGQCLNVPGGYRCECEMGFSP-TKDQHACQDVDECVLRNICVFGSCENL-----PGM-FRCICDEGYELDRGGGNCTDVNECADPVNCINGLCVNTP----GSYLCN 1553          

HSP 2 Score: 255.373 bits (651), Expect = 8.074e-67
Identity = 219/648 (33.80%), Postives = 312/648 (48.15%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTA---CVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGF-DLMDETECFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGS--GSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDV--DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCG-PHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL-CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            C C  GF L+  +  C D+DEC   P+LC    C N PG++ C+C  G+ S       C+D++EC    LL  G       C N DG Y+C+C   PG  L+  +   C   + C +++G C H +C++      C C  G++   D + CVD++EC T +  C   C+N  GS  C+C  GY    +G  C D++ECE    ICD   C N  G   C C  GF   +D   C D DEC+++   C   VC N  G+F C C+ G+ +    + C+D +EC +G  +C  +  C+NTPGSF C C PG+      C D++EC +     S    C N  G+Y C C  G+     +C D +EC  N   C +G+C+N   GY C C  G+      + C+D DEC+  N C V G C N PG F C C  GYE     G C D+NE +   DP    +G CVN  GS+ C C Q F  + N S + C+D        CF        GG  C  E G  ++    + C  +     N  +   +         C   EG++ +      L+D       P G CQ   C+N  G  +CEC PGY ++ +D R+C D +EC+ ++G C    C N LG +TC C + +
Sbjct: 1094 CSCAGGFALDTQERNCTDIDECRISPDLCGQGTCVNTPGSFECECLRGYESGFMLMKNCMDVDECARDPLLCRG-----GTCTNTDGSYECQC--PPGHALA-AEGTACEDVDECSLSDGLCPHGQCVNVIGAFQCSCYAGFQSTPDRQGCVDVDECRTRNGGCHVHCVNTKGSYQCECGPGYSLMPDGRACEDVDECEQNPDICDGGQCTNMPGGHRCLCYDGFVATLDMRMCVDVDECDLNPHICLHGVCENTRGSFVCHCQLGYIVRKGAMGCSDVDECQLGGHSCDSHASCLNTPGSFSCSCQPGWVGDGFKCRDLDECASKEHGCSPRADCLNAPGSYRCACRLGFSGDGFSCEDRDECAENVALCENGQCLNVPGGYRCECEMGFSPTKDQHACQDVDECVLRNIC-VFGSCENLPGMFRCICDEGYELDRGGGNCTDVNECA---DPVNCINGLCVNTPGSYLCNCPQDF--ELNPSGVGCVDTR---VGNCFLDTQHRGDGGISCSAEIGVGVTRA--SCCCSLGRAWGNPCELCPLANTTEYRTLCPGGEGFRPNSI-TVILEDIDECQELP-GLCQGGNCVNTFGSFQCECPPGYHLN-EDTRICEDIDECSAHSGICGPGTCYNTLGNYTCVCPVEY 1719          

HSP 3 Score: 253.447 bits (646), Expect = 3.398e-66
Identity = 241/768 (31.38%), Postives = 334/768 (43.49%), Query Frame = 0
Query:  435 CHDGFFLNDDGECEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFT--SQGTACVD--INECLLNNGHGPCQDE----------CKNVDGGYQCECGGLP-------------GTQLSDKD---NHTCISD-EACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINEC-VTGDIQCLNKCMNVPGSAYCKCDSGYEG-----DDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDLMDE-TECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNV--CRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCEC------NPGYI--VDSQDPRLCVDKNE---------CTINNGGCQHACINKLG---GHTCS-CHL--------------GFKPDE-----KNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C  GF       CEDV+EC   P +C +  C N  G++ C+C  G    + G  C+D  +  C L      C             C  V   +   C   P             G   + +D         D   C+   G C+H  C ++     C C  G+ LD   + C DI+EC ++ D+     C+N PGS  C+C  GYE       +C D++EC    L+C    C NT+GS  C C  G  L  E T C D DEC + +G C    C N+ G FQC C  GF    D   C D +EC      C ++  C+NT GS+ CEC PG+ LM D  +C D++EC  N  +C  G C N+ G + C C  G++       C+D++EC  NP  C HG C N    + C C  GY+       C D DEC L  + C     C N PGSF C C PG+      C D++E + ++  C P  DC+N  GS+ C C  GF     D   C D DEC    + C + +C N  GG+ C CE GF+ ++   + C+D++EC L N      C N+ G   C C EGY+ D  G NC   +EC     P      LC+N PG   C C      NP  +  VD++     +D              I  G  + +C   LG   G+ C  C L              GF+P+      ++ ++C +        G C +   S       +C CP G+ L  D R C+ I
Sbjct:  938 CARGFARVKGLSCEDVNECEVFPGVCPNGRCINTAGSFRCECPEGLILDTSGRLCIDMRLELCFLRWEEDECGAALLGKYRMDVCCCTVGAAWGTTCEACPEPESPAFTSLCPRGLGFASRDFLSGRPFYKDVNECKAFPGLCAHGTCRNTVGSFRCSCAGGFALDTQERNCTDIDECRISPDLCGQGTCVNTPGSFECECLRGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYECQCPPGHALAAEGTACEDVDECSLSDGLCPHGQCVNVIGAFQCSCYAGFQSTPDRQGCVDVDECRTRNGGCHVH--CVNTKGSYQCECGPGYSLMPDGRACEDVDECEQNPDICDGGQCTNMPGGHRCLCYDGFVATLDMRMCVDVDECDLNPHICLHGVCENTRGSFVCHCQLGYIVRKGAMGCSDVDECQLGGHSCDSHASCLNTPGSFSCSCQPGWVGDGFKCRDLDECASKEHGCSPRADCLNAPGSYRCACRLGF---SGDGFSCEDRDECAENVALCENGQCLNVPGGYRCECEMGFSPTKDQ-HACQDVDECVLRNICVFGSCENLPGMFRCICDEGYELDRGGGNCTDVNECA---DPVNCINGLCVNTPGSYLCNCPQDFELNPSGVGCVDTRVGNCFLDTQHRGDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPLANTTEYRTLCPGGEGFRPNSITVILEDIDECQELPG-LCQGGNCVNTFGS------FQCECPPGYHLNEDTRICEDI 1689          

HSP 4 Score: 244.973 bits (624), Expect = 1.335e-63
Identity = 229/704 (32.53%), Postives = 307/704 (43.61%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINE-------------------------CLLNNGHG---PCQDECKNVDGGYQCECGG-LPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNVCRDYDE----C---LHDNPCGVGGK---------CNNKPG----------------SFDCDCAPGYEFKNG---XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKP 1053
            CEC  G+ LN+D   CED+DEC     +C    C N  G Y C C + +   + G  C+D+ +                         C  N G     PC+         YQ  CG  +PG  +          DE  ++     S  CI+      C CP G+  +     C D++EC +G+  C     C+N+ GS  CKC  GY+   G  C   NEC      C H +C++T  S  C C  GF    D+T C D DEC+    G    C N+ G++ C C PGF +   N  C D +ECT  +     +G C+NT GSF+C C  GFEL  D  +C+D NEC +    C  G+C NLEG++ C C  G+   +  C+DI+EC   P  C  G C N +  + C C   +V  DN  R +D     C        C V            C+ +PG                +F   C  G+    G      D+NE +     C  +G CVN DGSF C C  G+  D    + C+D DEC +  PC    C N +GGFEC C  GF    ++  TCEDI+EC+LN   C+  C N  GS+ C C  GY   E G  C   DEC    +       LC N+ G   C C PG    S     C D +EC      C +  CIN +G   C C  G++P
Sbjct: 1671 CECPPGYHLNEDTRICEDIDECSAHSGICGPGTCYNTLGNYTCVCPVEYLQVNGGNNCMDMRKSVCFRHYNSTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPASLDYQILCGNQVPGFVIDIHTGKPLDIDECGEIPAICASGVCINQIGSFRCECPAGFSYNSLLLVCEDVDECTSGENPCQQNADCVNIAGSYRCKCAQGYKLSPGGACVGRNECREIPNACSHGDCMDTVDSYMCLCHRGFRASADQTLCMDVDECDRQPCG-NGTCKNIVGSYNCLCFPGF-VAAHNGDCVDMDECTTMVGQVCRFGQCLNTAGSFHCLCKDGFELTSDGKNCIDTNECLSLPGTCLPGTCQNLEGSFRCICPPGFQVQSDHCVDIDECSEEPNLCLFGTCTNSAGSFDCLCPPDFVLSDNGHRCFDTRQSFCFTHFEAGKCSVPKAFNTTKARCCCSQRPGEGWNDPCELCPQEGSVAFQELCPFGHGAVPGPDDSREDVNECAETPGVC-TNGLCVNTDGSFRCECPFGYSLDFTGVS-CVDTDECSIGHPCGGGTCTNVIGGFECACADGFEPGPMM--TCEDIDECSLNPLLCAFRCHNTEGSYVCTCPVGYALREDGAMCRDVDECADGEQDCHARGMLCKNLIGTFACICPPGMRPQSGSGEGCTDDDECRAQPSPCANGHCINTVGSFHCDCDEGYQP 2368          

HSP 5 Score: 243.432 bits (620), Expect = 3.341e-63
Identity = 247/790 (31.27%), Postives = 342/790 (43.29%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEA-----CQVNNGGCSH---------EC-----IHSYNQIFCLCP------------DGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTD-----------ENECTIGIANCGIYGDCINTPGSFY---CE-------CHPGFELMED-SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDI-----------NECIRNPCGH----------GECIN---------ESPGYSCSCHSG-------YVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C C+ GF L+ D + C D +EC       + +C N+ G++ C C+ GF     G  CVDI+EC    +  NGH      C N +G + C C  L G  ++  D   C+           ++ G C+          EC      H + +   LCP             G  +  D +   DINEC      C N  C N+ GS  C C+ GYE    G +C+D++EC    L+CD+  C N+ GS  C+C  GF    +TE C D DEC + N     VC NL G++ C C PG  L      C D           +  C   +    +  +C  T G+ +   CE       C  GF  ++  SC D+NEC     +C +G C N  G++ C+C  G I   S   C+D+           +EC     G           G             ESP ++  C  G       ++      +D +EC         G C N  GSF C CA G+    +   C DI+E  +  D CG  G CVN  GSFEC C +G+         C+D DEC   P  C    C NT G +EC C  G AL+      CED++EC+L++G C    CVN++G+  C CY G++   +R  C   DECR     NGGC   C+N  G  +CEC PGY +   D R C D +EC  N   C    C N  GGH C C+ GF     +   CV    C +N   C H +C++T       C C  G+ ++  A  C  +
Sbjct:  597 CVCNAGFELSTDSKNCVDHNECATTTMCANGVCLNEDGSFTCLCKPGFLLAPGGRHCVDIDECQTPGICMNGH------CTNTEGSFHCRC--LGGLAVA-ADGRVCVDTHVRSTCYGTLDQGSCARPFPGAVTKSECCCASPAHGFGEPCQLCPPKNSAEFQALCSSGLGITTDGR---DINECALDPDVCANGMCENLRGSYRCICNLGYEAVADGRECTDVDECALNSLLCDNGRCRNSPGSYSCSCPQGFSFRPDTETCEDIDEC-LSNPCVNGVCRNLAGSYACECAPGSRLGPSGTMCLDSTKGTCWLKIQDGRCEANLHGATLRSECCATLGTAWGSPCERCDMDRACARGFARVKGLSCEDVNECEVFPGVCPNGRCINTAGSFRCECPEGLILDTSGRLCIDMRLELCFLRWEEDECGAALLGKYRMDVCCCTVGAAWGTTCEACPEPESPAFTSLCPRGLGFASRDFLSGRPFYKDVNECKAFPGLCAHGTCRNTVGSFRCSCAGGFALDTQERNCTDIDECRISPDLCG-QGTCVNTPGSFECECLRGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYECQCPPGHALA-AEGTACEDVDECSLSDGLCPHGQCVNVIGAFQCSCYAGFQSTPDRQGCVDVDECRTR---NGGCHVHCVNTKGSYQCECGPGYSL-MPDGRACEDVDECEQNPDICDGGQCTNMPGGHRCLCYDGFVA-TLDMRMCVDVDECDLNPHICLHGVCENTRGSF--VCHCQLGYIVRKGAMGCSDV 1364          

HSP 6 Score: 229.95 bits (585), Expect = 5.043e-59
Identity = 189/587 (32.20%), Postives = 277/587 (47.19%), Query Frame = 0
Query:  448 EDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE-----GDDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDL---------MDETECFD---KDECEMDNGGCEQVCNN------------------LEGT--FQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECL-HDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHG---DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            EDV+EC + P +C + +C N  G++ C+C  G++    G +CVD +EC +  GH      C NV GG++C C  G  PG  +      TC   + C +N   C+  C ++     C CP GY L ED   C D++EC  G+  C  +   C N+ G+  C C  G       G+ C+D +EC  Q   C + +CINT GS HC C  G+           + +  CF    +  C+  +   E V                     L GT   +  C  G     D     D +EC + + +   +G+CIN+ GSF C C  G+  +    +C+D++EC+ +       C N EG++ C C  GY+   +   C D++EC  R       C+N    ++C C  G+      C D DECL    PCG  G+C+N PGSF C+C  G+   +    C D++E +      GPH     C N  G + C C QGF      S  C+D +EC+ SP  C  + C NTLGGF C+C +GF   + +   C+D++ECA  +G CS  C N  G   C C  GY +  +G+C 
Sbjct: 2166 EDVNECAETPGVCTNGLCVNTDGSFRCECPFGYSLDFTGVSCVDTDECSI--GHPCGGGTCTNVIGGFECACADGFEPGPMM------TCEDIDECSLNPLLCAFRCHNTEGSYVCTCPVGYALREDGAMCRDVDECADGEQDCHARGMLCKNLIGTFACICPPGMRPQSGSGEGCTDDDECRAQPSPCANGHCINTVGSFHCDCDEGYQPSPSLTKCQDIRQGPCFSEVLQATCQAQSSRGEAVTRAECCCGGGRGWGPGCEPCPLPGTSAHRKLCPHGSGYTADG---RDVDECRV-LPHLCPHGECINSLGSFRCHCQAGYAPDTTATACLDVDECSQAPTPCPFLCKNTEGSFLCACPRGYLLEENGRICRDLDECSSRQHNCQFFCVNTIGAFTCRCPPGFTQRHQACFDNDECLAQPGPCGTRGRCHNAPGSFSCECYQGFTLDSSGHGCKDVDECN------GPHRCKHGCQNELGGYRCSCPQGFTPHSQWSQ-CVDENECVLSPSACGSASCHNTLGGFRCVCPSGFDFDQAV-RGCQDVDECAARSGPCSYSCANTPGGFLCGCPRGYFRAGQGHCV 2732          

HSP 7 Score: 228.794 bits (582), Expect = 1.011e-58
Identity = 254/849 (29.92%), Postives = 350/849 (41.22%), Query Frame = 0
Query:  448 EDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTA-CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFD---KDEC--EMDNGGCE-------------------------QVC---NNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSCHSG--YVDVDNVCRD-------------------YDECLHDNPCGVGGKCNNKPGS---FDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDF-----------DECLS------------------------------SPCFHSECKNTLGGFECLCETGFALSEILPNT--CEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYI-----------VD--SQDPRLCV-----------------------------DKNECTINNGGCQHA-CINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            + +D C     LC +  C   P +Y C+C +G+T      C+D++EC  +  H     +C N  G Y+C C    G Q +      C+  + C  ++G C H  C+++     C+C  G+EL  D K CVD NEC T  +     C+N  GS  C C  G+     G  C DI+EC+T  +  + +C NTEGS HC C  G  +  D   C D   +  C   +D G C                          Q+C   N+ E  FQ  C  G  + TD     D NEC +    C   G C N  GS+ C C+ G+E + D   C D++EC  NS LC +G C N  G+Y C C  G+ F     TC DI+EC+ NPC +G C N +  Y+C C  G        +C D                   +   L    C   G     P      D  CA G+   K   C D+NE  +    C P+G C+N  GSF C C +G I D +   +CID            DEC +                              SP F S C   L         GFA  + L      +D+NEC    G C+   C N +GS  C C  G+  D +  NC   DECR+S  P+   Q  C+N PG  +CEC  GY            VD  ++DP LC                              D +EC++++G C H  C+N +G   CSC+ GF+  PD +    CV    C   NGGC   C +T+    ++C C  G+ L  D R C+ +           GG C++ P    G +RC
Sbjct:  490 QTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECASSPCH---HGDCINTPGSYRCRC--HEGFQAT-LTKQACLDIDECIASSGLCHHGRCVNTEGSFQCVCNAGFELSTDSKNCVDHNECATTTMCANGVCLNEDGSFTCLCKPGFLLAPGGRHCVDIDECQTPGICMNGHCTNTEGSFHCRCLGGLAVAADGRVCVDTHVRSTCYGTLDQGSCARPFPGAVTKSECCCASPAHGFGEPCQLCPPKNSAE--FQALCSSGLGITTDG---RDINECALDPDVCA-NGMCENLRGSYRCICNLGYEAVADGRECTDVDECALNSLLCDNGRCRNSPGSYSCSCPQGFSFRPDTETCEDIDECLSNPCVNGVCRNLAGSYACECAPGSRLGPSGTMCLDSTKGTCWLKIQDGRCEANLHGATLRSECCATLGTAWGSPCERCDMDRACARGFARVKGLSCEDVNECEVFPGVC-PNGRCINTAGSFRCECPEGLILDTS-GRLCIDMRLELCFLRWEEDECGAALLGKYRMDVCCCTVGAAWGTTCEACPEPESPAFTSLCPRGL---------GFASRDFLSGRPFYKDVNECKAFPGLCAHGTCRNTVGSFRCSCAGGFALDTQERNCTDIDECRIS--PDLCGQGTCVNTPGSFECECLRGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYECQCPPGHALAAEGTACEDVDECSLSDGLCPHGQCVNVIGAFQCSCYAGFQSTPDRQG---CVDVDECRTRNGGCHVHCVNTKG--SYQCECGPGYSLMPDGRACEDVDECEQNPDICDGGQCTNMP----GGHRC 1304          

HSP 8 Score: 226.483 bits (576), Expect = 6.201e-58
Identity = 241/770 (31.30%), Postives = 320/770 (41.56%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTACVDINEC-----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEAC----QVNNGGCSHECIHSYNQIFC---------------------------LCPDGYEL---DEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGD-CINTPGSFYCECHPGFELMEDS---CMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIRNPCGHGECINESPGYSCSCHSGYVDV-----DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPC-FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC-SHICKSTESGLHHRCMCPSGFKLKTDARTCKPI------GGICSSAPRPSNGYYRCNKKKVSGYFVKG 1136
            C C DGF L  DG+ C D +EC+  P  C    C N  G++ C C  GF  Q   CVDI+EC     L   G       C N  G + C C   P   LSD + H C              G CS     +  +  C                           LCP G+      +D +   D+NEC      C N  C+N  GS  C+C  GY     G  C D +EC          C N  G   C C  GF+      C D DEC ++   C   C+N EG++ C C  G+ L  D   C D +EC  G  +C   G  C N  G+F C C PG      S   C D +EC    + C +G C N  G++ C CD GY    S   C DI +        G C +E    +C   S   +                    PC + G   ++     C    GY        D++E  +    C PHG+C+N+ GSF C C  G+  D   +  C+D DEC  +P      CKNT G F C C  G+ L E     C D++EC+    +C   CVN +G+  CRC  G+ +  +  CF  DEC     P G  +  C N PG   CEC  G+ +DS     C D +EC   +  C+H C N+LGG+ CSC  GF P  +   +CV    C ++   C S  C +T  G   RC+CPSGF      R C+ +       G CS +   + G + C   +  GYF  G
Sbjct: 1995 CLCKDGFELTSDGKNCIDTNECLSLPGTCLPGTCQNLEGSFRCICPPGFQVQSDHCVDIDECSEEPNLCLFG------TCTNSAGSFDCLC--PPDFVLSD-NGHRCFDTRQSFCFTHFEAGKCSVPKAFNTTKARCCCSQRPGEGWNDPCELCPQEGSVAFQELCPFGHGAVPGPDDSRE--DVNECAETPGVCTNGLCVNTDGSFRCECPFGYSLDFTGVSCVDTDECSIGHPCGGGTCTNVIGGFECACADGFEPGPMMTCEDIDECSLNPLLCAFRCHNTEGSYVCTCPVGYALREDGAMCRDVDECADGEQDCHARGMLCKNLIGTFACICPPGMRPQSGSGEGCTDDDECRAQPSPCANGHCINTVGSFHCDCDEGYQPSPSLTKCQDIRQ--------GPCFSEVLQATCQAQSSRGEAVTRAECCCGGGRGWGPGCEPCPLPGTSAHRK---LCPHGSGYTADG---RDVDECRVLPHLC-PHGECINSLGSFRCHCQAGYAPDTT-ATACLDVDECSQAPTPCPFLCKNTEGSFLCACPRGYLLEEN-GRICRDLDECSSRQHNCQFFCVNTIGAFTCRCPPGFTQRHQA-CFDNDECLAQPGPCGT-RGRCHNAPGSFSCECYQGFTLDSSG-HGCKDVDECNGPH-RCKHGCQNELGGYRCSCPQGFTPHSQW-SQCVDENECVLSPSACGSASCHNTLGGF--RCVCPSGFDFDQAVRGCQDVDECAARSGPCSYSCANTPGGFLCGCPR--GYFRAG 2727          

HSP 9 Score: 224.172 bits (570), Expect = 3.156e-57
Identity = 244/817 (29.87%), Postives = 340/817 (41.62%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLS------DKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDET-ECFDKDEC----EMDNGGCE--QVCNNLEGTFQCGCKPGFHLNTDNLTCTDE--------------------------NEC--TIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLH-DNPCGVGGK-CNNKPGSFDCDCAPGYEFKNGX---CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEI------------------LPNTC----------------EDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCN---KKKVSGYFVKGTKCKLKCRKGFMP 1149
            C+C  G+ L+  G C   +EC + P  C H  C +   +YMC C  GF +    T C+D++EC       PC +  CKN+ G Y C C   PG   +      D D  T +  + C+        +C+++     CLC DG+EL  D K C+D NEC++    CL   C N+ GS  C C  G+  + D C DI+EC  +  +C    C N+ GS  C C   F L D    CFD  +       + G C   +  N  +    C  +PG   N     C  E                          NEC  T G+   G+   C+NT GSF CEC  G+ L     SC+D +EC+    CG G+C N+ G +EC C  G+      TC DI+EC  NP  C    C N    Y C+C  GY   ++  +CRD DEC   +  C   G  C N  G+F C C PG   ++G    C D +E   +  PC  +G C+N  GSF C C +G+    + +  C D  +    PCF    + T          G A++                    LP T                  D++EC +    C    C+N LGS  C C  GY  D     C   DEC  +  P   C  LC N  G   C C  GY+++ ++ R+C D +EC+     CQ  C+N +G  TC C  GF    +  + C     C    G C    +   +     C C  GF L +    CK +           NG +RC    + ++ GY       +  C +GF P
Sbjct: 1872 CKCAQGYKLSPGGACVGRNECREIPNACSHGDCMDTVDSYMCLCHRGFRASADQTLCMDVDECDRQ----PCGNGTCKNIVGSYNCLC--FPGFVAAHNGDCVDMDECTTMVGQVCRFG------QCLNTAGSFHCLCKDGFELTSDGKNCIDTNECLSLPGTCLPGTCQNLEGSFRCICPPGFQVQSDHCVDIDECSEEPNLCLFGTCTNSAGSFDCLCPPDFVLSDNGHRCFDTRQSFCFTHFEAGKCSVPKAFNTTKARCCCSQRPGEGWNDPCELCPQEGSVAFQELCPFGHGAVPGPDDSREDVNECAETPGVCTNGL---CVNTDGSFRCECPFGYSLDFTGVSCVDTDECSIGHPCGGGTCTNVIGGFECACADGFEPGPMMTCEDIDECSLNPLLCAF-RCHNTEGSYVCTCPVGYALREDGAMCRDVDECADGEQDCHARGMLCKNLIGTFACICPPGMRPQSGSGEGCTDDDECRAQPSPCA-NGHCINTVGSFHCDCDEGYQPSPSLTK-CQDIRQ---GPCFSEVLQATCQAQS---SRGEAVTRAECCCGGGRGWGPGCEPCPLPGTSAHRKLCPHGSGYTADGRDVDECRVLPHLCPHGECINSLGSFRCHCQAGYAPDTTATACLDVDECSQAPTP---CPFLCKNTEGSFLCACPRGYLLE-ENGRICRDLDECSSRQHNCQFFCVNTIGAFTCRCPPGFT---QRHQACFDNDECLAQPGPCGTRGRCHNAPGSFSCECYQGFTLDSSGHGCKDV--------DECNGPHRCKHGCQNELGGY-------RCSCPQGFTP 2642          

HSP 10 Score: 181.8 bits (460), Expect = 2.105e-44
Identity = 223/765 (29.15%), Postives = 303/765 (39.61%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVD--INECLLNNGHGPCQDECKNVDGGYQCE------------CGGL-----------------------PGTQLSDKDNHTCISDEA--CQVNNGGC-SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGY----EGDDCSDINE----------CE-------TQDLICDHNCINTEGSAHC-TCKAGFDLMDETEC----------------FDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME-DSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNV-CRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIP--GGLK----CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFK 1096
            C C +G+ L+   G C DV+EC D     + +C N PG+Y+C+C   F     G  CVD  +  C L+  H          DGG  C             C  L                       PG +    ++ T I ++   CQ   G C    C++++    C CP GY L+ED + C DI+EC      C    C N  G+  C C   Y     G++C D+ +          C+       T+ + C    I    +  C  C     L  +  C                 D DEC      C   VC N  G+F+C C  GF  N+  L C D +ECT G   C    DC+N  GS+ C+C  G++L    +C+  NEC      C  G C +   +Y C C  G+      + C+D++EC R PCG+G C N    Y+C C  G+V   N  C D DEC  +    C   G+C N  GSF C C  G+E  +    C D NE       C P G C N +GSF C+C  GF   Q  S+ C+D DEC   P  C    C N+ G F+CLC   F LS+   + C D  +           C     +  C   + +          K  C  S+RP  G    C   P  G +     C    G +    D R   D NEC    G C +  C+N  G   C C  G+  D      CV    CS+ +      C +   G    C C  GF+
Sbjct: 1511 CICDEGYELDRGGGNCTDVNECADPVNCINGLCVNTPGSYLCNCPQDFELNPSGVGCVDTRVGNCFLDTQH--------RGDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPLANTTEYRTLCPGGEGFRPNSITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPPGYHLNEDTRICEDIDECSAHSGICGPGTCYNTLGNYTCVCPVEYLQVNGGNNCMDMRKSVCFRHYNSTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPASLDYQILCGNQVPGFVIDIHTGKPLDIDECGEIPAICASGVCINQIGSFRCECPAGFSYNSLLLVCEDVDECTSGENPCQQNADCVNIAGSYRCKCAQGYKLSPGGACVGRNECREIPNACSHGDCMDTVDSYMCLCHRGFRASADQTLCMDVDECDRQPCGNGTCKNIVGSYNCLCFPGFVAAHNGDCVDMDECTTMVGQVCRF-GQCLNTAGSFHCLCKDGFELTSDGKNCIDTNECLSLPGTCLP-GTCQNLEGSFRCICPPGF---QVQSDHCVDIDECSEEPNLCLFGTCTNSAGSFDCLCPPDFVLSDN-GHRCFDTRQ---------SFCFTHFEAGKCSVPKAFNT-------TKARCCCSQRPGEGWNDPCELCPQEGSVAFQELCPFGHGAVPGPDDSR--EDVNECAETPGVCTNGLCVNTDGSFRCECPFGYSLDFTG-VSCVDTDECSIGHPCGGGTCTNVIGGFE--CACADGFE 2240          

HSP 11 Score: 124.405 bits (311), Expect = 7.499e-27
Identity = 134/478 (28.03%), Postives = 197/478 (41.21%), Query Frame = 0
Query:  741 STLCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNG---GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKC 1203
            + LC +G C     +Y C+C+ GY       C+D++EC  +PC HG+CIN    Y C CH G+        C D DEC+  +     G+C N  GSF C C  G+E      + ++           +G C+N DGSF C+C  GF+      + C+D DEC +   C +  C NT G F C C  G A++                     +VCV+      C     Y   ++G+C         K EC  +   +G    CQ          +  C+ G  + + D R   D NEC ++   C +  C N  G + C C+LG++      E C     C++N+  C +  +   S   + C CP GF  + D  TC+ I   C S P   NG  R     ++G +    +C    R G  P+G +         W   +D  CE         LH   +  E C T  +  GS C
Sbjct:  499 TNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECASSPCHHGDCINTPGSYRCRCHEGFQATLTKQACLDIDECIASSGLCHHGRCVNTEGSFQCVCNAGFELSTDSKNCVDHNECATTTMCANGVCLNEDGSFTCLCKPGFLLAPGGRH-CVDIDECQTPGICMNGHCTNTEGSFHCRCLGGLAVAAD------------------GRVCVDTHVRSTC-----YGTLDQGSCARPFPGAVTKSECCCASPAHGFGEPCQLCPPKNSAEFQALCSSGLGI-TTDGR---DINECALDPDVCANGMCENLRGSYRCICNLGYEAVADGRE-CTDVDECALNSLLCDNG-RCRNSPGSYSCSCPQGFSFRPDTETCEDI-DECLSNPC-VNGVCR----NLAGSYA--CECAPGSRLG--PSGTMCLDSTKGTCWLKIQDGRCEAN-------LHGATLRSECCATLGTAWGSPC 929          

HSP 12 Score: 59.6918 bits (143), Expect = 3.143e-7
Identity = 42/97 (43.30%), Postives = 51/97 (52.58%), Query Frame = 0
Query:  879 CHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV-CVNILGSHYCRCYEGYKKDERG 972
            C +GFI + N +  C D DEC + P  C    C NT+G FEC C TG  LSE     CED++EC    G CS   C N +GS+ C C  GY     G
Sbjct:  267 CRRGFIPNIN-TGACQDVDECQAVPGLCQGGSCVNTVGSFECRCPTGHRLSEN-SAKCEDVDECLSVPGLCSGGDCTNTVGSYVCTCPHGYASSLDG 361          

HSP 13 Score: 56.9954 bits (136), Expect = 1.916e-6
Identity = 65/206 (31.55%), Postives = 78/206 (37.86%), Query Frame = 0
Query:  599 CKCDSGYEGDDCSDINECETQDLICDHNCINTE---GSAHCTCKAGFDLMDETECFDKDECEMDNG--GCEQVCNNLEGT-------------FQC--------GCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTN-STLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLD 773
            C C  GY G  C           +CDH C N     G  HC C  GF        +    C    G  GC+     L  T             F C         C+ GF  N +   C D +EC      C   G C+NT GSF C C  G  L E+S  C D++EC +   LC  G C N  G+Y C C  GY      + CLD
Sbjct:  170 CLCQRGYTGTVCGQP--------VCDHGCHNGGRCIGPNHCACVYGFMGPQCERDYRTGPCFGRVGPEGCQHQLTGLICTKALCCATVGRAWGFPCELCPAQPHPCRRGFIPNINTGACQDVDECQAVPGLC-QGGSCVNTVGSFECRCPTGHRLSENSAKCEDVDECLSVPGLCSGGDCTNTVGSYVCTCPHGYASSLDGTRCLD 366          

HSP 14 Score: 52.373 bits (124), Expect = 4.598e-5
Identity = 35/86 (40.70%), Postives = 43/86 (50.00%), Query Frame = 0
Query:  844 FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALS 927
               G C D++E       C   G CVN  GSFEC C  G    +N +  C D DECLS P  C   +C NT+G + C C  G+A S
Sbjct:  275 INTGACQDVDECQAVPGLC-QGGSCVNTVGSFECRCPTGHRLSENSAK-CEDVDECLSVPGLCSGGDCTNTVGSYVCTCPHGYASS 358          

HSP 15 Score: 50.8322 bits (120), Expect = 1.430e-4
Identity = 45/137 (32.85%), Postives = 67/137 (48.91%), Query Frame = 0
Query:  638 CKAGF-DLMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSC-NNLEGTY---ECKCDSGYIF 766
            C+ GF   ++   C D DEC+   G C+   C N  G+F+C C  G  L+ ++  C D +EC + +      GDC NT GS+ C C  G+    D   C+D    T  ++  +G C  +L G Y   +C CD G  +
Sbjct:  267 CRRGFIPNINTGACQDVDECQAVPGLCQGGSCVNTVGSFECRCPTGHRLSENSAKCEDVDEC-LSVPGLCSGGDCTNTVGSYVCTCPHGYASSLDGTRCLDHRAGTCFSVLIAGRCTGDLSGHYTHRQCCCDKGRCW 402          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:FBN1 "Fibrillin-1" species:9606 "Homo sapiens" [GO:0005201 "extracellular matrix structural constituent" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 GO:GO:0005578 InterPro:IPR013032 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 GO:GO:0005201 EMBL:AC084757 Gene3D:3.90.290.10 InterPro:IPR017878 PANTHER:PTHR24039 Pfam:PF00683 SUPFAM:SSF57581 PROSITE:PS51364 EMBL:AC022467 EMBL:AC084758 HGNC:HGNC:3603 ChiTaRS:FBN1 ProteinModelPortal:H0YND0 PRIDE:H0YND0 Ensembl:ENST00000559133 NextBio:35525002 Uniprot:H0YND0)

HSP 1 Score: 259.61 bits (662), Expect = 3.256e-70
Identity = 238/703 (33.85%), Postives = 325/703 (46.23%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINE----------------------------CLLNNGHG---PCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI-QCLNKCMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMD-ETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGV---GGKCNNKPG----SFDCDCA----------------PGYEFK------NGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            C C  G++LN+D   C+DV+EC + P +C    C N  G Y C C   +   + G  C+D+                              C  N G     PC+         +   CG      + D      +  + C+   G C +  CI+      C CP G+  ++    C DI+EC  G + Q   +C+N  GS  C C  GY       C+D NEC+    IC H  CI+T GS +C C  GF   D +T C D +ECE D  G    C N  G+F C C  GF L+ +N  C D +EC  G  N    G CINT GSF C+C+ G+E+  D  +C+DINEC      C  G+C NL+G+Y C C  GY   N  C DI+EC+  P  C  G C N    + C C  G+    +  R  D  L  + C     GGKC++         +C CA                P   F+      +G     ++ +++ D C       HG C+N DGS+ C C  G+I   N+   C+D DEC + +PC +  CKN +GGFEC CE GF    ++  TCEDINECA N   C+  CVN  GS+ C+C  GY  +++R  C  +DEC   +      Q  C N+ G   C C PGY     D   CVD+NEC    G C++  C+N  G +TC C+ GF
Sbjct:   67 CRCPTGYYLNEDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNN-DCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQD--LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMM--TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGY-QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGF 758          

HSP 2 Score: 214.157 bits (544), Expect = 1.698e-55
Identity = 203/642 (31.62%), Postives = 272/642 (42.37%), Query Frame = 0
Query:  548 ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINEC------ETQDLICDHNCINTEGSAHCTCKAGFDLMDETEC-------------------------------FDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME-DSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGHGECINESPGYSCSCHSGYV-DVDNVCRDYDECLHDNP-CGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINE----CALNNGDCS----------QVCVNILGSHY------------------CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105
            +CI+++    C CP GY L+ED + C D+NEC T  I     C N  G+  C C   Y     G++C D+            +  CD   +       C C           C                                D DEC    G CE  VC N+ G+F+C C  GF  N   L C D +EC  G   C    +CINT GS+ C+C PG+       C D NEC     +C  G C +  G++ C C +G+  ++  + CLDINEC R+ CG+G C N    ++C C+ G++   +N C D DEC   N      G+C N  GSF C C  GYE       C DINE  LE   C P G C N DGS+ C+C  G+   QN+   C D DEC+  P  C    C NT G F+CLC  GF+LS      C+D+           G CS          + C  + G  +                  C    G       +    DEC   + P+      CIN  G  +CEC  GYI+   +   CVD +EC++ N      C N +GG  C+C  GF+P       C     C+ N   C+  C +T     + C CP G+ L+ D R CK
Sbjct:   57 KCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPV-CQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAP-GTCQNLDGSYRCICPPGY-SLQNEK--CEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSS-SGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDEC---KEPDVCKHGQCINTDGSYRCECPFGYILAGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPM--MTCEDINECAQNPLLCAFRCVNTYG--SYECKCPVGYVLREDRRMCK 682          

HSP 3 Score: 162.925 bits (411), Expect = 2.648e-39
Identity = 160/530 (30.19%), Postives = 230/530 (43.40%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT-SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICD-HNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGD----CINTPG-SFYCECHPGFELM---EDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCG-PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALS 927
            C H   +D   +  C CH GF  NDD   C D++EC  D    +  C N  G++ C C  GF  S    C+D++EC   NG+     +C N  G +QC+C                                             +GYE+  D +TCVDINEC+    +C    C N+ GS  C C  GY  + + C DI+EC  +  IC    C NTEGS  C C  GF L                    + C +L  ++      G   ++       + EC   +   G +GD    C   P  +F   C  G  ++   +DS +D++EC    +C  G C N +G+Y C+C  GYI   + C+D +EC + NPCG+G C N   G+ C+C  G+     + C D +EC   NP     +C N  GS++C C  GY  +     C D +E    K  C     +C N  G++ C+C  G+   + D   C+D +EC + P  C +  C NT G + C C  GF  S
Sbjct:  296 CSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERD-ACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCN--------------------------------------------EGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSG----------------RRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEG-WGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQ-NPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGY-QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTAS 761          

HSP 4 Score: 124.405 bits (311), Expect = 2.720e-27
Identity = 113/384 (29.43%), Postives = 177/384 (46.09%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECG-----GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCP---DGY---------ELDEDWK---------------TCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-IYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDI 774
            C+C++G+ +  DG  C D++EC+ +P  C    C N  G+Y C C  G++ Q   C DI+EC+           C N +G ++C C         G +  D     C +    +   G CS     ++++  C C    +G+         E DE ++               + VD++EC   D+    +C+N  GS  C+C  GY   G++C D +EC   +   +  C N  G   CTC+ GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C DE+EC  G  +C     +C N  G++ C C PG++   D   C+D NEC T   +C +G C N  G+Y C+C+ G+    +   CLD+
Sbjct:  392 CQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECV-EEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYA----KFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDV 770          

HSP 5 Score: 117.087 bits (292), Expect = 5.631e-25
Identity = 87/239 (36.40%), Postives = 118/239 (49.37%), Query Frame = 0
Query:  426 DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLM-DETECFD 652
            D+     C    G  +  D    D+DEC  +P++C H  C N  G+Y C+C  G+   G  CVD +EC + N  G     CKNV GG++C C  G  PG  +      TC     C  N   C+  C+++Y    C CP GY L ED + C D +EC  G   C  K   C N+ G+  C C  GY+    G+ C D NEC+T+  IC++  C+NT GS  C C  GF    ++ EC D
Sbjct:  540 DEAFRQICPYGSGIIVGPDDSAVDMDEC-KEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNPCG--NGTCKNVIGGFECTCEEGFEPGPMM------TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLD 769          

HSP 6 Score: 55.0694 bits (131), Expect = 6.013e-6
Identity = 71/265 (26.79%), Postives = 104/265 (39.25%), Query Frame = 0
Query:  895 DFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN---------CF------------------LKDEC----RLSRRPNGGCQQLCINIPGGLKCECN---PGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEK-----NPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKT-----DARTCKPIGGICS 1112
            D DEC   P  C   +C NT G F+C C TG+ L+E     C+D+NEC          C N +G++ C C   Y +   GN         C+                   K  C     + R  N  C+Q  I         C    PG+++D     L VD +EC    G C++  CIN +G   C C +GF  ++K     + ++C     C  N        +   +   +RC C  G++  +     D   C+ I  ICS
Sbjct:   42 DIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDT-RVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYT-GLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNA-------ECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICS 297          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:FBN3 "Fibrillin-3" species:9606 "Homo sapiens" [GO:0005201 "extracellular matrix structural constituent" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005578 "proteinaceous extracellular matrix" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF00008 Pfam:PF07645 PIRSF:PIRSF036312 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 Reactome:REACT_118779 InterPro:IPR000152 GO:GO:0005509 GO:GO:0005578 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 eggNOG:NOG12793 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 EMBL:AC008946 GO:GO:0005201 EMBL:AC022146 HOGENOM:HOG000231768 HOVERGEN:HBG005643 Gene3D:3.90.290.10 InterPro:IPR017878 PANTHER:PTHR24039 Pfam:PF00683 SUPFAM:SSF57581 PROSITE:PS51364 OrthoDB:EOG7RV9F6 TreeFam:TF316849 EMBL:AY165863 EMBL:AY165864 EMBL:AY165865 EMBL:AB177797 EMBL:AB177798 EMBL:AB177799 EMBL:AB177800 EMBL:AB053450 RefSeq:NP_115823.3 RefSeq:XP_005272561.1 RefSeq:XP_005272562.1 UniGene:Hs.370362 ProteinModelPortal:Q75N90 SMR:Q75N90 BioGrid:124100 IntAct:Q75N90 MINT:MINT-4095014 STRING:9606.ENSP00000270509 PhosphoSite:Q75N90 PaxDb:Q75N90 PRIDE:Q75N90 Ensembl:ENST00000270509 Ensembl:ENST00000600128 Ensembl:ENST00000601739 GeneID:84467 KEGG:hsa:84467 UCSC:uc002mjf.3 CTD:84467 GeneCards:GC19M008130 H-InvDB:HIX0014707 HGNC:HGNC:18794 HPA:HPA049482 MIM:608529 neXtProt:NX_Q75N90 PharmGKB:PA38681 InParanoid:Q75N90 OMA:SCARPFP PhylomeDB:Q75N90 GenomeRNAi:84467 NextBio:74278 PRO:PR:Q75N90 Bgee:Q75N90 CleanEx:HS_FBN3 Genevestigator:Q75N90 Uniprot:Q75N90)

HSP 1 Score: 261.922 bits (668), Expect = 7.928e-69
Identity = 216/632 (34.18%), Postives = 297/632 (46.99%), Query Frame = 0
Query:  435 CHDGFFLNDDGECEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFT--SQGTACVDIN--ECLLNNGHGPCQDECK-NVDGGYQ-----CECGGLPGTQ---------------------------LSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINEC-VTGDIQCLNKCMNVPGSAYCKCDSGYEG-----DDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDLMDE-TECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNV--CRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDE-RGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCEC 1005
            C  GF       C+DV+EC   P +C +  C N  G++ C+C  G    + G  CVD+    C L       +DEC   + G Y+     C  G + G +                           LS +  +  +++  C+V  G C+H  C ++     C C  G+ LD   + C DI+EC ++ D+     C+N PGS  C+C  GYE       +C D++EC    L+C    C NT+GS  C C  G +L  + T C D DEC + +G C    C N+ G FQC C  GF    D   C D NEC +    C ++  CINT GS+ C C  G+ LM D  +C D++EC  N  +C  G C N+ G + C C  G++      TC+D++EC  NP  C HG+C N    + C C  GY+       C D DEC +  + C     C N PGSF C C PG+      CHD++E   ++  C P GDC+N  GS+ C C QGF     D   C D DEC  +   C + +C N  GG+ C CE GF  +E     C+D++ECA  N      C N+ G   C C  GY+ D   GNC   +EC     P      +CIN PG   C C
Sbjct:  855 CARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWD----EDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNE--CKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFA---GDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDH-RACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINEC---ADPVNCINGVCINTPGSYLCSC 1471          

HSP 2 Score: 235.343 bits (599), Expect = 9.676e-61
Identity = 189/584 (32.36%), Postives = 274/584 (46.92%), Query Frame = 0
Query:  448 EDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE-----GDDCSDINECETQ-DLICDHNCINTEGSAHCTCKAGFDLMDE-TECFDKDECEMDNGGCEQVCNNLEGTFQCGCK--------------------PGF--------HLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI-RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHG---DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            EDV+EC ++P +C + +C N  G++ C+C  G++    G  CVD +EC +  GH   Q  C NV GG++C C  G  PG  +      TC   + C +N   C+  C ++     C CP GY L ED   C D++EC  G   C  +   C N+ G+  C C  G       G+ C+D NEC  Q DL  +  C+NT GS  C C  GF      TEC D  +        + +C +L  + +   +                    PG         H +       D +EC + +A+   +G+CIN+ GSF C C  G+  +    +C+D++EC+      +  C N +G++ C C  GY+      TC D++EC  R       C+N    ++C C  G+      C D DEC     PCG  G C+N PGSF C+C  G+   +    C D+NE        GPH     C N  G + C C QGF      +  C+D +EC  SP  C  + C+NTLGGF C+C +GF   + L   C++++ECA   G CS  C N  G   C C +GY +  +G+C 
Sbjct: 2083 EDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSV--GHPCGQGTCTNVIGGFECACADGFEPGLMM------TCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRM-LAHLCAHGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD------GPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQ-CVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQAL-GGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGYFRAGQGHCV 2649          

HSP 3 Score: 231.876 bits (590), Expect = 1.320e-59
Identity = 250/783 (31.93%), Postives = 335/783 (42.78%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQGT--ACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECET-----QDLICDHNCINTEGSAHCTCK---AGFD---------------------LMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDI-----------NECIRNPCG---HGEC---INESPGYSC-------SCHSGYVDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEX----SLEKDPCGP-------HGDCVNNDGS----------------FECVCHQGFIHDQND----SNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD--ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            CEC+ G+  +  GEC DVDEC   P  C H  C N PGTY C C  GF +  T  ACVD++EC+++ G   C    C N +G +QC C    G +LS  D   C+    C  +    +  C++      CLC  G+ L      C+DI+EC T  I     C N  GS  C+C  G     +G  C D +   T     +   C      T   + C C     GF                      L   T+  D +EC +D   C   VC NL G+++C C  G+        CTD +EC +    C   G C N+PGS+ C C PGF   +D+  C D++EC +S  C SG C NL G+Y CKC  G     S   CLD            + C  N  G     EC   +  + G  C       +C  G+  +  V C D +EC         G+C N  GSF C+C  G         C D+         ++D CG           C  + G+                F  +C +G      D         D +EC   P  C H  C+NT+G F C C  GFAL     N C DI+EC ++   C Q  CVN  GS  C C+ GY+       NC   DEC  +R P       C N  G  KC+C PG+ + ++    C D +EC++++G C H  C+N +G   CSCH GF+  PD +    CV    C V NGGC   C +TE    +RC C  G+ L  D R C  +
Sbjct:  433 CECNVGYTQDVRGECIDVDECTSSP--CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGL--CHLGRCVNTEGSFQCVCNA--GFELS-PDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCD-NGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSP-CVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERN-CTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDEC--ARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKG-TACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQG---CVDINECRVQNGGCDVHCINTEG--SYRCSCGQGYSLMPDGRACADV 1197          

HSP 4 Score: 231.106 bits (588), Expect = 1.950e-59
Identity = 252/797 (31.62%), Postives = 344/797 (43.16%), Query Frame = 0
Query:  402 ADPSRPSCDPDVQEKKRCEHICYLDKGVTP----TCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEA-----CQVNNGGCSH---------ECI-----HSYNQIFCLCP------------DGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTD-----------ENECTIGIANCGIYGDCINTPGSFY------CE----CHPGFELMED-SCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECIRNPC----GHGECINESPGY----SCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHI-CKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            A P+R +C  DV E      +C+L + V       C C+ GF L+ DG+ C D +EC       + +C N+ G++ C C+ GF     G  C+DI+EC    +  NGH      C N +G ++C+C GGL        D   C+           +  G C+          EC      H + +   LCP             G  +  D +   DINEC      C N  C N+ GS  C C+ GYE    G DC+D++EC    L+CD+  C N+ GS  C+C  GF    +TE C D DEC + +     VC NL G++ C C PG  L+     C D           E+ C + +    +  +C  T G+ +      CE    C  GF  M   +C D+NEC +   +C +G C N  G++ C+C  G +   S   C+D+      PC       EC    PG      C C  G V       + + C           C    G    D   G  F      D+NE  +    C  HG C N  GSF C C  GF  D  + N C D DEC  SP  C    C NT G FEC C  G+    +L   C D++ECA +   C    C N  GS+ C+C  G++   +G  C   DEC LS   +G C    C+N+ G  +C C+ G+   + D + CVD NEC + NGGC   CIN  G + CSC  G+   PD +    C     C  N   C    C +   G  HRC+C  GF    D RTC  +
Sbjct:  480 ATPTRQAC-VDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGH------CTNTEGSFRCQCLGGL----AVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGR---DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDEC-LSSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVR---LEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWG----VECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYK----DVNECKVFPGLC-THGTCRNTVGSFHCACAGGFALDAQERN-CTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLS---DGLCPHGQCVNVIGAFQCSCHAGF-QSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGR---ACADVDECEENPRVCDQGHCTNMPGG--HRCLCYDGFMATPDMRTCVDV 1239          

HSP 5 Score: 227.639 bits (579), Expect = 2.261e-58
Identity = 244/770 (31.69%), Postives = 327/770 (42.47%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTACVDINEC-----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEAC----QVNNGGCSHECIHSYNQIFC---------------------------LCPDGYEL---DEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYG-DCINTPGSFYCECHPGFELMEDS---CMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFD----CDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC-SHICKSTESGLHHRCMCPSGFKLKTDARTCKPIG------GICSSAPRPSNGYYRCNKKKVSGYFVKG 1136
            C C DGF L  DG+ C D +EC+     C    C N  G++ C C  GF  Q   C+DI+EC     L   G       C N  G +QC C   PG  LSD + H C          +   G CS     +  +  C                           LCP G+      +D +   D+NEC      C N  C+N  GS  C+C  GY     G +C D +EC          C N  G   C C  GF+      C D DEC ++   C   C+N EG++ C C  G+ L  D   C D +EC  G  +C   G +C N  G+F C C PG   +  S   C D NEC     LC +G C N  G++ C CD G+    +   C DI +        G C  E       C S     + V R    C      G   +    PG+      C    GY  +     D++E  +    C  HG+C+N+ GSF C C  G+  D   +  C+D DEC  +  PC    CKNT G F C C  G+ L E    TC+D++EC     +C  +CVN +G+  CRC  G+ +  +  CF  DEC     P G     C N PG  +CEC+ G+ + S     C D NEC   +  CQH C N+LGG+ CSC  GF        +CV    C+++   C S  C++T  G   RC+CPSGF        C+ +       G CS +   + G + C   +  GYF  G
Sbjct: 1912 CLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFG------TCTNSPGSFQCLC--PPGFVLSD-NGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSRE--DVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQ--------GPCFAEV--LQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEG---RDVDECRMLAHLCA-HGECINSLGSFRCHCQAGYTPDAT-ATTCLDMDECSQVPKPCTFL-CKNTKGSFLCSCPRGYLLEED-GRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQA-CFDNDECSAQPGPCGA-HGHCHNTPGSFRCECHQGFTLVSSG-HGCEDVNECDGPH-RCQHGCQNQLGGYRCSCPQGFT-QHSQWAQCVDENECALSPPTCGSASCRNTLGGF--RCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQ--GYFRAG 2644          

HSP 6 Score: 219.164 bits (557), Expect = 9.596e-56
Identity = 247/772 (31.99%), Postives = 328/772 (42.49%), Query Frame = 0
Query:  410 DPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPC-QDECKNVDGGYQCECGGLPGTQLS-------DKDNHTC---ISDEACQVNNGGCS--HECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDL---------MDETECF---DKDECEMDNGG------------------CEQVCNNLEGTFQCGCKPGFHLNTDNLTC-----TDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECTNST-LCGSGSCNNLEGTYECKCDSGY---IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV-CVNILGSHYCRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGC--QHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            DP+V     CE++    +G +  C C+ G+     G +C DVDEC  +  LCD+  C N PG+Y C C  GF        C D++ECL +    PC    C+N+ G Y C+CG  PG++L        D    TC   I +  C+VN  G S   EC  +          G       + C     C  G  +                     G  C D+NECE+   +C +  C+NT GS  C C  G  L         +    CF   D+DEC +   G                  CE   +     F   C  G    + +         D NEC +    C  +G C NT GSF+C C  GF L   E +C DI+EC  S  LCG G+C N  G++EC+C  GY         C+D++EC R+P  C  G C N    Y C C  G+        C D DEC L D  C   G+C N  G+F C C  G++       C DINE  ++   C  H  C+N +GS+ C C QG+     D   C D DEC  +P  C    C N  GG  CLC  GF  +  +  TC D++EC LN   C    C N  GS  C C  GY  +K   G C   DEC +    N      C+NIPG   C C PG++ D  +   C D +EC      C  +  C+N  G + C+C  GF  D      C     C+ N   C +  C +   G  +RC C  GF    D R C+ +
Sbjct:  689 DPEVCANGVCENL----RG-SYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSS----PCVSGVCRNLAGSYTCKCG--PGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATL---------GAAWGSPCERCEIDPACARGFAR-------------------MTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLC-THGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGY-SLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDM-RTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATG-CSDVDECEVGGH-NCDSHASCLNIPGSFSCRCLPGWVGDGFE---CHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGF---FCEDRDECAENVDLCDNGQCLNAPGG--YRCECEMGFDPTEDHRACQDV 1405          

HSP 7 Score: 215.698 bits (548), Expect = 9.938e-55
Identity = 227/723 (31.40%), Postives = 309/723 (42.74%), Query Frame = 0
Query:  432 TCECHDGFFLNDDGECEDVDECVDDPELCDHI--CTNKPGTYMCDCRLGFTSQGTACVDINEC-----LLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINE----CETQD-----LICDHNCINTEGSAHCTCKAGFDLMDETECF----------------------------DKDECEMDNGGCEQV-CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME--DSCMDINECTNSTLCG---SGSCNN-------------------------------LEGTYECKCDS---GYI--FHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSG--YVDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV--CVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGC-QQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            +C C  G+ + D  EC D+DECV     C     C N PG+Y C CR GF   G  C D +EC     L +NG      +C N  GGY+CEC  G   T+    D+  C   + C   N      C +      C+C  GYELD     C DINEC    + C+N  C+N PGS  C C   +E    G  C D        ET D     + C          A C C  G    +  E                              D DEC+   G C+   C N  G+FQC C PG+HL+     C D +EC+     CG  G C NT G++ C C   +  +   ++CMD+ +    ++C    +G+C N                               +   Y+  C +   G++   H    LDI+EC   P  C +G CIN+   + C C +G  Y  +   C D DEC   ++PC     C N PGS+ C C  GY+    G C   NE     + C  HGDC++ +GS+ C+CH+GF     D  +C+D DEC   PC +  CKN +G + CLC  GF ++      C D +EC    G   +   C+N  GS +C C +G++    G NC   +EC LS    G C    C N+ G  +C C PG+ V S     C+D +EC+     C    C N  G   C C  GF
Sbjct: 1305 SCRCLPGW-VGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNG------QCLNAPGGYRCECEMGFDPTE----DHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECAD-PVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGP-GTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRK----SVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVCS-HGDCMDTEGSYMCLCHRGF-QASADQTLCMDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTH--NGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNEC-LSLA--GTCLPGTCQNLEGSFRCICPPGFQVQSDH---CIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGF 2000          

HSP 8 Score: 214.542 bits (545), Expect = 2.112e-54
Identity = 219/711 (30.80%), Postives = 307/711 (43.18%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLS------DKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDET-ECFDKDEC----EMDNGGCE--QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHG-DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLK----CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C+C  G+ L+  G C   +EC + P +C H  C +  G+YMC C  GF +    T C+DI+EC       PC +  CKN+ G Y C C   PG  ++      D D  T +  + C+  +      C+++     CLC DG+EL  D K CVD NEC++    CL   C N+ GS  C C  G+  + D C DI+EC  +  +C    C N+ GS  C C  GF L D    CFD  +       + G C   +  N  +    C  +PG         C  E   +        +G             H      +DS  D+NEC  N  +C +G C N +G++ C+C  GY   F    C+D +EC + +PCG G C N   G+ C+C  G+   +   C D DEC   NP     +C+N  GS+ C C  GY  +     C D++E +  +  C   G +C N  G+F CVC  G          C D +EC + P  C +  C NT G F C C+ GF  S  L   C DI +     G C    +  +        E   + E              R  G   +LC  +PG       C    GY  + +      D +EC +    C H  CIN LG   C C  G+ PD      C+    CS     C+ +CK+T+      C CP G+ L+ D RTCK +
Sbjct: 1789 CKCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQ----PCGNGTCKNIIGSYNCLC--FPGFVVTHNGDCVDFDECTTLVGQVCRFGH------CLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEG--SAAFQELCPFG-------------HGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDEC-SLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTL-TECHDIRQ-----GPCFAEVLQTMCRSLSSSSEAVTRAECCC--------GGGRGWGPRCELC-PLPGTSAYRKLCPHGSGYTAEGR------DVDECRMLAHLCAHGECINSLGSFRCHCQAGYTPD-ATATTCLDMDECSQVPKPCTFLCKNTKGSF--LCSCPRGYLLEEDGRTCKDL 2447          

HSP 9 Score: 187.193 bits (474), Expect = 5.498e-46
Identity = 229/757 (30.25%), Postives = 308/757 (40.69%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVD--INECLLNN--------------GHGPCQDECKNVDG---GYQCECGGL----------PGTQLSDKDNHTCISDEA--CQVNNGGC-SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGY----EGDDCSDINE----------CETQDLI--------CDHNC--------------INTEGSAHCTCKAGFDLMD--ETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME-DSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNV-CRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIP--GGLK----CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFK 1096
            C C+ G+ L+   G C D++EC D     + +C N PG+Y+C C   F     G  CVD     C L                G G  +  C    G   G  CE   +          PG +    +  T I ++   CQ   G C   +C++++    C CP GY L E  + C DI+EC T    C    C N  G+  C C + Y     G++C D+ +          C+ +           C +N               I+ +    C  +A   L D    +  D DEC      C   +C N  G+F+C C  GF+ N+  L C D +EC    + C    DCIN PGS+ C+C  G++L    +C+  NEC     +C  G C + EG+Y C C  G+      + C+DI+EC R PCG+G C N    Y+C C  G+V   N  C D+DEC  L    C   G C N  GSF C C  G+E       C D NE       C P G C N +GSF C+C  GF   Q  S+ CID DEC   P  C    C N+ G F+CLC  GF LS+   + C D  +           C     +  C   + +          K  C  S+RP  G    C   P  G       C    G +    D R   D NEC  N G C +  C+N  G   C C  G+  D      CV    CSV +      C +   G    C C  GF+
Sbjct: 1428 CICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRF-GHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLP-GTCQNLEGSFRCICPPGF---QVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDN-GHRCFDTRQ---------SFCFTRFEAGKCSVPKAFNT-------TKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSR--EDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTG-INCVDTDECSVGHPCGQGTCTNVIGGF--ECACADGFE 2157          

HSP 10 Score: 114.775 bits (286), Expect = 5.222e-24
Identity = 134/481 (27.86%), Postives = 194/481 (40.33%), Query Frame = 0
Query:  741 STLCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNGGCQQLCINIPGGLKCE----CNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKC 1203
            + LC +G C     +Y C+C+ GY       C+D++EC  +PC HG+C+N    Y C C+ G+        C D DEC+        G+C N  GSF C C  G+E       C D NE +        +G C+N DGSF C+C  GF+      + C+D DEC +   C +  C NT G F C C  G A+                  G   +VCV+      C     Y   E+G+C         K EC     P+ G  + C   P     E    C+ G  + + D R   D NEC ++   C +  C N  G + C C+LG++      + C     C++N+  C +       G  + C CP GF    D   CK +   C S+P  S        + ++G +     CK        P+G           W   ++  CEV        L   ++  E C T  +  GS C
Sbjct:  416 TNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMC--VNGVCLNEDGSFSCLCKPGFLLAPG-GHYCMDIDECQTPGICVNGHCTNTEGSFRCQCLGGLAV------------------GTDGRVCVDTHVRSTC-----YGAIEKGSCARPFPGTVTKSEC-CCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGI-TTDGR---DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASG-KDCTDVDECALNSLLCDNGWCQNSPG-SYSCSCPPGFHFWQDTEICKDV-DECLSSPCVSG-----VCRNLAGSYT----CKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVN-------LQGASLRSECCATLGAAWGSPC 846          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:FBN1 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0001501 "skeletal system development" evidence=IEA] [GO:0001527 "microfibril" evidence=IEA] [GO:0005201 "extracellular matrix structural constituent" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005604 "basement membrane" evidence=IEA] [GO:0005615 "extracellular space" evidence=IEA] [GO:0007507 "heart development" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF07645 PIRSF:PIRSF036312 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005615 GO:GO:0007507 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 GO:GO:0001501 PROSITE:PS01186 PROSITE:PS00010 GO:GO:0005604 GO:GO:0001527 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 GO:GO:0005201 CTD:2200 KO:K06825 Gene3D:3.90.290.10 InterPro:IPR017878 PANTHER:PTHR24039 Pfam:PF00683 SUPFAM:SSF57581 PROSITE:PS51364 OMA:GGSCSDD OrthoDB:EOG7RV9F6 TreeFam:TF316849 GeneTree:ENSGT00740000114996 EMBL:AAEX03016111 RefSeq:NP_001274014.1 Ensembl:ENSCAFT00000023394 GeneID:478293 KEGG:cfa:478293 Uniprot:F1PIA3)

HSP 1 Score: 261.536 bits (667), Expect = 9.708e-69
Identity = 240/713 (33.66%), Postives = 327/713 (45.86%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINE----------------------------CLLNNGHG---PCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGV---GGKCNNKP----GSFDCDCA----------------PGYEFK------NGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPE 1059
            C C  G++LN+D   C+DV+EC + P +C    C N  G Y C C   +   + G  C+D+                              C  N G     PC+         +   CG      + D      +  + C+   G C +  CI+      C CP G+  ++    C DI+EC  G +   N +C+N  GS  C C  GY       C+D NEC+    IC H  CI+T GS +C C  GF    D+T C D +ECE D  G    C N  G+F C C  GF L+ +N  C D +EC  G  N    G CINT GSF C+C+ G+E+  D  +C+DINEC      C  G+C NL+G+Y C C  GY   N  C DI+EC+  P  C  G C N    + C C  G+        C+D    L  + C     GGKC++         +C CA                P   F+      +G     ++ +++ D C       HG C+N DGS+ C C  G+I + N+   C+D DEC + +PC +  CKN +GGFEC CE GF    ++  TCEDINECA N   C+  CVN  GS+ C+C  GY  +++R  C  +DEC   +      Q  C N+ G   C C PGY     D   CVD+NEC    G C++  C+N  G +TC C  GF P     E
Sbjct: 1631 CRCPTGYYLNEDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSFRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNN-DCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQD----LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILEGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMM--TCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYICICGPGY-QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECSDGFTPSPAQDE 2330          

HSP 2 Score: 234.572 bits (597), Expect = 1.868e-60
Identity = 227/648 (35.03%), Postives = 306/648 (47.22%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQ-QLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSC 1047
            C C  GF L+ ++  C D+DEC   P+LC    C N PG + C C  G+ S       C+DI+EC    LL  G       C N +G Y+CEC   PG QLS  +   CI    C+++   C +  C++   +  C C  GY    D   CVDI+EC   +  C   C N  GS  C C  G+    +   C+DI+ECE    ICD   C N  G   C C  GF   ++ + C D +EC+++   C    C N +G+F C C  G+        CTD NEC IG  NC  +  C NT GSF C C PG+      C D++EC+N T +C     C N  G+Y C C  GY     TC D++EC    N CG+G+C+N   GY C C  G+V   +   C D DEC   N C V G C+N PG F C+C  GYE     G C D+NE  L+   C   G+CVN  GS+ C C   F  + N + + C+D     S  C+     +   G   C  E G  +S+   + C     C+L    G   ++C  +  S Y   C   EG++ +      L+D       P G CQ   CIN  G  +C C  GY ++ +D R+C D NEC          C N +G +TC C
Sbjct: 1053 CRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRG-----GVCLNTEGSYRCEC--PPGHQLS-PNISACIDINECELSANLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNIC-VFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-CLDPTTC-ISGNCVNTPGSYTCDCPPDF--ELNPTRVGCVDT---RSGNCYLDIRPRGDNGDTACSNEIGVGVSKA--SCC-----CSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPI-TVILEDIDECQELP-GLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCIC 1674          

HSP 3 Score: 231.876 bits (590), Expect = 1.100e-59
Identity = 203/604 (33.61%), Postives = 285/604 (47.19%), Query Frame = 0
Query:  426 DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGF-------DLMDETE--CF------------------DKDECEMDNGG-----CEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            D+     C    G  +  D    D+DEC  +P++C H  C N  G+Y C+C  G+  +G  CVD +EC + N   PC +  CKNV GG++C C  G  PG  +      TC     C  N   C+  C+++Y    C CP GY L ED + C D +EC  G   C  K   C N+ G+  C C  GY+    G+ C D NEC+T+  IC++  C+NT GS  C C  GF       + +D  E  CF                   K EC  D G      CE         F+  C  G    T+     D +EC + I +    G+C+N  GS++C C  G+  ++   SC+D+NEC  +    +  C N EG+++C C  GYI      +C D++EC   ++ C    C+N    ++C C  G+      C D +EC  D N CG  G C N PGSF C+C  G+        C D++E   E +    HG C N  G + C C QG++      N C+D +ECLS+  C  + C NTLG ++C+C  GF   E     C+DINEC      CS  C N  G + C C  GY +  +G+C 
Sbjct: 2104 DEAFRQICPYGSGIIVGPDDSAVDMDEC-KEPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGN---PCGNGTCKNVIGGFECTCEEGFEPGPMM------TCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYICICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECSDGFTPSPAQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG---ADIDECKV-IHDVCRNGECVNDRGSYHCLCKNGYTPDITGTSCVDLNECNQAPKPCNFICKNTEGSFQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGSFTCKCPPGFTQHHTACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQSGASCEDVDE--CEGNHRCQHG-CQNIIGGYRCSCPQGYLQ-HYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQY-EQFSGGCQDINECGSAQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCV 2687          

HSP 4 Score: 224.557 bits (571), Expect = 1.938e-57
Identity = 231/707 (32.67%), Postives = 337/707 (47.67%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFT--SQGTACVDI--NECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCP--DGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-IYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKP----GSFDCDCAPGYEF-KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP-CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHIC--KSTESGL-HHRCMCPSGFKLKTDARTCKPIGGICSSAPRP 1117
            C C  G+ L +D +CED+DECV++PE+C    C+N  G++ C C  GF+  S G  C D+  + C      G C    K+ +   Q  C  L G    D           C++    C  E   ++ QI   CP   G  +  D  + VD++EC   D+    +C+N  GS  C+C  GY  EG++C D +EC   +   +  C N  G   CTC+ GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C DE+EC  G  +C     +C N  G++ C C PG++   D   C+D NEC T   +C +G C N  G+Y C+C  G+    +     +EC+ N    G C  E       C  G  + + V +   EC  D   G G  C   P     +F   C  G  F  NG   DI+E  +  D C  +G+CVN+ GS+ C+C  G+  D   ++ C+D +EC  +P   +  CKNT G F+C C  G+ L E    +C+D++ECA    +C  +CVN +GS  C+C  G+ +     C   +EC       G  + +C N PG   CEC  G+ +D Q    C D +EC  N+  CQH C N +GG+ CSC  G+        +CV    C       +HIC   S  + L  ++CMCP+GF+ +  +  C+ I   C SA  P
Sbjct: 1998 CICPPGYSLQND-KCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSP-KSRNHSKQECCCALKGEGWGD----------PCEL----CPTEPDEAFRQI---CPYGSGIIVGPD-DSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYICICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECSDGFTPSPAQ----DECLDNR--EGYCFTEV--LQNMCQIGSSNRNPVTK--SECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGA--DIDECKVIHDVC-RNGECVNDRGSYHCLCKNGYTPDITGTS-CVDLNECNQAPKPCNFICKNTEGSFQCSCPKGYILQED-GRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFTQHHTA-CIDNNECTSDINLCGS-KGICQNTPGSFTCECQRGFSLD-QSGASCEDVDECEGNH-RCQHGCQNIIGGYRCSCPQGYL-QHYQWNQCVDENECLS-----AHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINE-CGSAQAP 2658          

HSP 5 Score: 223.402 bits (568), Expect = 5.135e-57
Identity = 262/832 (31.49%), Postives = 368/832 (44.23%), Query Frame = 0
Query:  369 YAF-DPSKPDTLFCSERRWIGKRPLCVAKSTLEIA--DPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLP-----GTQLSDKDNHTC---ISDEACQVNNGGCS--HECIHSYN----------QIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAH------CTCKAGFDLMDETEC----------------------------FDKD--ECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL--CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN----GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            YAF +P +P    C  +     + LC +   +  A  D +  + DPD+     CE++    +G T  C C+ G+ ++  G+ C D++ECV +  LCD+  C N PG+++C C  GF  +     C DI+EC       PC +  CKN  G + CEC          T   +    TC   + D  C++N  G +   +C  S            Q+  +C  GY   +  + C DINEC      C N  C+N  GS  C+C +G      G  C DI          D  C       H      C+  A +   +  EC                            F KD  EC+M    C    C N  G+F+C C  GF L+++   CTD +EC I    CG  G C+NTPG F C+C  G+E   +M  +CMDI+EC  +  LC  G C N EG+Y C+C  G+    + S C+DINEC    N C +G C+N    Y C+C+ GY    +   C D DEC   N  G    C N  GS++C C PG+        C DI+E     + C   G C N  G + C+C+ GF+  + D   C+D +EC  +P  C    C+NT G F C C+ G++  +     C DINEC +   +C +  VC N  GS  C C  G+  D    C   DEC         C Q   C N  G  +C C  GY   + D   C D +EC+ N   C +  C+N  GG+ C C +GF P   + + C     CS+ N    G C ++      GL  RC C  G++L      C  +
Sbjct:  690 YAFGEPCQP----CPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENL----RG-TYKCICNSGYEVDPSGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECE----SSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQ-CEDINECEVFPGVCKNGVCVNSEGSFKCQCPNGMTLDATGRICLDIRLETCFLRYEDEECTLPVAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCG-RGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCECPPGHQLSPNISACIDINECELSANLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNG-GCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASE-DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYS-GKKGKTGCTDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGI-KCTDLDECSNGTHM---CSQHADCKNTMGSYRCLCKEGY---TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVP-SADGKACEDIDECSLPNICVFGTCHNL-----PGL-FRCECEIGYELDRSGGNCTDV 1488          

HSP 6 Score: 205.682 bits (522), Expect = 1.251e-51
Identity = 232/737 (31.48%), Postives = 330/737 (44.78%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT-SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCS-HECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTG-DIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQ--CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDEC---LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPC-FHSECKNTLGGFECLCETG---------------FALSEILPN------TCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACS--VNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C H   +D   +  C CH GF  N D   C D++EC  D    +  C N  G++ C C  GF  S    C+D++EC   NG+     +C N  G +QC+C    G +++  D  TC+    C +  G C+   C +      C+CP GY L  D   C DI+ECV   +I  L  C N  GS  C C  G+     S    C  QDL   +     EG    + K+      E  C  K E   D   CE      +  F+  C    G  +  D+ +  D +EC     +   +G CINT GS+ CEC  G+ L  + C+D +EC+    CG+G+C N+ G +EC C+ G+      TC DINEC +NP  C    C+N    Y C C +GYV  ++  +C+D DEC    HD       +C N  G++ C C PGY+ +     C D NE   +   C  +G C+N  GS+ C C  GF         C+D      F E L + C   S  +N +   EC C+ G                A  ++ P+         DI+EC + +  C    CVN  GS++C C  GY  D  G +C   +EC  + +P   C  +C N  G  +C C  GYI+  +D R C D +EC      CQ  C+N +G  TC C  GF    ++   C+    C+  +N  G   IC++T       C C  GF L     +C+ +
Sbjct: 1860 CSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERD-ACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCN--EGYEVA-PDGRTCVDINECLLEPGKCAPGTCQNLDGSYRCICPPGYSLQND--KCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLS--STGRRC--QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDP--CELCPTEPDEAFRQICPYGSGIIVGPDD-SAVDMDECK--EPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCA-EKQMECKNLIGTYICICGPGYQRRPDGEGCVDENECQTKPGIC-ENGRCLNTRGSYTCECSDGFTPSPAQDE-CLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCLCKNGYTPDITGTSCVDLNECNQAPKP---CNFICKNTEGSFQCSCPKGYIL-QEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFT---QHHTACIDNNECTSDINLCGSKGICQNTPGSF--TCECQRGFSLDQSGASCEDV 2568          

HSP 7 Score: 199.519 bits (506), Expect = 8.959e-50
Identity = 236/766 (30.81%), Postives = 323/766 (42.17%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINE--CV--------TGDIQCLNKCMNVPGSAYCKCDSGYEG----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF-DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENEC-TIGIANCGIYGDCINTPGSFYCECHPGFELME--DSCMDINE--CTNSTLCGSGSCN----------------NLEGTYECKCDS------------------GYIFHNSTCL--DINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN-GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI----------GGICSSAPRPSN 1119
            C C +G+   D   C D+DEC ++  LC +  C N PG Y C+C +GF  ++ G AC DI+EC L N    C    C N+ G ++CEC    G +L D+    C     C       S  C+++     C CP  +EL+     CVD     C          GD  C N+       A C C  G       + C  +N  E + L              C    GF     T    D DEC+   G C+   C N  G+FQC C  G++LN D   C D NEC T GI  CG  G C NT G++ C C P +  +   ++CMD+    C  +    + +C+                N+   +   C+                   G++    T L  DI+EC   P  C +G CIN    + C C  G+   D   VC D DEC +   C    +C N  GSF CDC PGY F + G C+D NE     + C  HG C++  GSF C+CH GF  +  D  +C+D +EC    C +  C+NT+G F C C  GF LS    N C D++ECA  NG+  +   C+N +GS  C+C EGY+    G  C   +EC L   P       C N+ G  +C C PGY + +     C D +EC                              + PE C                C +TE     +C+CP GF L +  R C+ +          GG CSS P+  N
Sbjct: 1389 CLCKEGY-TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPN---ICVFGTCHNLPGLFRCEC--EIGYEL-DRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPPVNTSEYKIL--------------CPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGI--CGP-GTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSFRCDCKPGYRFTSTGQCNDRNECQEIPNICS-HGQCIDTVGSFYCLCHTGFKTNA-DQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSH--NNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLL--EPGKCAPGTCQNLDGSYRCICPPGYSLQNDK---CEDIDECV-----------------------------EEPEICALG------------TCSNTEGSF--KCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSS-PKSRN 2077          

HSP 8 Score: 196.438 bits (498), Expect = 8.859e-49
Identity = 245/827 (29.63%), Postives = 336/827 (40.63%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKC----DSGYEGDDCSDINE---------------------------CETQDLICDHNC----INTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------------------------FDECLSS--------PCFHSECKNTLGGFECLCET--GFALSEILPNT--CEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY------------IVDSQ-DPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEK--CVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            CEC+ GF L+  GEC DVDEC  +P      C N  G+Y C CR G+ S    T C DI+ECL  NG       C N DG + C C    G  ++ +D   C   + C + N   +  CI+      C+C  G++L  D + C DINEC T  I    +C+N  GS  C+C      G +G  C D +                            C + +      C              C +G  +       D +EC +D   C   +C NL GT++C C  G+ ++     C D NEC +    C   G C NTPGSF C C  GF    D  +C DI+EC  S+ C +G C N  G++ C+C S      +  + I E I+     G C        C  +     + + C         +PC +   C   P      C  GY   K   C DINE  +    C  +G CVN++GSF+C C  G   D     IC+D                         D C  S         C     +NT   +E LC    GFA  EI       +DINEC +    C+   C N +GS  CRC  G+  D E  NC   DECR+S  P+   +  C+N PG  +C+C+ GY            I + Q DP L                             C+D NEC ++   C +  C+N +G + C+C+ G+      P++  CV    CS+ NGGC   C ++E    + C C  GF L  D R+C  I           GG C++ P    G YRC
Sbjct:  474 CECNKGFQLDLRGECIDVDECEKNP-CAGGECINNQGSYTCQCRPGYQSTLTRTECRDIDECL-QNGRICNNGRCINTDGSFHCVCNA--GFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGS--DINECALDPDICPNGICENLRGTYKCICNSGYEVDPSGKNCVDINECVLNSLLCD-NGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDEC-ESSPCINGVCKNSPGSFICECSSESTLDPTKTICI-ETIK-----GTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTL---CQVDP-----ICGKGYSRIKGTQCEDINECEVFPGVC-KNGVCVNSEGSFKCQCPNGMTLDAT-GRICLDIRLETCFLRYEDEECTLPVAGRHRMDACCCSVGAAWGTEECEECPVRNTP-EYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRIS--PDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCECPPGHQLSPNISACIDINECELSANLCPNGRCVNLIGKYQCACNPGY---HSTPDRLFCVDIDECSIMNGGCETFCTNSEG--SYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP----GEYRC 1263          

HSP 9 Score: 140.969 bits (354), Expect = 6.392e-32
Identity = 134/415 (32.29%), Postives = 189/415 (45.54%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDK---DNHTCISDEA----CQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGC--EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV 805
            P + E  RC     L+   + TCEC DGF  +        DEC+D+ E     C  +    M  C++G +++    V  +EC  + G G           G  CE     GT    K        +++ A    C+V +  C + EC++      CLC +GY  D    +CVD+NEC      C   C N  GS  C C  GY    +G  C D++EC T+   C   C+NT GS  C C  GF     T C D +EC  D   C  + +C N  G+F C C+ GF L+    +C D +EC     N      C N  G + C C  G+      + C+D NEC ++ +CG  SC+N  G+Y+C C +G+ +   +  C DINEC   + PC +G C N   GY C C  GY  +
Sbjct: 2299 PGICENGRC-----LNTRGSYTCECSDGFTPS-----PAQDECLDNRE---GYCFTEVLQNM--CQIGSSNRNP--VTKSECCCDGGRG----------WGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCLCKNGYTPDITGTSCVDLNECNQAPKPCNFICKNTEGSFQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGF-TQHHTACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQSGASCEDVDECE---GNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYG-CSNTEGGYLCGCPPGYFRI 2681          

HSP 10 Score: 129.028 bits (323), Expect = 3.046e-28
Identity = 150/507 (29.59%), Postives = 217/507 (42.80%), Query Frame = 0
Query:  743 LCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVD--VDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF-KNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNG---GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLF-----TCNNGYQITGVKKTRCTRLSE 1226
            LC +G C    G+Y C+C+ G+       C+D++EC +NPC  GECIN    Y+C C  GY        CRD DECL +      G+C N  GSF C C  G+   ++G  C D++E S+ ++ C  +G C+N DGSF+C+C  GF    +D   C D +EC +   C +  C NT G + C C  G A+                  G   +VCV+        CY GYK   RG C         K EC  +         CQ          +  C+ G  + S       D NEC ++   C +  C N  G + C C+ G++ D    + CV    C +N+  C +  C++T       C CP GF  K D +TC+ I   C S+P   NG      K   G F+    C+        PT  I  + I    W    D  CE+        ++   +  + C +  +  GS C        C  GY  + +K T+C  ++E
Sbjct:  459 LCQNGRCIPTPGSYRCECNKGFQLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSI-RNMC-LNGMCINEDGSFKCICKPGF-QLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAV------------------GLDGRVCVDTHMRS--TCYGGYK---RGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGS----DINECALDPDICPNGICENLRGTYKCICNSGYEVDPSG-KNCVDINECVLNSLLCDNGQCRNTPGSF--VCTCPKGFIYKPDLKTCEDIDE-CESSP-CINGVC----KNSPGSFI----CECSSESTLDPTKTICIETIKGTCWQTVIDGRCEIN-------INGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGY--SRIKGTQCEDINE 913          

HSP 11 Score: 67.781 bits (164), Expect = 9.484e-10
Identity = 67/212 (31.60%), Postives = 93/212 (43.87%), Query Frame = 0
Query:  895 DFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRP-NGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            D+ +     C +  C  T G + C C  GF L   L   C D++EC  N     + C+N  GS+ C+C  GY+    R  C   DEC  + R  N G    CIN  G   C CN G+ V ++D + C D +EC+I N      CIN+ G   C C  GF+    +   C     C       +  C +T+    +RC C  G  +  D R C
Sbjct:  451 DYCQLFRYLCQNGRCIPTPGSYRCECNKGFQLD--LRGECIDVDECEKNPCAGGE-CINNQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICNNG---RCINTDGSFHCVCNAGFHV-TRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQL-ASDGRYCKDINECETPGICMNGRCVNTDG--SYRCECFPGLAVGLDGRVC 652          

HSP 12 Score: 52.373 bits (124), Expect = 4.956e-5
Identity = 35/91 (38.46%), Postives = 48/91 (52.75%), Query Frame = 0
Query:  879 CHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGY 966
            C +GFI +   +  C D DEC + P  C    C NT+G FEC C  G   +E     CEDI+EC+   G C    C N + S++C+C  G+
Sbjct:  231 CRRGFIPNIR-TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEA-SQKCEDIDECSTIPGICDGGECTNTVSSYFCKCPPGF 319          

HSP 13 Score: 50.447 bits (119), Expect = 1.749e-4
Identity = 34/89 (38.20%), Postives = 48/89 (53.93%), Query Frame = 0
Query:  721 CHPGF--ELMEDSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIRNP--CGHGECINESPGYSCSCHSGY 802
            C  GF   +   +C D++EC     LC  G+C N  G++ECKC +G+ F+ ++  C DI+EC   P  C  GEC N    Y C C  G+
Sbjct:  231 CRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEASQKCEDIDECSTIPGICDGGECTNTVSSYFCKCPPGF 319          
BLAST of EMLSAG00000000097 vs. GO
Match: - (symbol:Fbn1 "Fibrillin 1, isoform CRA_a" species:10116 "Rattus norvegicus" [GO:0001501 "skeletal system development" evidence=IEA] [GO:0001527 "microfibril" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005604 "basement membrane" evidence=IEA] [GO:0005615 "extracellular space" evidence=IEA] [GO:0007507 "heart development" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR011398 InterPro:IPR018097 Pfam:PF07645 PIRSF:PIRSF036312 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 RGD:620908 GO:GO:0005576 GO:GO:0005615 GO:GO:0007507 GO:GO:0005509 GO:GO:0071560 InterPro:IPR013032 PROSITE:PS00022 GO:GO:0001501 PROSITE:PS01186 GO:GO:0031012 PROSITE:PS00010 GO:GO:0005604 GO:GO:0001656 GO:GO:0001527 EMBL:CH473949 InterPro:IPR009030 SUPFAM:SSF57184 InterPro:IPR026823 Pfam:PF12662 GO:GO:0005201 Gene3D:3.90.290.10 InterPro:IPR017878 PANTHER:PTHR24039 Pfam:PF00683 SUPFAM:SSF57581 PROSITE:PS51364 OMA:GGSCSDD OrthoDB:EOG7RV9F6 TreeFam:TF316849 GeneTree:ENSGT00740000114996 EMBL:AABR06026007 EMBL:AABR06026008 EMBL:AABR06026009 RefSeq:XP_006234997.1 UniGene:Rn.12759 Ensembl:ENSRNOT00000056022 GeneID:83727 NextBio:35584380 Uniprot:G3V9M6)

HSP 1 Score: 260.766 bits (665), Expect = 1.499e-68
Identity = 239/705 (33.90%), Postives = 330/705 (46.81%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECK----------------NVDGGY-----QC------ECGGLPGTQ----LSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGV---GGKCNNKP----GSFDCDCAPGYE----------------------FKNGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            C C  G++LN+D   C+DV+EC + P +C    C N  G Y C C   +   + G  C+D+   L    +      C                 N+   +     QC      E   L G+Q    + D      +  + C+   G C +  CI+      C CP G+  ++    C DI+EC  G +   N +C+N  GS  C C  GY       C+D NEC+    IC H  CI+T GS +C C  GF    D+T C D +ECE D  G    C N  G+F C C  GF L+ +N  C D +EC  G  N    G C+NT GSF C C+ G+E+  D  +C+DINEC  +   C  G+C NL+G+Y C C  GY   N  C DI+EC+  P  C  G C N    + C C  G+        C+D    L  + C     GGKC++         +C CA   E                      F +G     ++ +++ D C       HG C+N DGS+ C C  G+I + N+   C+D DEC + +PC +  CKN +GGFEC CE GF    ++  TCEDINECA N   C+  CVN  GS+ C+C  GY  +++R  C  +DEC   +      Q  C N+ G   C C PGY     D   C+D+NEC    G C++  C+N LG +TC C+ GF
Sbjct: 1632 CRCPTGYYLNEDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYHADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNN-DCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQD----LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILEGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMM--TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGY-QRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGF 2323          

HSP 2 Score: 243.432 bits (620), Expect = 3.468e-63
Identity = 245/760 (32.24%), Postives = 345/760 (45.39%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQG--TACVDINECLLNN-GHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH--ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICD-HNCINTEGSAHCTCKAGFDL---------MDETECFDKDE------------------CEMDNGG----CEQVCNNLEGTFQ--CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECL---HDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPC-FHSECKNTLGGFECLCETGFALS---EILP------------------NTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACS--VNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C+C  G+ L   G+C D +EC + P +C H  C +  G++ C C  GF +    T C+DINEC  +  G+G     C+N  G + C C    G  LS   N+ CI  + C   NG      +C+++     C C +GYE+  D +TCVDINECV    +C    C N+ GS  C C  GY  + D C DI+EC  +  IC    C NTEGS  C C  GF L         +  + C+ K E                  C +   G    CE      +  F+  C    G  +  D+ +  D +EC     +   +G CINT GS+ CEC  G+ L  + C+D +EC+    CG+G+C N+ G +EC C+ G+      TC DINEC +NP  C    C+N    Y C C  GYV  ++  +C+D DEC    HD       +C N  G++ C C PGY+ +     C D NE   +   C  +G C+N  GS+ C C+ GF         C+D      F E L + C   S  +N +   EC C+ G       EI P                      DI+EC + +  C    CVN  GS++C C  GY  D  G  C   +EC  + +P   C  +C N  G  +C C  GYI+  +D R C D +EC      CQ  C+N +GG TC C  GF    ++   C+    C+  +N  G   +C++T       C C  GF L     +C+ +
Sbjct: 1834 CDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNG----TCRNTIGSFNCRCN--HGFILS--HNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDD-SAVDMDECK--EPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCT-EKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGIC-ENGRCLNTLGSYTCECNDGFTASPTQDE-CLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKP---CNFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFT---QHHTACIDNNECTSEINLCGSKGVCQNTPGSF--TCECQRGFSLDQSGASCEDV 2569          

HSP 3 Score: 234.958 bits (598), Expect = 1.449e-60
Identity = 206/608 (33.88%), Postives = 288/608 (47.37%), Query Frame = 0
Query:  426 DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLM-DETECFD--------------------------KDECEMDNGG-----CEQVCNNLEGTFQ----CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            D+     C    G  +  D    D+DEC  +P++C H  C N  G+Y C+C  G+  +G  CVD +EC + N   PC +  CKNV GG++C C  G  PG  +      TC     C  N   C+  C+++Y    C CP GY L ED + C D +EC  G   C  K   C N+ G+  C C  GY+    G+ C D NEC+T+  IC++  C+NT GS  C C  GF     + EC D                          K EC  D G      CE +C   EGT      C    GF  N       D +EC + I +    G+C+N  GS++C C  G+  ++   +C+D+NEC  +    +  C N EG+Y+C C  GYI      +C D++EC   ++ C    C+N   G++C C  G+      C D +EC  + N CG  G C N PGSF C+C  G+        C D++E   E +    HG C N  G + C C QG++      N C+D +ECLS+  C  + C NTLG ++C+C  GF   E     C+DINEC  +   CS  C N  G + C C  GY +  +G+C 
Sbjct: 2105 DEAFRQICPFGSGIIVGPDDSAVDMDEC-KEPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGN---PCGNGTCKNVIGGFECTCEEGFEPGPMM------TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCE-IC-PFEGTVAYKKLCPHGRGFMTNG-----ADIDECKV-IHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHTACIDNNECTSEINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDE--CEGNHRCQHG-CQNIIGGYRCSCPQGYLQ-HYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPAGFQY-EQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYLRIGQGHCV 2688          

HSP 4 Score: 233.802 bits (595), Expect = 3.271e-60
Identity = 227/648 (35.03%), Postives = 306/648 (47.22%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGC-SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQ-QLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSC 1047
            C C  GF L+ ++  C D+DEC   P+LC    C N PG + C C  G+ S       C+DI+EC    LL  G       C N +G Y+CEC    G QLS  +   CI    C+++   C S  C++   +  C C  GY    D   CVDI+EC   +  C   C N  GS  C C  G+    +   C+DI+ECE    ICD   C N  G   C C  GF   ++ + C D +EC+++   C    C N +G+F C C  G+        CTD NEC IG  NCG +  C NT GSF C C PG+      C D++EC+N T +C     C N  G+Y C C  GY     TC D++EC    N CG+G+C+N   GY C C  G+V   +   C D +EC   N C V G C+N PG F C+C  GYE     G C D+NE  L+   C   G+CVN  GS+ C C   F  + N + + C+D     S  C+     +   G   C  E G  +S+   + C     C+L    G   ++C  +  S Y   C   EG++ +      L+D       P G CQ   CIN  G  +C C  GY ++ +D R+C D NEC          C N +G +TC C
Sbjct: 1054 CRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRG-----GICHNTEGSYRCEC--PSGHQLS-PNISACIDINECELSANLCPSGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDINECSLPNIC-VFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-CLDPTTC-ISGNCVNTPGSYTCDCPPDF--ELNPTRVGCVDT---RSGNCYLDIRPRGDNGDTACSNEIGVGVSKA--SCC-----CSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPI-TVILEDIDECQELP-GLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCIC 1675          

HSP 5 Score: 227.639 bits (579), Expect = 2.176e-58
Identity = 272/836 (32.54%), Postives = 376/836 (44.98%), Query Frame = 0
Query:  369 YAF-DPSKPDTLFCSERRWIGKRPLCVAKSTLEIA--DPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLPGTQLSDKDNHTCIS-----------DEACQVNNGGCS--HECIHSYN----------QIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDIN-----------ECETQDLICDHN---CINTEGSAH-------------------CTCKAGFDLMDET--ECFDKD--ECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL--CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN----GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            YAF +P +P    C  +     + LC +   +  A  D +  + DPD+     CE++    +G T  C C+ G+ ++  G+ C D++ECV +  LCD+  C N PG+++C C  GF  +     C DI+EC       PC +  CKN  G + CEC   P + L D     CI            D  C++N  G +   EC  S            Q+  +C  GY   +  + C DINEC      C N  C+N  GS  C+C SG      G  C DI            EC T  +   H    C  + G+A                    C    GF   D T  + F KD  EC+M    C    C N  G+F+C C  GF L+++   CTD +EC I    CG  G C+NTPG F C+C  G+E   +M  +CMDI+EC  +  LC  G C+N EG+Y C+C SG+    + S C+DINEC    N C  G C+N    Y C+C+ GY    +   C D DEC   N  G    C N  GS++C C PG+        C DI+E     + C   G C N  G + C+C+ GF+  + D   C+D +EC  +P  C    C+NT G F C C+ G++  +     C DINEC +   +C +  VC N  GS  C C  G+  D    C   DEC         C Q   C N  G  +C C  GY   + D   C D +EC+ N   C +  C+N  GG+ C C +GF P   + + C     CS+ N    G C ++      GL  RC C  G++L      C  +
Sbjct:  691 YAFGEPCQP----CPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENL----RG-TYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECE----SSPCINGVCKNSPGSFICECS--PESTL-DPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQVDPICGKGYSRIKGTQ-CEDINECEVFPGVCKNGLCVNSRGSFKCECPSGMTLDATGRICLDIRLETCFLKYDDEEC-TLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCG-RGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPSGHQLSPNISACIDINECELSANLCPSGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIMNG-GCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASE-DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYS-GKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGI-KCTDLDECSNGTHM---CSQHADCKNTMGSYRCLCKDGY---TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVP-SADGKACEDINECSLPNICVFGTCHNL-----PGL-FRCECEIGYELDRSGGNCTDV 1489          

HSP 6 Score: 225.713 bits (574), Expect = 8.962e-58
Identity = 242/792 (30.56%), Postives = 347/792 (43.81%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCP---DGY---------ELDEDWK---------------TCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-IYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLD------INECIRNPCGHGE-----------CINESPGYSCSCH----SGYVDVDNVC----------RDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS---ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP---------SNGYYRCNKKKVSGYFVKGTK 1138
            C C++G+ +  DG  C D++ECV DP  C    C N  G+Y C C  G++ Q   C DI+EC+           C N +G ++C C  G   +    +     +S    +   G CS     ++++  C C    +G+         E DE ++               + VD++EC   D+    +C+N  GS  C+C  GY  EG++C D +EC   +   +  C N  G   CTC+ GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C DE+EC  G  +C     +C N  G++ C C PG++   D   C+D NEC T   +C +G C N  G+Y C+C+ G+        CLD       +E ++N C  G            C +   G+   C      G V    +C           D DEC   +     G+C N  GS+ C C  GY  +     C D+NE +    PC  +  C N +GS++C C +G+I  Q D   C D DEC +    H+    C NT+GGF C C  GF         C D NEC      C    VC N  GS  C C  G+  D+ G +C   DEC  + R    CQ  C NI GG +C C  GY+   Q  + CVD+NEC   +     +C N LG + C C  GF+  E+    C     C  +   CS+ C +TE G  + C CP G+ L+     C    G+    P P         S     C + K++GY  +G K
Sbjct: 1957 CRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECV-EEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPC--NFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQ--HNCQFLCVNTIGGFTCKCPPGFTQHHT---ACIDNNECTSEINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHR----CQHGCQNIIGGYRCSCPQGYLQHYQWNQ-CVDENECLSAHVCGGASCHNTLGSYKCMCPAGFQ-YEQFSGGCQDINECGSSQAPCSYGCSNTEGG--YLCGCPPGY-LRIGQGHCVSGMGMGRGGPEPPASGEMDDNSLSPEACYECKINGYPKRGRK 2730          

HSP 7 Score: 201.06 bits (510), Expect = 3.331e-50
Identity = 238/766 (31.07%), Postives = 322/766 (42.04%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINE--CV--------TGDIQCLNKCMNVPGSAYCKCDSGYEG----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF-DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENEC-TIGIANCGIYGDCINTPGSFYCECHPGFELME--DSCMDINE--CTNSTLCGSGSCN----------------NLEGTYECKCDS------------------GYIFHNSTCL--DINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN-GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI----------GGICSSAPRPSN 1119
            C C DG+   D   C D+DEC ++  LC +  C N PG Y C+C +GF  ++ G AC DINEC L N    C    C N+ G ++CEC    G +L D+    C     C       S  C+++     C CP  +EL+     CVD     C          GD  C N+       A C C  G       + C  +N  E + L              C    GF     T    D DEC+   G C+   C N  G+FQC C  G++LN D   C D NEC T GI  CG  G C NT G++ C C P +  +   ++CMD+    C  +    + +C+                N+   +   C+                   G++    T L  DI+EC   P  C +G CIN    + C C  G+   D   VC D DEC +   C    +C N  GS+ CDC PGY   + G C+D NE     + C  HG C++  GSF C+CH GF  +  D  +C+D +EC    C +  C+NT+G F C C  GF LS    N C D++ECA  NG+  +   CVN +GS  CRC EGY+    G  C   +EC L   P       C N+ G  +C C PGY + +     C D +EC                              + PE C                C +TE     +C+CP GF L +  R C+ +          GG CSS P+  N
Sbjct: 1390 CLCKDGY-TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDINECSLPN---ICVFGTCHNLPGLFRCEC--EIGYEL-DRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPPVNTSEYKIL--------------CPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGI--CGP-GTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYHADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNICS-HGQCIDTVGSFYCLCHTGFKTNA-DQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSH--NNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLD--PGKCAPGTCQNLDGSYRCICPPGYSLQNDK---CEDIDECV-----------------------------EEPEICALG------------TCSNTEGSF--KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSS-PKSRN 2078          

HSP 8 Score: 193.356 bits (490), Expect = 7.521e-48
Identity = 242/827 (29.26%), Postives = 326/827 (39.42%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKC----DSGYEGDDCSDINE---------------------------CETQDLICDHNC----INTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF----HSECKNTLGGFE----CLCETGFALS----------------EILPNT--------------CEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY------------IVDSQ-DPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            CEC+ GF L+  GEC DVDEC  +P      C N  G+Y C CR G+ S    T C DI+ECL  NG       C N DG + C C    G  ++ +D   C   + C + N   +  CI+      C+C  G++L  D + C DINEC T  I    +C+N  GS  C+C      G +G  C D +                            C + +      C              C +G  +       D +EC +D   C   +C NL GT++C C  G+ ++     C D NEC +    C   G C NTPGSF C C  GF    D  +C DI+EC  S+ C +G C N  G++ C+C         + LD  + I      G C        C  +     + + C         +PC +   C   P      C  GY   K   C DINE  +    C  +G CVN+ GSF+C C  G   D     IC+D        CF      EC   + G      C C  G A                  E+ P                 +DINEC +    C+   C N +GS  CRC  G+  D E  NC   DECR+S  P+   +  C+N PG  +C+C+ GY            I + Q DP L                             C+D NEC ++   C    C+N +G + C+C+ G+ P       CV    CS+ NGGC   C  T S   + C C  GF L  D R+C  I           GG C++ P    G YRC
Sbjct:  475 CECNKGFQLDIRGECIDVDECEKNP-CTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECL-QNGRICNNGRCINTDGSFHCVCNA--GFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGS--DINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCD-NGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDEC-ESSPCINGVCKNSPGSFICECSP------ESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTI---CQVDP-----ICGKGYSRIKGTQCEDINECEVFPGVC-KNGLCVNSRGSFKCECPSGMTLDAT-GRICLDI---RLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRIS--PDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPSGHQLSPNISACIDINECELSANLCPSGRCVNLIGKYQCACNPGYHPTHDR-LFCVDIDECSIMNGGCETFC--TNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP----GEYRC 1264          

HSP 9 Score: 174.866 bits (442), Expect = 3.085e-42
Identity = 166/504 (32.94%), Postives = 229/504 (45.44%), Query Frame = 0
Query:  589 KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFD-LMDETECFDKDECEMDNGGCEQVCN-----NLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECIRNPC----GHGECINESPGY----SCSCHSGYVDVDNVCR-------------------------DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE--FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALS-------EILPNTC-----EDINECALNNGDCSQVCVNILGSHY------CR----CYEGYKKDERGNCFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVD 1021
            +C+  PGS  C+C+ G++ D   +C D++ECE         CIN +GS  C C+AG+   +  TEC D DEC + NG   ++CN     N +G+F C C  GFH+  D   C D +EC+  I N  + G CIN  GSF C C PGF+L  D   C DINEC    +C +G C N +G+Y C+C  G         C+D +  +R+ C      G+C+    G      C C S        C+                         D +EC  D      G C N  G++ C C  GYE       C DINE  L    C  +G C N  GSF C C +GF++ + D   C D DEC SSPC +  CKN+ G F C C     L        E +  TC     +   E  +N       C + LG+ +      C+    C +GY + +   C   +EC +     G C+  LC+N  G  KCEC  G  +D+   R+C+D
Sbjct:  465 RCIPTPGSYRCECNKGFQLDIRGECIDVDECEKNPCT-GGECINNQGSYTCHCRAGYQSTLTRTECRDIDEC-LQNG---RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECS--IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTH--MRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFVY-KPDLKTCEDIDECESSPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQVDPICGKGYSRIKGTQCEDINECEVFP---GVCKNGLCVNSRGSFKCECPSGMTLDATG-RICLD 953          

HSP 10 Score: 139.813 bits (351), Expect = 1.424e-31
Identity = 133/415 (32.05%), Postives = 191/415 (46.02%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDK---DNHTCISDEA----CQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDEC--EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV 805
            P + E  RC     L+   + TCEC+DGF  +        DEC+D+ E     C ++    M  C++G +++    V  +EC  + G G           G  CE     GT    K        +++ A    C+V +  C + EC++      C+C  GY  D     CVD+NEC      C   C N  GS  C C  GY    +G  C D++EC T+   C   C+NT G   C C  GF     T C D +EC  E++  G + VC N  G+F C C+ GF L+    +C D +EC     N      C N  G + C C  G+      + C+D NEC ++ +CG  SC+N  G+Y+C C +G+ +   +  C DINEC   + PC +G C N   GY C C  GY+ +
Sbjct: 2300 PGICENGRC-----LNTLGSYTCECNDGFTAS-----PTQDECLDNRE---GYCFSEVLQNM--CQIGSSNRNP--VTKSECCCDGGRG----------WGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGF-TQHHTACIDNNECTSEINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECE---GNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSSQAPCSYG-CSNTEGGYLCGCPPGYLRI 2682          

HSP 11 Score: 138.272 bits (347), Expect = 3.691e-31
Identity = 162/510 (31.76%), Postives = 216/510 (42.35%), Query Frame = 0
Query:  616 CETQDLICDHN-CINTEGSAHCTCKAGFDLMDETECFDKDECEMD--NGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC-IRNPCGHGECINESPGYSCSCHSGY-VDVDN-VCRDY-------------------------DEC-------LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCY-EGYKKDERGNCF--LKDECRLSRRPNGGCQQLCINIPGG-LKCECNPGYIVDSQDP-------------------RLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPD 1054
            C+    +C +  CI T GS  C C  GF L    EC D DECE +   GG    C N +G++ C C+ G+        C D +EC      C   G CINT GSF+C C+ GF +  D  +C D++EC+   +C +G C N +G+++C C  G+   +    C DINEC     C +G C+N    Y C C  G  V +D  VC D                           EC           PC      N+      C   PG         DINE +L+ D C P+G C N  G+++C+C+ G+  D    N C+D +EC+  S  C + +C+NT G F C C  GF     L  TCEDI+EC  +   NG    VC N  GS  C C  E      +  C   +K  C      +G C+   INI G  LK EC          P                     C D NEC +  G C++  C+N  G   C C  G   D
Sbjct:  454 CQLVRYLCQNGRCIPTPGSYRCECNKGFQLDIRGECIDVDECEKNPCTGG---ECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAG---SDINECALDPDIC-PNGICENLRGTYKCICNSGYEVDITGKN-CVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDL-KTCEDIDECESSPCING----VCKNSPGSFICECSPESTLDPTKTICIETIKGTC-WQTVIDGRCE---ININGATLKSECCSSLGAAWGSPCTICQVDPICGKGYSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPSGMTLD 945          

HSP 12 Score: 127.487 bits (319), Expect = 9.033e-28
Identity = 150/507 (29.59%), Postives = 218/507 (43.00%), Query Frame = 0
Query:  743 LCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVD--VDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF-KNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNG---GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLF-----TCNNGYQITGVKKTRCTRLSE 1226
            LC +G C    G+Y C+C+ G+       C+D++EC +NPC  GECIN    Y+C C +GY        CRD DECL +      G+C N  GSF C C  G+   ++G  C D++E S+ ++ C  +G C+N DGSF+C+C  GF    +D   C D +EC +   C +  C NT G + C C  G A+                  G   +VCV+        CY GY+   RG C         K EC  +         CQ          +  C+ G  + S       D NEC ++   C +  C N  G + C C+ G++ D    + CV    C +N+  C +  C++T       C CP GF  K D +TC+ I   C S+P   NG      K   G F+    C+        PT  I  + I    W    D  CE+        ++   +  E C +  +  GS C        C  GY  + +K T+C  ++E
Sbjct:  460 LCQNGRCIPTPGSYRCECNKGFQLDIRGECIDVDECEKNPCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSI-RNMC-LNGMCINEDGSFKCICKPGF-QLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAV------------------GLDGRVCVDTHMRS--TCYGGYR---RGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGS----DINECALDPDICPNGICENLRGTYKCICNSGYEVDITG-KNCVDINECVLNSLLCDNGQCRNTPGSF--VCTCPKGFVYKPDLKTCEDIDE-CESSP-CINGVC----KNSPGSFI----CECSPESTLDPTKTICIETIKGTCWQTVIDGRCEIN-------INGATLKSECCSSLGAAWGSPCTICQVDPICGKGY--SRIKGTQCEDINE 914          

HSP 13 Score: 53.9138 bits (128), Expect = 1.777e-5
Identity = 35/91 (38.46%), Postives = 49/91 (53.85%), Query Frame = 0
Query:  879 CHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGY 966
            C +GFI +   +  C D DEC + P  C    C NT+G FEC C  G   +E+    CEDI+EC+   G C    C N + S++C+C  G+
Sbjct:  231 CRRGFIPNIR-TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEV-SQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGF 319          

HSP 14 Score: 49.6766 bits (117), Expect = 3.759e-4
Identity = 34/89 (38.20%), Postives = 47/89 (52.81%), Query Frame = 0
Query:  721 CHPGF--ELMEDSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY 802
            C  GF   +   +C D++EC     LC  G+C N  G++ECKC +G+ F+  +  C DI+EC   P  C  GEC N    Y C C  G+
Sbjct:  231 CRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGF 319          

HSP 15 Score: 48.9062 bits (115), Expect = 6.383e-4
Identity = 49/155 (31.61%), Postives = 66/155 (42.58%), Query Frame = 0
Query:  601 CDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDET-ECFDKDECEMDNGGCEQV-CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNN 751
            C     G  C+    C T      H C       H  C+ GF     T  C D DEC+   G C+   C N  G+F+C C  G   N  +  C D +EC+     C   G+C NT  S++C+C PGF    D   C+D+      T   +G C+N
Sbjct:  195 CQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPH-PCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGVCD-GGECTNTVSSYFCKCPPGFYTSPDGTRCVDVRPGYCYTTLTNGRCSN 347          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592792679|gb|GAXK01161889.1| (TSA: Calanus finmarchicus comp34802_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 553.903 bits (1426), Expect = 1.125e-175
Identity = 337/741 (45.48%), Postives = 443/741 (59.78%), Query Frame = 0
Query:  266 DDEDLIDGSGFDLDYETSGSGYYVHEIEDIGNSSGEKKEQKARVQFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFL-NXXXXXXXXXXXXXXXXXXXHICTNKPGTYMCDCRLGFTSQGTA----CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEG-----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGC 990
            DDED+I+GSG ++ +        + E E++ N+    KE K R +F+  + +D+L LD+SC+  F  A  + ++ +  YD R          +AEV Y C++GY  +  +   LFC + RW GK P CV  S  E     +  C    ++  RC  +C+L++   P C C+DGF L +D   CED++EC D+   C   C N+PGT+MC C  G++S G +    C+D+NECLLNNGHGPCQD C N DGGY C C  L GTQ+  +DNHTC     C  NNGGCSHECI+SYNQ+FC+CP G+ L  DW+TC D++EC++ +  C + C+N PGSA+C C  GYE        C D++EC T +  C H+C+NT GSA+C C  G+D+  D+  C D DEC  +NG C+Q+C N  G+ +CGC+ G+HL+T+  +C+D NEC +  A CG +GDCINTPGS+ C CH G+ L    C D +EC+  T LCG +G C N  G YEC C  GY F  STC D++EC I NPC HG C N   GYSC C  GY   + VC D +EC+  +PCGV G C N P S+ C C  GYE + G CHDI+E   E  PCG HGDC+N  G+F C CH GF      + +C D DEC   PC   EC N  G FEC C  G+ L     NTC D +EC+  NG CSQ+C+N  GS  CRC+ GY  D      C   DEC L    NGGC
Sbjct:  167 DDEDIIEGSGSNILFHEDKENVAL-EPEEVENAEIGDKESKQRKEFFVVHGIDILSLDSSCMEDFLPAPAVKNSEVSGYDARSERGDT---VFAEVSYSCNQGYQLEDPQVQALFCQQSRWRGKLPKCVKISGKE---EGKEKC----RDVGRCAQVCHLEES-GPVCSCYDGFILADDGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIG-QDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVA-AICG-HGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEEGVCLDINECIISSPCGV-GTCINTPASYACSCPDGYEEREGGCHDIDECLSE--PCGKHGDCLNLPGNFTCHCHPGFAL---TAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDT-NTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGYLADVEAESLCVDNDECALD---NGGC 2314          

HSP 2 Score: 286.574 bits (732), Expect = 3.570e-80
Identity = 219/595 (36.81%), Postives = 291/595 (48.91%), Query Frame = 0
Query:  499 GPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL--DEDWKTCVDINECV--TGDIQCLNKCMNVPGSAYCKCDS------GYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHL-NTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP-CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC 1074
            G C   C   + G  C C    G  L+D D  TC     C  NNGGCS +C +      C C +GY          C+D+NEC+   G   C + C N  G   C CD+      G +   C  +  C   +  C H CIN+     C C  GF L  D   C D DEC  +N GC  +C N  G+  C C PG+      N TC D +EC     N G   DC+NT GS YC+C  G+++  D  +C DI+EC          C N  G+ EC C+ GY    + S+C D+NEC+    CGHG+CIN    YSCSCH GY    + C+D DEC  D N CG  G+C N  G ++C C PGY F    C D++E  L  +PC  HG C N +G + C C +G+  ++    +C+D +EC+ SSPC    C NT   + C C  G+   E     C DI+EC          C+N+ G+  C C+ G+     G C   DEC       G     C N+PG  +C C+ GY++D +D   CVD +EC+  NGGC   CIN  G   C CH G+  D +    CV    C+++NGGC
Sbjct:  587 GRCAQVCHLEESGPVCSC--YDGFILAD-DGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHT--MNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDE-CLIGNPC-VHGTCDNLEGGYSCECDKGYYQEEG---VCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE---GGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFAL-TAGLCEDIDECAGDPCTGG----ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGYLADVEAESLCVDNDECALDNGGC 2314          

HSP 3 Score: 242.662 bits (618), Expect = 1.488e-65
Identity = 205/583 (35.16%), Postives = 272/583 (46.66%), Query Frame = 0
Query:  543 GGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE------GDDCSDINECETQDL--ICDHNCINTEGSAHCTCK--AGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELM---EDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN--NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDART 1103
            G C+  C    +   C C DG+ L +D +TC DINEC   +  C  KC N PG+  C C  GY         DC D+NEC   +    C   C N +G   C+C   AG  +  D   C     C  +NGGC   C N      C C PGF L  D  TC D +EC      C     C+NTPGS +C C PG+E       +C D++EC       S  C N  G+  C C  G+     + TC DI+EC   N      CIN+     C C  GY +D + + C D +EC+    CG G  C N PGS+ C C  GY      C D +E S + + CG  G+CVN  G +EC+C  G+       + C D DECL  +PC H  C N  GG+ C C+ G+   E     C DINEC +++      C+N   S+ C C +GY++ E G C   DEC     P G     C+N+PG   C C+PG+ + +    LC D +EC  +   GG    C N  G   C C  G+  D ++   CV    CS  NGGCS IC +       +C C  G+    +A +
Sbjct:  587 GRCAQVCHLEESGPVCSCYDGFILADDGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHL--CVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHG-DCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE---GVCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE-GGCHDIDECL--SEPCGK-HGDCLNLPGNFTCHCHPGFALTA---GLCEDIDECAGDPCTGG---ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSA--QCRCHPGYLADVEAES 2269          

HSP 4 Score: 197.208 bits (500), Expect = 6.426e-51
Identity = 182/546 (33.33%), Postives = 252/546 (46.15%), Query Frame = 0
Query:  585 QCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDET---ECFDKDECEMDNGG--CEQVCNNLEGTFQCGCK--PGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF---HSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            +C   C        C C  G+    +G+ C DINEC+  +  C   C N  G+  C+C  G+     +   +C D +EC ++NG   C+  C N +G + C C    G  +  DN TC     C     N G   +CIN+    +C C PGF L  D  +C D++EC ++       C N  G+  C C  GY     HN+TC D++EC  +   C H +C+N +    C C  G+ D+   D  C+D DEC  +N       C NK GS +C C  GY        C D+NE  +    CG HGDC+N  GS+ C CHQG+   + D++ C D DEC           EC NTLGG+ECLC+ G+  S    +TC D++EC + N      C N+ G + C C +GY ++E G C   +EC +S     G    CIN P    C C  GY    +    C D +EC     G    C+N  G  TC CH GF       E   +        G C+++      GL   C C +G+ L  D  TC
Sbjct:  590 RCAQVCHLEESGPVCSCYDGFILADDGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHN--NGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSH-DCVNTAGSAYCDCPKGW-DIGTDDKTCQDIDECREENG-FCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAA-ICG-HGDCINTPGSYSCSCHQGY---RLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE-GVCLDINECIISSPCGVG---TCINTPASYACSCPDGY---EEREGGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNL-----PGLF-ECRCSAGYVLDRDTNTC 2149          

HSP 5 Score: 105.145 bits (261), Expect = 8.160e-22
Identity = 94/283 (33.22%), Postives = 124/283 (43.82%), Query Frame = 0
Query:  836 CDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIH-DQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCETGFALSEILPN--TCEDINECALNNGDCSQVCVNILGSHYCRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C C  G+   +    C DINE       C     C N  G+F C C +G+     + +  C+D +ECL      PC    C N  GG+ C C+   A ++I  +  TCE +  CA NNG CS  C+N     +C C  G+    D R  C   DEC LS   N GC  LC+N PG   C C PGY         C D +EC   N GC H C+N  G   C C  G+     + + C     C   NG C  IC +    +   C C  G+ L T+  +C  +
Sbjct:  632 CSCYDGFILADDGETCEDINECDDNNGGCSQK--CENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPC-QDTCTNHDGGYVCSCDN-LAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWR-TCEDVDEC-LSN--NNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIG-TDDKTCQDIDECREENGFCQQICINKIGSM--ECGCEVGYHLDTNTSSCSDV 1447          

HSP 6 Score: 96.2857 bits (238), Expect = 4.313e-19
Identity = 85/249 (34.14%), Postives = 113/249 (45.38%), Query Frame = 0
Query:  464 CTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPC-QDECKNVDGGYQCECG-GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVT------GDIQCLN----------------------------------KCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGF--DLMDETECFDKDECEMDNGGCE 664
            C N  G Y C C+ G+   G+ C D++ECL+ N   PC    C N++GGY CEC  G    +    D + CI    C V        CI++     C CPDGYE  E    C DI+EC++      GD  CLN                                  +C N+PG   C+C +GY    + + C D +EC T +  C   CIN  GSA C C  G+  D+  E+ C D DEC +DNGGC+
Sbjct: 1610 CVNTLGGYECLCQPGYGFSGSTCFDLDECLIGN---PCVHGTCDNLEGGYSCECDKGYYQEEGVCLDINECIISSPCGVGT------CINTPASYACSCPDGYE--EREGGCHDIDECLSEPCGKHGD--CLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDTNTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGYLADVEAESLCVDNDECALDNGGCD 2317          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592792678|gb|GAXK01161890.1| (TSA: Calanus finmarchicus comp34802_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 546.969 bits (1408), Expect = 2.411e-173
Identity = 327/715 (45.73%), Postives = 433/715 (60.56%), Query Frame = 0
Query:  266 DDEDLIDGSGFDLDYETSGSGYYVHEIEDIGNSSGEKKEQKARVQFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFL-NXXXXXXXXXXXXXXXXXXXHICTNKPGTYMCDCRLGFTSQGTA----CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEG-----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGY 966
            DDED+I+GSG ++ +        + E E++ N+    KE K R +F+  + +D+L LD+SC+  F  A  + ++ +  YD R          +AEV Y C++GY  +  +   LFC + RW GK P CV  S  E     +  C    ++  RC  +C+L++   P C C+DGF L +D   CED++EC D+   C   C N+PGT+MC C  G++S G +    C+D+NECLLNNGHGPCQD C N DGGY C C  L GTQ+  +DNHTC     C  NNGGCSHECI+SYNQ+FC+CP G+ L  DW+TC D++EC++ +  C + C+N PGSA+C C  GYE        C D++EC T +  C H+C+NT GSA+C C  G+D+  D+  C D DEC  +NG C+Q+C N  G+ +CGC+ G+HL+T+  +C+D NEC +  A CG +GDCINTPGS+ C CH G+ L    C D +EC+  T LCG +G C N  G YEC C  GY F  STC D++EC I NPC HG C N   GYSC C  GY   + VC D +EC+  +PCGV G C N P S+ C C  GYE + G CHDI+E   E  PCG HGDC+N  G+F C CH GF      + +C D DEC   PC   EC N  G FEC C  G+ L     NTC D +EC+  NG CSQ+C+N  GS  CRC+ GY
Sbjct:  167 DDEDIIEGSGSNILFHEDKENVAL-EPEEVENAEIGDKESKQRKEFFVVHGIDILSLDSSCMEDFLPAPAVKNSEVSGYDARSERGDT---VFAEVSYSCNQGYQLEDPQVQALFCQQSRWRGKLPKCVKISGKE---EGKEKC----RDVGRCAQVCHLEES-GPVCSCYDGFILADDGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIG-QDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVA-AICG-HGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEEGVCLDINECIISSPCGV-GTCINTPASYACSCPDGYEEREGGCHDIDECLSE--PCGKHGDCLNLPGNFTCHCHPGFAL---TAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDT-NTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGY 2245          

HSP 2 Score: 273.092 bits (697), Expect = 8.908e-76
Identity = 211/572 (36.89%), Postives = 279/572 (48.78%), Query Frame = 0
Query:  499 GPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL--DEDWKTCVDINECV--TGDIQCLNKCMNVPGSAYCKCDS------GYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHL-NTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP-CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF 1051
            G C   C   + G  C C    G  L+D D  TC     C  NNGGCS +C +      C C +GY          C+D+NEC+   G   C + C N  G   C CD+      G +   C  +  C   +  C H CIN+     C C  GF L  D   C D DEC  +N GC  +C N  G+  C C PG+      N TC D +EC     N G   DC+NT GS YC+C  G+++  D  +C DI+EC          C N  G+ EC C+ GY    + S+C D+NEC+    CGHG+CIN    YSCSCH GY    + C+D DEC  D N CG  G+C N  G ++C C PGY F    C D++E  L  +PC  HG C N +G + C C +G+  ++    +C+D +EC+ SSPC    C NT   + C C  G+   E     C DI+EC          C+N+ G+  C C+ G+     G C   DEC       G     C N+PG  +C C+ GY++D +D   CVD +EC+  NGGC   CIN  G   C CH G+
Sbjct:  587 GRCAQVCHLEESGPVCSC--YDGFILAD-DGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHT--MNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDE-CLIGNPC-VHGTCDNLEGGYSCECDKGYYQEEG---VCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE---GGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFAL-TAGLCEDIDECAGDPCTGG----ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGY 2245          

HSP 3 Score: 242.662 bits (618), Expect = 1.236e-65
Identity = 203/569 (35.68%), Postives = 266/569 (46.75%), Query Frame = 0
Query:  543 GGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE------GDDCSDINECETQDL--ICDHNCINTEGSAHCTCK--AGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELM---EDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN--NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRC 1089
            G C+  C    +   C C DG+ L +D +TC DINEC   +  C  KC N PG+  C C  GY         DC D+NEC   +    C   C N +G   C+C   AG  +  D   C     C  +NGGC   C N      C C PGF L  D  TC D +EC      C     C+NTPGS +C C PG+E       +C D++EC       S  C N  G+  C C  G+     + TC DI+EC   N      CIN+     C C  GY +D + + C D +EC+    CG G  C N PGS+ C C  GY      C D +E S + + CG  G+CVN  G +EC+C  G+       + C D DECL  +PC H  C N  GG+ C C+ G+   E     C DINEC +++      C+N   S+ C C +GY++ E G C   DEC     P G     C+N+PG   C C+PG+ + +    LC D +EC  +   GG    C N  G   C C  G+  D ++   CV    CS  NGGCS IC +       RC
Sbjct:  587 GRCAQVCHLEESGPVCSCYDGFILADDGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHL--CVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHG-DCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE---GVCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE-GGCHDIDECL--SEPCGK-HGDCLNLPGNFTCHCHPGFALTA---GLCEDIDECAGDPCTGG---ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSAQCRC 2233          

HSP 4 Score: 197.978 bits (502), Expect = 3.683e-51
Identity = 182/546 (33.33%), Postives = 252/546 (46.15%), Query Frame = 0
Query:  585 QCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDET---ECFDKDECEMDNGG--CEQVCNNLEGTFQCGCK--PGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF---HSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            +C   C        C C  G+    +G+ C DINEC+  +  C   C N  G+  C+C  G+     +   +C D +EC ++NG   C+  C N +G + C C    G  +  DN TC     C     N G   +CIN+    +C C PGF L  D  +C D++EC ++       C N  G+  C C  GY     HN+TC D++EC  +   C H +C+N +    C C  G+ D+   D  C+D DEC  +N       C NK GS +C C  GY        C D+NE  +    CG HGDC+N  GS+ C CHQG+   + D++ C D DEC           EC NTLGG+ECLC+ G+  S    +TC D++EC + N      C N+ G + C C +GY ++E G C   +EC +S     G    CIN P    C C  GY    +    C D +EC     G    C+N  G  TC CH GF       E   +        G C+++      GL   C C +G+ L  D  TC
Sbjct:  590 RCAQVCHLEESGPVCSCYDGFILADDGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHN--NGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSH-DCVNTAGSAYCDCPKGW-DIGTDDKTCQDIDECREENG-FCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAA-ICG-HGDCINTPGSYSCSCHQGY---RLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE-GVCLDINECIISSPCGVG---TCINTPASYACSCPDGY---EEREGGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNL-----PGLF-ECRCSAGYVLDRDTNTC 2149          

HSP 5 Score: 163.696 bits (413), Expect = 2.485e-40
Identity = 158/461 (34.27%), Postives = 208/461 (45.12%), Query Frame = 0
Query:  659 DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS----CMDINECTNSTLCG--SGSCNNLEGTYECKCD----SGYIFHNSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK---NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLK 1098
            D G C QVC+  E    C C  GF L  D  TC D NEC     N G    C N PG+F C C  G+     S    C+D+NEC  +   G    +C N +G Y C CD    +     N TC  +  C  N   C H ECIN      C C  G+V   +   C D DECL +N  G    C N PGS  C C PGYE     N  C D++E       C    DCVN  GS  C C +G+    +D   C D DEC     F  + C N +G  EC CE G+ L +   ++C D+NEC +        C+N  GS+ C C++GY+ D    C  +DEC       G   + C+N  GG +C C PGY         C D +EC I N      C N  GG++C C  G+  +E    +  +C+ +  C V        C +T +   + C CP G++ +
Sbjct:  581 DVGRCAQVCHLEESGPVCSCYDGFILADDGETCEDINECDDN--NGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSH-ECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNN-GCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSH--DCVNTAGSAYCDCPKGWDIGTDDK-TCQDIDECREENGFCQQICINKIGSMECGCEVGYHL-DTNTSSCSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLDAH-ECQDRDECSQDTNLCGDAGE-CVNTLGGYECLCQPGYGFSGS---TCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEEGVCLDINECIISSPCGVG------TCINTPA--SYACSCPDGYEER 1900          

HSP 6 Score: 162.925 bits (411), Expect = 4.398e-40
Identity = 175/543 (32.23%), Postives = 236/543 (43.46%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLT--CTDENECTIGIANCGIYGDCINTPGSFYCECH--PGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV--CVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHI--CKSTESGLHHRCM---------CPSGFKLKTDARTCKPI---------GGICSSAP-----RPSNGY 1121
            C   C   E    C+C  GF L D+ E C D +EC+ +NGGC Q C N  GTF C C  G+     ++   C D NEC +   +      C N  G + C C    G ++ +D  +C  +  C ++    S  C N      C C  G++      TC D++EC+   N C H  C+N      C+C  GY      +  C D DEC H    G    C N  GS  CDC  G++    +  C DI+E   E   C     C+N  GS EC C  G+  D N S+ C D +EC+ ++ C H +C NT G + C C  G+ L     + C+D +EC+ +   C     CVN LG + C C  GY       CF  DEC +    N      C N+ GG  CEC+ GY    Q+  +C+D NEC I++      CIN    + CSC  G++  E                GGC  I  C S   G H  C+         C  GF L   A  C+ I         GG C++ P     R S GY
Sbjct:  593 CAQVCHLEESGPVCSCYDGFILADDGETCEDINECDDNNGGCSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPH-LCVNTPGSAHCACMPGYEAAGGHNATCEDVDEC-HTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFC--QQICINKIGSMECGCEVGYHLDTNTSS-CSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLD---AHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGF-SGSTCFDLDECLIG---NPCVHGTCDNLEGGYSCECDKGYY---QEEGVCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE----------------GGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFALT--AGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGY 2122          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592792677|gb|GAXK01161891.1| (TSA: Calanus finmarchicus comp34802_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 536.569 bits (1381), Expect = 1.279e-170
Identity = 294/685 (42.92%), Postives = 388/685 (56.64%), Query Frame = 0
Query:  934 CEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQ--LCINIPGGLKCECNPGYIVDSQDPRL-CVDKNECTINNGGCQHACINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKR-----------LDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYH--KLPSDHGL------FKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGICVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHC 1594
            C D +ECAL+NG C QVC N+ G H C C  GY  D    C   DEC +    NGGC Q  LC+N PG   C+C PG+I DS +    C D NEC   NGGC   C NK GGHTCSC+ GF   PD +   +C     C  +NG CSH CK+T  G  H C CP G+ L      CK     C +  RP  GY++C  ++    +V G+KC+L+CRKG+     + +KC  + +W+G +   C    CP L    NG+++PE+C   ++   +KC   C+ G+  +G +   C    EW+     PP+C   F  P I CPPD  +PLP  + SVYV   +P+TNV+W RYV +DP WA  LEGEM+ GKH +TF A SPV+  ++A+C + IH+KD  PP V +CP S ++ LS GQ++K+ISW EP F+DN+ IQHVMASFLPGHYF EG H ++Y A+D DGN  RC FT+T+KR              +S  +  L     + H+ SS+    S  +    ++    G         C+ VP + NGK  C N    +   KC P C  G+ FYQKFSSRPP+YIC+  RVDW++ +FIPDCSPV KS     C  GWE R  +  CVACPPGM+R    + LCQLC K  +S  F    C+ C   ++T  LGSR    C
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAHHTCQDTDECLID---NGGCAQAQLCLNTPGSRLCKCKPGFIEDSHNTDTGCADHNECDQANGGCDQLCHNKEGGHTCSCNKGFHLLPDMR---RCADNNECEQDNGSCSHTCKNTAGG--HECSCPPGWTLHHAGYKCKLEQSFCPALKRPKFGYFKCTSQRRKAGYVTGSKCRLRCRKGYKTVAGVRKKCFPDSSWSGGQGQ-CRPAACPVLSAPVNGHVTPESCSMGTNKIMTKCSVQCDQGFIQSGSRWASCNEKEEWE-YPDGPPQCKANFPPPFIMCPPDQTKPLPHGASSVYVMFSQPKTNVDWFRYVSADPAWAKQLEGEMVLGKHRLTFLAASPVS-NQTASCHLNIHIKDTEPPRVISCPHSKVETLSRGQMLKKISWTEPVFRDNVAIQHVMASFLPGHYFPEGRHHVLYQAADGDGNRARCGFTLTVKRERYENKRYQSSPRGRSPLSQLLTTRRPHNHRKSSNNRADSVLHLPPPRMSPSRGKSVSSIPAHCNVVPHVPNGKMACLN---KRRSKKCTPVCKEGHVFYQKFSSRPPTYICSTHRVDWKITKFIPDCSPVEKSSQVGQCPQGWEAR--DSYCVACPPGMFRSK--APLCQLCSKGTFSDSFGLARCSPCAMGHSTNSLGSRSAGEC 2004          

HSP 2 Score: 105.916 bits (263), Expect = 3.466e-22
Identity = 64/173 (36.99%), Postives = 84/173 (48.55%), Query Frame = 0
Query:  532 CISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYCKCDSGYEGDD------CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDEN 695
            C+ ++ C ++NGGC   C +      C C  GY  D    TC D +EC+  +  C     C+N PGS  CKC  G+  D       C+D NEC+  +  CD  C N EG   C+C  GF L+ D   C D +ECE DNG C   C N  G  +C C PG+ L+     C  E 
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAH-HTCQDTDECLIDNGGCAQAQLCLNTPGSRLCKCKPGFIEDSHNTDTGCADHNECDQANGGCDQLCHNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTLHHAGYKCKLEQ 519          

HSP 3 Score: 103.219 bits (256), Expect = 2.567e-21
Identity = 66/163 (40.49%), Postives = 80/163 (49.08%), Query Frame = 0
Query:  573 CVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHN--CINTEGSAHCTCKAGF---DLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL 727
            CVD +EC   +  C   C N+PG   C C  GY  D    C D +EC   +  C     C+NT GS  C CK GF       +T C D +EC+  NGGC+Q+C+N EG   C C  GFHL  D   C D NEC     +C     C NT G   C C PG+ L
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAHHTCQDTDECLIDNGGCAQAQLCLNTPGSRLCKCKPGFIEDSHNTDTGCADHNECDQANGGCDQLCHNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCS--HTCKNTAGGHECSCPPGWTL 486          

HSP 4 Score: 96.6709 bits (239), Expect = 3.093e-19
Identity = 64/166 (38.55%), Postives = 80/166 (48.19%), Query Frame = 0
Query:  610 CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ--VCNNLEGTFQCGCKPGFHLNTDNLT--CTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS 769
            C D +EC   +  CD  C N  G   C+C  G+       C D DEC +DNGGC Q  +C N  G+  C CKPGF  ++ N    C D NEC    AN G    C N  G   C C+ GF L+ D   C D NEC       S +C N  G +EC C  G+  H++
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAHHTCQDTDECLIDNGGCAQAQLCLNTPGSRLCKCKPGFIEDSHNTDTGCADHNECDQ--ANGGCDQLCHNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTLHHA 495          

HSP 5 Score: 92.0485 bits (227), Expect = 6.676e-18
Identity = 81/242 (33.47%), Postives = 106/242 (43.80%), Query Frame = 0
Query:  808 VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF-KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNT--CEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDE-CRLSRRPNGG-----CQQLCINIPGGLKC--ECNPGYIVDSQDPRLCVDKNECTINNGGCQHA 1035
            +C D DEC  DN  G    CNN PG  +C C PGY    +  C D +E  ++   C     C+N  GS  C C  GFI D ++++  C D +EC  ++      C N  GG  C C  GF L   LP+   C D NEC  +NG CS  C N  G H C C  G+     G  C L+   C   +RP  G      Q+       G KC   C  GY   +   + C   +  +   G C+ A
Sbjct:    1 LCVDNDECALDNG-GCDQVCNNLPGGHECSCLPGYHHDAHHTCQDTDECLIDNGGCAQAQLCLNTPGSRLCKCKPGFIEDSHNTDTGCADHNECDQANGGCDQLCHNKEGGHTCSCNKGFHL---LPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTLHHAGYKCKLEQSFCPALKRPKFGYFKCTSQRRKAGYVTGSKCRLRCRKGYKTVAGVRKKCFPDSSWSGGQGQCRPA 714          

HSP 6 Score: 87.4261 bits (215), Expect = 2.076e-16
Identity = 64/200 (32.00%), Postives = 95/200 (47.50%), Query Frame = 0
Query:  486 CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE--CIHSYNQIFCLCPDGYELDEDWKT---CVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQC 676
            CVD +EC L+NG   C   C N+ GG++C C  LPG       +HTC   + C ++NGGC+    C+++     C C  G+ +++   T   C D NEC   +  C   C N  G   C C+ G+    +   C+D NECE  +  C H C NT G   C+C  G+ L          +C+++   C  +     G F+C
Sbjct:    4 CVDNDECALDNGG--CDQVCNNLPGGHECSC--LPGYH--HDAHHTCQDTDECLIDNGGCAQAQLCLNTPGSRLCKCKPGF-IEDSHNTDTGCADHNECDQANGGCDQLCHNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTLHHAGY-----KCKLEQSFCPALKRPKFGYFKC 567          

HSP 7 Score: 66.6254 bits (161), Expect = 5.311e-10
Identity = 46/146 (31.51%), Postives = 61/146 (41.78%), Query Frame = 0
Query:  462 HICTNKPGTYMCDCRLGFTSQGT-ACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPG-TQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY 605
             +C N PG + C C  G+       C D +ECL++NG       C N  G   C+C   PG  + S   +  C     C   NGGC   C +      C C  G+ L  D + C D NEC   +  C + C N  G   C C  G+
Sbjct:   49 QVCNNLPGGHECSCLPGYHHDAHHTCQDTDECLIDNGGCAQAQLCLNTPGSRLCKCK--PGFIEDSHNTDTGCADHNECDQANGGCDQLCHNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGW 480          

HSP 8 Score: 60.077 bits (144), Expect = 5.452e-8
Identity = 38/109 (34.86%), Postives = 52/109 (47.71%), Query Frame = 0
Query:  462 HICTNKPGTYMCDCRLGFTSQG----TACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL 566
             +C N PG+ +C C+ GF        T C D NEC  +  +G C   C N +GG+ C C    G  L   D   C  +  C+ +NG CSH C ++     C CP G+ L
Sbjct:  175 QLCLNTPGSRLCKCKPGFIEDSHNTDTGCADHNEC--DQANGGCDQLCHNKEGGHTCSCNK--GFHLL-PDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTL 486          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592792676|gb|GAXK01161892.1| (TSA: Calanus finmarchicus comp34802_c1_seq4 transcribed RNA sequence)

HSP 1 Score: 501.516 bits (1290), Expect = 3.463e-158
Identity = 273/642 (42.52%), Postives = 366/642 (57.01%), Query Frame = 0
Query:  974 CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKR-----------LDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYH--KLPSDHGL------FKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGICVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHC 1594
            C   DEC L    NGGC Q+C N+PGG +C C PGY  D+     C D +EC+ +NGGC   C NK GGHTCSC+ GF   PD +   +C     C  +NG CSH CK+T  G  H C CP G+ L      CK     C +  RP  GY++C  ++    +V G+KC+L+CRKG+     + +KC  + +W+G +   C    CP L    NG+++PE+C   ++   +KC   C+ G+  +G +   C    EW+     PP+C   F  P I CPPD  +PLP  + SVYV   +P+TNV+W RYV +DP WA  LEGEM+ GKH +TF A SPV+  ++A+C + IH+KD  PP V +CP S ++ LS GQ++K+ISW EP F+DN+ IQHVMASFLPGHYF EG H ++Y A+D DGN  RC FT+T+KR              +S  +  L     + H+ SS+    S  +    ++    G         C+ VP + NGK  C N    +   KC P C  G+ FYQKFSSRPP+YIC+  RVDW++ +FIPDCSPV KS     C  GWE R  +  CVACPPGM+R    + LCQLC K  +S  F    C+ C   ++T  LGSR    C
Sbjct:    4 CVDNDECALD---NGGCDQVCNNLPGGHECSCLPGYHHDAH--HTCQDIDECSADNGGCAQLCRNKEGGHTCSCNKGFHLLPDMR---RCADNNECEQDNGSCSHTCKNTAGG--HECSCPPGWTLHHAGYKCKLEQSFCPALKRPKFGYFKCTSQRRKAGYVTGSKCRLRCRKGYKTVAGVRKKCFPDSSWSGGQGQ-CRPAACPVLSAPVNGHVTPESCSMGTNKIMTKCSVQCDQGFIQSGSRWASCNEKEEWE-YPDGPPQCKANFPPPFIMCPPDQTKPLPHGASSVYVMFSQPKTNVDWFRYVSADPAWAKQLEGEMVLGKHRLTFLAASPVS-NQTASCHLNIHIKDTEPPRVISCPHSKVETLSRGQMLKKISWTEPVFRDNVAIQHVMASFLPGHYFPEGRHHVLYQAADGDGNRARCGFTLTVKRERYENKRYQSSPRGRSPLSQLLTTRRPHNHRKSSNNRADSVLHLPPPRMSPSRGKSVSSIPAHCNVVPHVPNGKMACLN---KRRSKKCTPVCKEGHVFYQKFSSRPPTYICSTHRVDWKITKFIPDCSPVEKSSQVGQCPQGWEAR--DSYCVACPPGMFRSK--APLCQLCSKGTFSDSFGLARCSPCAMGHSTNSLGSRSAGEC 1869          

HSP 2 Score: 93.9745 bits (232), Expect = 1.706e-18
Identity = 51/122 (41.80%), Postives = 66/122 (54.10%), Query Frame = 0
Query:  650 CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS 769
            C D DEC +DNGGC+QVCNNL G  +C C PG+H +  + TC D +EC+     C     C N  G   C C+ GF L+ D   C D NEC       S +C N  G +EC C  G+  H++
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAHH-TCQDIDECSADNGGCAQL--CRNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTLHHA 360          

HSP 3 Score: 88.5817 bits (218), Expect = 7.330e-17
Identity = 50/127 (39.37%), Postives = 61/127 (48.03%), Query Frame = 0
Query:  573 CVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDEN 695
            CVD +EC   +  C   C N+PG   C C  GY  D    C DI+EC   +  C   C N EG   C+C  GF L+ D   C D +ECE DNG C   C N  G  +C C PG+ L+     C  E 
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAHHTCQDIDECSADNGGCAQLCRNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTLHHAGYKCKLEQ 384          

HSP 4 Score: 85.8853 bits (211), Expect = 5.644e-16
Identity = 49/118 (41.53%), Postives = 56/118 (47.46%), Query Frame = 0
Query:  610 CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL 727
            C D +EC   +  CD  C N  G   C+C  G+       C D DEC  DNGGC Q+C N EG   C C  GFHL  D   C D NEC     +C     C NT G   C C PG+ L
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAHHTCQDIDECSADNGGCAQLCRNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCS--HTCKNTAGGHECSCPPGWTL 351          

HSP 5 Score: 72.4034 bits (176), Expect = 9.337e-12
Identity = 44/120 (36.67%), Postives = 59/120 (49.17%), Query Frame = 0
Query:  486 CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY 605
            CVD +EC L+NG   C   C N+ GG++C C  LPG       +HTC   + C  +NGGC+  C +      C C  G+ L  D + C D NEC   +  C + C N  G   C C  G+
Sbjct:    4 CVDNDECALDNGG--CDQVCNNLPGGHECSC--LPGYH--HDAHHTCQDIDECSADNGGCAQLCRNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGW 345          

HSP 6 Score: 67.781 bits (164), Expect = 2.090e-10
Identity = 50/122 (40.98%), Postives = 62/122 (50.82%), Query Frame = 0
Query:  808 VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF-KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFAL 926
            +C D DEC  DN  G    CNN PG  +C C PGY    +  C DI+E S +   C     C N +G   C C++GF H   D   C D +EC   +  C H+ CKNT GG EC C  G+ L
Sbjct:    1 LCVDNDECALDNG-GCDQVCNNLPGGHECSCLPGYHHDAHHTCQDIDECSADNGGCA--QLCRNKEGGHTCSCNKGF-HLLPDMRRCADNNECEQDNGSCSHT-CKNTAGGHECSCPPGWTL 351          

HSP 7 Score: 57.3806 bits (137), Expect = 3.361e-7
Identity = 37/106 (34.91%), Postives = 51/106 (48.11%), Query Frame = 0
Query:  462 HICTNKPGTYMCDCRLGFTSQGT-ACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL 566
             +C N PG + C C  G+       C DI+EC  +NG   C   C+N +GG+ C C    G  L   D   C  +  C+ +NG CSH C ++     C CP G+ L
Sbjct:   49 QVCNNLPGGHECSCLPGYHHDAHHTCQDIDECSADNGG--CAQLCRNKEGGHTCSCNK--GFHLLP-DMRRCADNNECEQDNGSCSHTCKNTAGGHECSCPPGWTL 351          

HSP 8 Score: 47.7506 bits (112), Expect = 3.529e-4
Identity = 41/118 (34.75%), Postives = 51/118 (43.22%), Query Frame = 0
Query:  771 CLDINECIRNPCGHGECINESPG-YSCSCHSGYV-DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFI 884
            C+D +EC  +  G  +  N  PG + CSC  GY  D  + C+D DEC  DN  G    C NK G   C C  G+        C D NE   +   C     C N  G  EC C  G+ 
Sbjct:    4 CVDNDECALDNGGCDQVCNNLPGGHECSCLPGYHHDAHHTCQDIDECSADNG-GCAQLCRNKEGGHTCSCNKGFHLLPDMRRCADNNECEQDNGSCS--HTCKNTAGGHECSCPPGWT 348          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592792675|gb|GAXK01161893.1| (TSA: Calanus finmarchicus comp34802_c1_seq5 transcribed RNA sequence)

HSP 1 Score: 461.84 bits (1187), Expect = 9.608e-145
Identity = 271/542 (50.00%), Postives = 339/542 (62.55%), Query Frame = 0
Query:  464 CTNKPGTYMCDCRLGFTSQGTA----CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEG-----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGC 990
            C N+PGT+MC C  G++S G +    C+D+NECLLNNGHGPCQD C N DGGY C C  L GTQ+  +DNHTC     C  NNGGCSHECI+SYNQ+FC+CP G+ L  DW+TC D++EC++ +  C + C+N PGSA+C C  GYE        C D++EC T +  C H+C+NT GSA+C C  G+D+  D+  C D DEC  +NG C+Q+C N  G+ +CGC+ G+HL+T+  +C+D NEC +  A CG +GDCINTPGS+ C CH G+ L    C D +EC+  T LCG +G C N  G YEC C  GY F  STC D++EC I NPC HG C N   GYSC C  GY   + VC D +EC+  +PCGV G C N P S+ C C  GYE + G CHDI+E   E  PCG HGDC+N  G+F C CH GF      + +C D DEC   PC   EC N  G FEC C  G+ L     NTC D +EC+  NG CSQ+C+N  GS  CRC+ GY  D      C   DEC L    NGGC
Sbjct:   15 CENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIG-QDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVV-AAICG-HGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEEGVCLDINECIISSPCGV-GTCINTPASYACSCPDGYEEREGGCHDIDECLSE--PCGKHGDCLNLPGNFTCHCHPGFAL---TAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDT-NTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGYLADVEAESLCVDNDECALD---NGGC 1601          

HSP 2 Score: 263.848 bits (673), Expect = 1.127e-74
Identity = 202/549 (36.79%), Postives = 272/549 (49.54%), Query Frame = 0
Query:  545 CSHECIHSYNQIFCLCPDGYEL--DEDWKTCVDINECV--TGDIQCLNKCMNVPGSAYCKCDS------GYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHL-NTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP-CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC 1074
            CS +C +      C C +GY          C+D+NEC+   G   C + C N  G   C CD+      G +   C  +  C   +  C H CIN+     C C  GF L  D   C D DEC  +N GC  +C N  G+  C C PG+      N TC D +EC     N G   DC+NT GS YC+C  G+++  D  +C DI+EC          C N  G+ EC C+ GY    + S+C D+NEC+    CGHG+CIN    YSCSCH GY    + C+D DEC  D N CG  G+C N  G ++C C PGY F    C D++E  L  +PC  HG C N +G + C C +G+  ++    +C+D +EC+ SSPC    C NT   + C C  G+   E     C DI+EC          C+N+ G+  C C+ G+     G C   DEC       G     C N+PG  +C C+ GY++D +D   CVD +EC+  NGGC   CIN  G   C CH G+  D +    CV    C+++NGGC
Sbjct:    3 CSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHT--MNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDE-CLIGNPC-VHGTCDNLEGGYSCECDKGYYQEEG---VCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE---GGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFAL-TAGLCEDIDECAGDPCTGG----ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGYLADVEAESLCVDNDECALDNGGC 1601          

HSP 3 Score: 211.46 bits (537), Expect = 1.122e-56
Identity = 189/540 (35.00%), Postives = 250/540 (46.30%), Query Frame = 0
Query:  586 CLNKCMNVPGSAYCKCDSGYE------GDDCSDINECETQDL--ICDHNCINTEGSAHCTCK--AGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELM---EDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN--NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDART 1103
            C  KC N PG+  C C  GY         DC D+NEC   +    C   C N +G   C+C   AG  +  D   C     C  +NGGC   C N      C C PGF L  D  TC D +EC      C     C+NTPGS +C C PG+E       +C D++EC       S  C N  G+  C C  G+     + TC DI+EC   N      CIN+     C C  GY +D + + C D +EC+    CG G  C N PGS+ C C  GY      C D +E S + + CG  G+CVN  G +EC+C  G+       + C D DECL  +PC H  C N  GG+ C C+ G+   E     C DINEC +++      C+N   S+ C C +GY++ E G C   DEC     P G     C+N+PG   C C+PG+ + +    LC D +EC  +   GG    C N  G   C C  G+  D ++   CV    CS  NGGCS IC +       +C C  G+    +A +
Sbjct:    3 CSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHL--CVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHG-DCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE---GVCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE-GGCHDIDECL--SEPCGK-HGDCLNLPGNFTCHCHPGFALTA---GLCEDIDECAGDPCTGG---ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSA--QCRCHPGYLADVEAES 1556          

HSP 4 Score: 199.519 bits (506), Expect = 8.786e-53
Identity = 156/414 (37.68%), Postives = 201/414 (48.55%), Query Frame = 0
Query:  462 HICTNKPGTYMCDCRLGFTSQG---TACVDINEC-LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGD--DCSDINECETQDLICDH--NCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYV-DVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF---KNGXCHDINEXSLEKDPC 862
            H+C N PG+  C C  G+ + G     C D++EC  +N G   C  +C N  G   C+C   P       D+ TC   + C+  NG C   CI+    + C C  GY LD +  +C D+NECV   I     C+N PGS  C C  GY  D  +C D +EC     +C     C+NT G   C C+ G+     T CFD DEC + N      C+NLEG + C C  G++   +   C D NEC I  + CG+ G CINTP S+ C C  G+E  E  C DI+EC +      G C NL G + C C  G+      C DI+EC  +PC  GEC N    + C C +GYV D D N C D DEC   N  G    C N PGS  C C PGY         C D +E +L+   C
Sbjct:  396 HLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYG---CSHDCVNTAGSAYCDC---PKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGST-CFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYY--QEEGVCLDINECIIS-SPCGV-GTCINTPASYACSCPDGYEEREGGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDTNTCVDTDECSTGNG-GCSQICINYPGSAQCRCHPGYLADVEAESLCVDNDECALDNGGC 1601          

HSP 5 Score: 174.866 bits (442), Expect = 1.555e-44
Identity = 171/505 (33.86%), Postives = 236/505 (46.73%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDET---ECFDKDECEMDNGG--CEQVCNNLEGTFQCGCK--PGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDECLHDNPCGVGGK-CNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF---HSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            C   C N  G+  C+C  G+     +   +C D +EC ++NG   C+  C N +G + C C    G  +  DN TC     C     N G   +CIN+    +C C PGF L  D  +C D++EC ++       C N  G+  C C  GY     HN+TC D++EC  +   C H +C+N +    C C  G+ D+   D  C+D DEC  +N  G   + C NK GS +C C  GY        C D+NE  +    CG HGDC+N  GS+ C CHQG+   + D++ C D DEC           EC NTLGG+ECLC+ G+  S    +TC D++EC + N      C N+ G + C C +GY ++E G C   +EC +S     G    CIN P    C C  GY    +    C D +EC     G    C+N  G  TC CH GF       E   +        G C+++      GL   C C +G+ L  D  TC
Sbjct:    3 CSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHN--NGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSH-DCVNTAGSAYCDCPKGW-DIGTDDKTCQDIDECREEN--GFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAA-ICG-HGDCINTPGSYSCSCHQGY---RLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE-GVCLDINECIISSPCGVG---TCINTPASYACSCPDGY---EEREGGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNL-----PGLF-ECRCSAGYVLDRDTNTC 1436          

HSP 6 Score: 98.5969 bits (244), Expect = 3.838e-20
Identity = 85/249 (34.14%), Postives = 113/249 (45.38%), Query Frame = 0
Query:  868 CVNNDGSFECVCHQGFIH-DQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCETGFALSEILPN--TCEDINECALNNGDCSQVCVNILGSHYCRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C N  G+F C C +G+     + +  C+D +ECL      PC    C N  GG+ C C+   A ++I  +  TCE +  CA NNG CS  C+N     +C C  G+    D R  C   DEC LS   N GC  LC+N PG   C C PGY         C D +EC   N GC H C+N  G   C C  G+     + + C     C   NG C  IC +    +   C C  G+ L T+  +C  +
Sbjct:   15 CENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPC-QDTCTNHDGGYVCSCDN-LAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWR-TCEDVDEC-LSN--NNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDD-KTCQDIDECREENGFCQQICINKIGSM--ECGCEVGYHLDTNTSSCSDV 734          

HSP 7 Score: 93.2041 bits (230), Expect = 1.974e-18
Identity = 85/249 (34.14%), Postives = 113/249 (45.38%), Query Frame = 0
Query:  464 CTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPC-QDECKNVDGGYQCECG-GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVT------GDIQCLN----------------------------------KCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGF--DLMDETECFDKDECEMDNGGCE 664
            C N  G Y C C+ G+   G+ C D++ECL+ N   PC    C N++GGY CEC  G    +    D + CI    C V        CI++     C CPDGYE  E    C DI+EC++      GD  CLN                                  +C N+PG   C+C +GY    + + C D +EC T +  C   CIN  GSA C C  G+  D+  E+ C D DEC +DNGGC+
Sbjct:  897 CVNTLGGYECLCQPGYGFSGSTCFDLDECLIGN---PCVHGTCDNLEGGYSCECDKGYYQEEGVCLDINECIISSPCGVGT------CINTPASYACSCPDGYE--EREGGCHDIDECLSEPCGKHGD--CLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDTNTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGYLADVEAESLCVDNDECALDNGGCD 1604          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592792674|gb|GAXK01161894.1| (TSA: Calanus finmarchicus comp34802_c1_seq6 transcribed RNA sequence)

HSP 1 Score: 454.907 bits (1169), Expect = 1.417e-142
Identity = 261/516 (50.58%), Postives = 329/516 (63.76%), Query Frame = 0
Query:  464 CTNKPGTYMCDCRLGFTSQGTA----CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEG-----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGY 966
            C N+PGT+MC C  G++S G +    C+D+NECLLNNGHGPCQD C N DGGY C C  L GTQ+  +DNHTC     C  NNGGCSHECI+SYNQ+FC+CP G+ L  DW+TC D++EC++ +  C + C+N PGSA+C C  GYE        C D++EC T +  C H+C+NT GSA+C C  G+D+  D+  C D DEC  +NG C+Q+C N  G+ +CGC+ G+HL+T+  +C+D NEC +  A CG +GDCINTPGS+ C CH G+ L    C D +EC+  T LCG +G C N  G YEC C  GY F  STC D++EC I NPC HG C N   GYSC C  GY   + VC D +EC+  +PCGV G C N P S+ C C  GYE + G CHDI+E   E  PCG HGDC+N  G+F C CH GF      + +C D DEC   PC   EC N  G FEC C  G+ L     NTC D +EC+  NG CSQ+C+N  GS  CRC+ GY
Sbjct:   15 CENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIG-QDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVV-AAICG-HGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEEGVCLDINECIISSPCGV-GTCINTPASYACSCPDGYEEREGGCHDIDECLSE--PCGKHGDCLNLPGNFTCHCHPGFAL---TAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDT-NTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGY 1532          

HSP 2 Score: 250.751 bits (639), Expect = 2.782e-70
Identity = 194/526 (36.88%), Postives = 260/526 (49.43%), Query Frame = 0
Query:  545 CSHECIHSYNQIFCLCPDGYEL--DEDWKTCVDINECV--TGDIQCLNKCMNVPGSAYCKCDS------GYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHL-NTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP-CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF 1051
            CS +C +      C C +GY          C+D+NEC+   G   C + C N  G   C CD+      G +   C  +  C   +  C H CIN+     C C  GF L  D   C D DEC  +N GC  +C N  G+  C C PG+      N TC D +EC     N G   DC+NT GS YC+C  G+++  D  +C DI+EC          C N  G+ EC C+ GY    + S+C D+NEC+    CGHG+CIN    YSCSCH GY    + C+D DEC  D N CG  G+C N  G ++C C PGY F    C D++E  L  +PC  HG C N +G + C C +G+  ++    +C+D +EC+ SSPC    C NT   + C C  G+   E     C DI+EC          C+N+ G+  C C+ G+     G C   DEC       G     C N+PG  +C C+ GY++D +D   CVD +EC+  NGGC   CIN  G   C CH G+
Sbjct:    3 CSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHT--MNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGSTCFDLDE-CLIGNPC-VHGTCDNLEGGYSCECDKGYYQEEG---VCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE---GGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFAL-TAGLCEDIDECAGDPCTGG----ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSAQCRCHPGY 1532          

HSP 3 Score: 211.075 bits (536), Expect = 8.871e-57
Identity = 187/526 (35.55%), Postives = 244/526 (46.39%), Query Frame = 0
Query:  586 CLNKCMNVPGSAYCKCDSGYE------GDDCSDINECETQDL--ICDHNCINTEGSAHCTCK--AGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELM---EDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGY-VDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN--NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRC 1089
            C  KC N PG+  C C  GY         DC D+NEC   +    C   C N +G   C+C   AG  +  D   C     C  +NGGC   C N      C C PGF L  D  TC D +EC      C     C+NTPGS +C C PG+E       +C D++EC       S  C N  G+  C C  G+     + TC DI+EC   N      CIN+     C C  GY +D + + C D +EC+    CG G  C N PGS+ C C  GY      C D +E S + + CG  G+CVN  G +EC+C  G+       + C D DECL  +PC H  C N  GG+ C C+ G+   E     C DINEC +++      C+N   S+ C C +GY++ E G C   DEC     P G     C+N+PG   C C+PG+ + +    LC D +EC  +   GG    C N  G   C C  G+  D ++   CV    CS  NGGCS IC +       RC
Sbjct:    3 CSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHL--CVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHG-DCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE---GVCLDINECIISSPCGVGTCINTPASYACSCPDGYEERE-GGCHDIDECL--SEPCGK-HGDCLNLPGNFTCHCHPGFALTA---GLCEDIDECAGDPCTGG---ECTNLPGLFECRCSAGYVLD-RDTNTCVDTDECSTGNGGCSQICINYPGSAQCRC 1520          

HSP 4 Score: 200.29 bits (508), Expect = 3.823e-53
Identity = 151/391 (38.62%), Postives = 193/391 (49.36%), Query Frame = 0
Query:  462 HICTNKPGTYMCDCRLGFTSQG---TACVDINEC-LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGD--DCSDINECETQDLICDH--NCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYV-DVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY 842
            H+C N PG+  C C  G+ + G     C D++EC  +N G   C  +C N  G   C+C   P       D+ TC   + C+  NG C   CI+    + C C  GY LD +  +C D+NECV   I     C+N PGS  C C  GY  D  +C D +EC     +C     C+NT G   C C+ G+     T CFD DEC + N      C+NLEG + C C  G++   +   C D NEC I  + CG+ G CINTP S+ C C  G+E  E  C DI+EC +      G C NL G + C C  G+      C DI+EC  +PC  GEC N    + C C +GYV D D N C D DEC   N  G    C N PGS  C C PGY
Sbjct:  396 HLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYG---CSHDCVNTAGSAYCDC---PKGWDIGTDDKTCQDIDECREENGFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAAICGHGDCINTPGSYSCSCHQGYRLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFSGST-CFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYY--QEEGVCLDINECIIS-SPCGV-GTCINTPASYACSCPDGYEEREGGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNLPGLFECRCSAGYVLDRDTNTCVDTDECSTGNG-GCSQICINYPGSAQCRCHPGY 1532          

HSP 5 Score: 175.252 bits (443), Expect = 7.907e-45
Identity = 171/505 (33.86%), Postives = 236/505 (46.73%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDET---ECFDKDECEMDNGG--CEQVCNNLEGTFQCGCK--PGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDECLHDNPCGVGGK-CNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF---HSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            C   C N  G+  C+C  G+     +   +C D +EC ++NG   C+  C N +G + C C    G  +  DN TC     C     N G   +CIN+    +C C PGF L  D  +C D++EC ++       C N  G+  C C  GY     HN+TC D++EC  +   C H +C+N +    C C  G+ D+   D  C+D DEC  +N  G   + C NK GS +C C  GY        C D+NE  +    CG HGDC+N  GS+ C CHQG+   + D++ C D DEC           EC NTLGG+ECLC+ G+  S    +TC D++EC + N      C N+ G + C C +GY ++E G C   +EC +S     G    CIN P    C C  GY    +    C D +EC     G    C+N  G  TC CH GF       E   +        G C+++      GL   C C +G+ L  D  TC
Sbjct:    3 CSQKCENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPCQDTCTNHDGGYVCSCDNLAGTQIGQDNHTCEGVGGCAHN--NGGCSHECINSYNQVFCMCPPGFVLGPDWRTCEDVDECLSNNNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSH-DCVNTAGSAYCDCPKGW-DIGTDDKTCQDIDECREEN--GFCQQICINKIGSMECGCEVGYHLDTNTSSCSDVNECVVAA-ICG-HGDCINTPGSYSCSCHQGY---RLDAHECQDRDECSQDTNLCGDAGECVNTLGGYECLCQPGYGFS---GSTCFDLDECLIGNPCVHGTCDNLEGGYSCECDKGYYQEE-GVCLDINECIISSPCGVG---TCINTPASYACSCPDGY---EEREGGCHDIDECLSEPCGKHGDCLNLPGNFTCHCHPGFALTAGLCEDIDECAGDPCTGGECTNL-----PGLF-ECRCSAGYVLDRDTNTC 1436          

HSP 6 Score: 98.9821 bits (245), Expect = 2.848e-20
Identity = 85/249 (34.14%), Postives = 113/249 (45.38%), Query Frame = 0
Query:  868 CVNNDGSFECVCHQGFIH-DQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCETGFALSEILPN--TCEDINECALNNGDCSQVCVNILGSHYCRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C N  G+F C C +G+     + +  C+D +ECL      PC    C N  GG+ C C+   A ++I  +  TCE +  CA NNG CS  C+N     +C C  G+    D R  C   DEC LS   N GC  LC+N PG   C C PGY         C D +EC   N GC H C+N  G   C C  G+     + + C     C   NG C  IC +    +   C C  G+ L T+  +C  +
Sbjct:   15 CENRPGTFMCSCAEGYSSFGGSVAGDCLDMNECLLNNGHGPC-QDTCTNHDGGYVCSCDN-LAGTQIGQDNHTCEGVGGCAHNNGGCSHECINSYNQVFCMCPPGFVLGPDWR-TCEDVDEC-LSN--NNGCPHLCVNTPGSAHCACMPGYEAAGGHNATCEDVDECHTMNYGCSHDCVNTAGSAYCDCPKGWDIGTDD-KTCQDIDECREENGFCQQICINKIGSM--ECGCEVGYHLDTNTSSCSDV 734          

HSP 7 Score: 35.039 bits (79), Expect = 2.433e+0
Identity = 30/87 (34.48%), Postives = 38/87 (43.68%), Query Frame = 0
Query:  432 TCECHDGFFLNXXXXXXXXXXXXXXXXXXXHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC 516
            TC CH GF L      +  +   D     +  CTN PG + C C  G+        CVD +EC  + G+G C   C N  G  QC C
Sbjct: 1272 TCHCHPGFALTAGLCEDIDECAGDPCTGGE--CTNLPGLFECRCSAGYVLDRDTNTCVDTDEC--STGNGGCSQICINYPGSAQCRC 1520          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592952813|gb|GAXK01005740.1| (TSA: Calanus finmarchicus comp235550_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 321.242 bits (822), Expect = 2.668e-89
Identity = 262/823 (31.83%), Postives = 353/823 (42.89%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECH--PGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCN-NKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQND-SNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY--IVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKC----NPTFNR----------------PQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQ 1410
            C   C+  +G A C C  GF      EC D DEC   NGGC++ C N  GT+ C C  GF L  DN  C D NEC     +      C+N  G +YCEC+  PG EL ED  SC  I+ C  +    S  C + +G   C C  G        TC D++EC       G C+N    YSC      V +D  C +  E  +    GV GK    K GS    C  G++ K G C            CG       G+C+        VC  GF+    +   +C D + C    C   E       +EC C+ GFAL     N C DI+ECA                                            PN   +  C+N  G   C+C  GY  + DS     C D +EC  NN  C   C N  G + CSC  GF     N + C     C++    C H C++T  G    C+C SGF    +  T K I   C     P  G   C+     G  V G+ C+L+C++G+M  G ++RKC+ NG W  +    C+ + CP L    N  + P  C++       +C  TC  G+   G K   C + S+W   R  P  C     P + +                P I CPPD+   L   S  + V IPKP+TN +WE+ V S P  A  L      G   + F A S +   + A C++++ V D + PTV  CP+S   +L PGQ  +R+ W EP F DN+KI+HV+AS LPG   + G H IVY A+D  GN  +C FTIT+ +   +
Sbjct:  308 CSQECMIEDGHAVCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETGASCEGNCVNSFGSYSC------VALD--CEEGFEARNGECVGVCGKDEIYKDGSCFPKCGEGFQLKEGKCSPR---------CGNGYKWADGECIE-------VCEYGFVQTGTECVPVCGDVNPCGRGTCLPKE-----DFYECECDAGFALQN---NECVDIDECA-------------------------------------------DPNTCSRGECVNNEGSYSCDCEAGYRKVDDS-----CRDIDECEENNP-CSQTCTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHGCENTPGGFE--CVCNSGFASDPEDST-KCISTGCPVLNAPEGGVLNCS----PGDPVPGSLCRLECQRGYMRRGKMSRKCMENGNWE-EGRGWCQKVACPALTVTDNVQVYPPNCLSGEQTYKQRCKLTCPPGFDFEGSKAAFCGKRSQWV-FRNGPSTCAEQSKPEYTQIPPPPPPLKKTTPAPPPYIVCPPDISLNLTGPS-PMLVQIPKPKTNADWEKNVRSYPDKAKSLSYYQEPGVVEIKFEASSSL-ANQVAFCKVVVTVNDAVRPTVSYCPQSRSVFLEPGQKSQRVFWKEPAFTDNVKIEHVIASALPGQELNLGKHLIVYQAADKAGNKEKCVFTITVVQFKQE 2500          

HSP 2 Score: 290.812 bits (743), Expect = 2.213e-79
Identity = 217/547 (39.67%), Postives = 281/547 (51.37%), Query Frame = 0
Query:  310 QFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNXXXXXXXXXXXXXXXXXXXHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYC---KCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDK--DECEMDNGGCEQVCNNLEGTFQCG--CKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGY 842
            +FY+K+ VDL  LD +C      A  I +  + RY+ RV N  LPG  Y + +Y+CD GYA      D++FC E  W G  P C  KS+  +   S  SC     E+  C   C ++ G    C C +GF      ECED+DEC D    CD  C NKPGTYMC C  GF        CVD NECL NNGHGPCQD C N +G Y CEC GLPGT+L++ D H+C   + C+ NNG CSH+C  S  + +C CP G EL+EDWKTC D++EC TG   C   C+N  GS  C    C+ G+E  +     EC     +C  + I  +GS    C  GF L  E +C  +  +  +  +G C +VC    G  Q G  C P          C D N C  G         C+     + CEC  GF L  + C+DI+EC +   C  G C N EG+Y C C++GY   + +C DI+EC   NPC    C N    Y CSC  G++ +    +VC+D DEC L    C  G  C N PG F+C C  G+
Sbjct: 1286 EFYQKHFVDLRILDETCEPVSFPAPTIMNGIVLRYE-RVENVLLPGRMYRQAIYQCDAGYALSSRTSDSMFCQEYGWTGLEPDC-EKSSTPVVTESSASCG----EESGCSQECMIEDGHA-VCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAE-DKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETG-ASCEGNCVNSFGSYSCVALDCEEGFEARN----GECVG---VCGKDEIYKDGSCFPKCGEGFQLK-EGKCSPRCGNGYKWADGECIEVCEY--GFVQTGTECVP---------VCGDVNPCGRGT--------CLPKEDFYECECDAGFALQNNECVDIDECADPNTCSRGECVNNEGSYSCDCEAGYRKVDDSCRDIDECEENNPCSQ-TCTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHG--CENTPGGFECVCNSGF 2809          

HSP 3 Score: 67.0106 bits (162), Expect = 5.244e-10
Identity = 46/121 (38.02%), Postives = 59/121 (48.76%), Query Frame = 0
Query:  989 GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN--GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            GC Q C+   G   C C+ G++  S +   C D +EC   NGGC   CINK G + CSC  GF+  E N   CV A  C  NN  G C   C + E   +  C    G +L  D  +C+PI
Sbjct: 2150 GCSQECMIEDGHAVCYCSEGFVETSYNE--CEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDN-HGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPI 2503          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592952815|gb|GAXK01005738.1| (TSA: Calanus finmarchicus comp235550_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 321.242 bits (822), Expect = 2.775e-89
Identity = 261/826 (31.60%), Postives = 351/826 (42.49%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECH--PGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGHGECINESPGYSC---SCHSGYVDVDNVCRDYDECLHDNPCGVGGKCN-NKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQND-SNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY--IVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKC----NPTFNR----------------PQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQ 1410
            C   C+  +G A C C  GF      EC D DEC   NGGC++ C N  GT+ C C  GF L  DN  C D NEC     +      C+N  G +YCEC+  PG EL ED  SC  I+ C  +    S  C + +G   C C  G        TC D++EC       G C+N    YSC    C  G+   +  C            GV GK    K GS    C  G++ K G C            CG       G+C+        VC  GF+    +   +C D + C    C   E       +EC C+ GFAL     N C DI+ECA                                            PN   +  C+N  G   C+C  GY  + DS     C D +EC  NN  C   C N  G + CSC  GF     N + C     C++    C H C++T  G    C+C SGF    +  T K I   C     P  G   C+     G  V G+ C+L+C++G+M  G ++RKC+ NG W  +    C+ + CP L    N  + P  C++       +C  TC  G+   G K   C + S+W   R  P  C     P + +                P I CPPD+   L   S  + V IPKP+TN +WE+ V S P  A  L      G   + F A S +   + A C++++ V D + PTV  CP+S   +L PGQ  +R+ W EP F DN+KI+HV+AS LPG   + G H IVY A+D  GN  +C FTIT+ +   +
Sbjct:  308 CSQECMIEDGHAVCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETGASCEGNCVNSFGSYSCVALDCEEGFEARNGEC-----------VGVCGKDEIYKDGSCFPKCGEGFQLKEGKCSPR---------CGNGYKWADGECIE-------VCEYGFVQTGTECVPVCGDVNPCGRGTCLPKE-----DFYECECDAGFALQN---NECVDIDECA-------------------------------------------DPNTCSRGECVNNEGSYSCDCEAGYRKVDDS-----CRDIDECEENNP-CSQTCTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHGCENTPGGFE--CVCNSGFASDPEDST-KCISTGCPVLNAPEGGVLNCSP----GDPVPGSLCRLECQRGYMRRGKMSRKCMENGNWE-EGRGWCQKVACPALTVTDNVQVYPPNCLSGEQTYKQRCKLTCPPGFDFEGSKAAFCGKRSQWV-FRNGPSTCAEQSKPEYTQIPPPPPPLKKTTPAPPPYIVCPPDISLNLTGPSP-MLVQIPKPKTNADWEKNVRSYPDKAKSLSYYQEPGVVEIKFEASSSL-ANQVAFCKVVVTVNDAVRPTVSYCPQSRSVFLEPGQKSQRVFWKEPAFTDNVKIEHVIASALPGQELNLGKHLIVYQAADKAGNKEKCVFTITVVQFKQE 2500          

HSP 2 Score: 290.426 bits (742), Expect = 2.374e-79
Identity = 217/547 (39.67%), Postives = 281/547 (51.37%), Query Frame = 0
Query:  310 QFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNXXXXXXXXXXXXXXXXXXXHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYC---KCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDK--DECEMDNGGCEQVCNNLEGTFQCG--CKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGY 842
            +FY+K+ VDL  LD +C      A  I +  + RY+ RV N  LPG  Y + +Y+CD GYA      D++FC E  W G  P C  KS+  +   S  SC     E+  C   C ++ G    C C +GF      ECED+DEC D    CD  C NKPGTYMC C  GF        CVD NECL NNGHGPCQD C N +G Y CEC GLPGT+L++ D H+C   + C+ NNG CSH+C  S  + +C CP G EL+EDWKTC D++EC TG   C   C+N  GS  C    C+ G+E  +     EC     +C  + I  +GS    C  GF L  E +C  +  +  +  +G C +VC    G  Q G  C P          C D N C  G         C+     + CEC  GF L  + C+DI+EC +   C  G C N EG+Y C C++GY   + +C DI+EC   NPC    C N    Y CSC  G++ +    +VC+D DEC L    C  G  C N PG F+C C  G+
Sbjct: 1286 EFYQKHFVDLRILDETCEPVSFPAPTIMNGIVLRYE-RVENVLLPGRMYRQAIYQCDAGYALSSRTSDSMFCQEYGWTGLEPDC-EKSSTPVVTESSASCG----EESGCSQECMIEDGHA-VCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAE-DKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETG-ASCEGNCVNSFGSYSCVALDCEEGFEARN----GECVG---VCGKDEIYKDGSCFPKCGEGFQLK-EGKCSPRCGNGYKWADGECIEVCEY--GFVQTGTECVP---------VCGDVNPCGRGT--------CLPKEDFYECECDAGFALQNNECVDIDECADPNTCSRGECVNNEGSYSCDCEAGYRKVDDSCRDIDECEENNPCSQT-CTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHG--CENTPGGFECVCNSGF 2809          

HSP 3 Score: 67.0106 bits (162), Expect = 5.163e-10
Identity = 46/121 (38.02%), Postives = 59/121 (48.76%), Query Frame = 0
Query:  989 GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN--GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            GC Q C+   G   C C+ G++  S +   C D +EC   NGGC   CINK G + CSC  GF+  E N   CV A  C  NN  G C   C + E   +  C    G +L  D  +C+PI
Sbjct: 2150 GCSQECMIEDGHAVCYCSEGFVETSYNE--CEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDN-HGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPI 2503          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592952812|gb|GAXK01005741.1| (TSA: Calanus finmarchicus comp235550_c0_seq5 transcribed RNA sequence)

HSP 1 Score: 320.087 bits (819), Expect = 2.805e-89
Identity = 262/823 (31.83%), Postives = 353/823 (42.89%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECH--PGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCN-NKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQND-SNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY--IVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKC----NPTFNR----------------PQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQ 1410
            C   C+  +G A C C  GF      EC D DEC   NGGC++ C N  GT+ C C  GF L  DN  C D NEC     +      C+N  G +YCEC+  PG EL ED  SC  I+ C  +    S  C + +G   C C  G        TC D++EC       G C+N    YSC      V +D  C +  E  +    GV GK    K GS    C  G++ K G C            CG       G+C+        VC  GF+    +   +C D + C    C   E       +EC C+ GFAL     N C DI+ECA                                            PN   +  C+N  G   C+C  GY  + DS     C D +EC  NN  C   C N  G + CSC  GF     N + C     C++    C H C++T  G    C+C SGF    +  T K I   C     P  G   C+     G  V G+ C+L+C++G+M  G ++RKC+ NG W  +    C+ + CP L    N  + P  C++       +C  TC  G+   G K   C + S+W   R  P  C     P + +                P I CPPD+   L   S  + V IPKP+TN +WE+ V S P  A  L      G   + F A S +   + A C++++ V D + PTV  CP+S   +L PGQ  +R+ W EP F DN+KI+HV+AS LPG   + G H IVY A+D  GN  +C FTIT+ +   +
Sbjct:  308 CSQECMIEDGHAVCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETGASCEGNCVNSFGSYSC------VALD--CEEGFEARNGECVGVCGKDEIYKDGSCFPKCGEGFQLKEGKCSPR---------CGNGYKWADGECIE-------VCEYGFVQTGTECVPVCGDVNPCGRGTCLPKE-----DFYECECDAGFALQN---NECVDIDECA-------------------------------------------DPNTCSRGECVNNEGSYSCDCEAGYRKVDDS-----CRDIDECEENNP-CSQTCTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHGCENTPGGFE--CVCNSGFASDPEDST-KCISTGCPVLNAPEGGVLNCSP----GDPVPGSLCRLECQRGYMRRGKMSRKCMENGNWE-EGRGWCQKVACPALTVTDNVQVYPPNCLSGEQTYKQRCKLTCPPGFDFEGSKAAFCGKRSQWV-FRNGPSTCAEQSKPEYTQIPPPPPPLKKTTPAPPPYIVCPPDISLNLTGPSP-MLVQIPKPKTNADWEKNVRSYPDKAKSLSYYQEPGVVEIKFEASSSL-ANQVAFCKVVVTVNDAVRPTVSYCPQSRSVFLEPGQKSQRVFWKEPAFTDNVKIEHVIASALPGQELNLGKHLIVYQAADKAGNKEKCVFTITVVQFKQE 2500          

HSP 2 Score: 290.041 bits (741), Expect = 1.857e-79
Identity = 217/547 (39.67%), Postives = 281/547 (51.37%), Query Frame = 0
Query:  310 QFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNXXXXXXXXXXXXXXXXXXXHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYC---KCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDK--DECEMDNGGCEQVCNNLEGTFQCG--CKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGY 842
            +FY+K+ VDL  LD +C      A  I +  + RY+ RV N  LPG  Y + +Y+CD GYA      D++FC E  W G  P C  KS+  +   S  SC     E+  C   C ++ G    C C +GF      ECED+DEC D    CD  C NKPGTYMC C  GF        CVD NECL NNGHGPCQD C N +G Y CEC GLPGT+L++ D H+C   + C+ NNG CSH+C  S  + +C CP G EL+EDWKTC D++EC TG   C   C+N  GS  C    C+ G+E  +     EC     +C  + I  +GS    C  GF L  E +C  +  +  +  +G C +VC    G  Q G  C P          C D N C  G         C+     + CEC  GF L  + C+DI+EC +   C  G C N EG+Y C C++GY   + +C DI+EC   NPC    C N    Y CSC  G++ +    +VC+D DEC L    C  G  C N PG F+C C  G+
Sbjct: 1286 EFYQKHFVDLRILDETCEPVSFPAPTIMNGIVLRYE-RVENVLLPGRMYRQAIYQCDAGYALSSRTSDSMFCQEYGWTGLEPDC-EKSSTPVVTESSASCG----EESGCSQECMIEDGHA-VCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAE-DKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETG-ASCEGNCVNSFGSYSCVALDCEEGFEARN----GECVG---VCGKDEIYKDGSCFPKCGEGFQLK-EGKCSPRCGNGYKWADGECIEVCEY--GFVQTGTECVP---------VCGDVNPCGRGT--------CLPKEDFYECECDAGFALQNNECVDIDECADPNTCSRGECVNNEGSYSCDCEAGYRKVDDSCRDIDECEENNPCSQ-TCTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHG--CENTPGGFECVCNSGF 2809          

HSP 3 Score: 66.6254 bits (161), Expect = 6.749e-10
Identity = 46/121 (38.02%), Postives = 59/121 (48.76%), Query Frame = 0
Query:  989 GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN--GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            GC Q C+   G   C C+ G++  S +   C D +EC   NGGC   CINK G + CSC  GF+  E N   CV A  C  NN  G C   C + E   +  C    G +L  D  +C+PI
Sbjct: 2150 GCSQECMIEDGHAVCYCSEGFVETSYNE--CEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDN-HGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPI 2503          
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Match: gi|592952816|gb|GAXK01005737.1| (TSA: Calanus finmarchicus comp235550_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 321.242 bits (822), Expect = 3.596e-89
Identity = 261/826 (31.60%), Postives = 351/826 (42.49%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECH--PGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGHGECINESPGYSC---SCHSGYVDVDNVCRDYDECLHDNPCGVGGKCN-NKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQND-SNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY--IVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKC----NPTFNR----------------PQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQ 1410
            C   C+  +G A C C  GF      EC D DEC   NGGC++ C N  GT+ C C  GF L  DN  C D NEC     +      C+N  G +YCEC+  PG EL ED  SC  I+ C  +    S  C + +G   C C  G        TC D++EC       G C+N    YSC    C  G+   +  C            GV GK    K GS    C  G++ K G C            CG       G+C+        VC  GF+    +   +C D + C    C   E       +EC C+ GFAL     N C DI+ECA                                            PN   +  C+N  G   C+C  GY  + DS     C D +EC  NN  C   C N  G + CSC  GF     N + C     C++    C H C++T  G    C+C SGF    +  T K I   C     P  G   C+     G  V G+ C+L+C++G+M  G ++RKC+ NG W  +    C+ + CP L    N  + P  C++       +C  TC  G+   G K   C + S+W   R  P  C     P + +                P I CPPD+   L   S  + V IPKP+TN +WE+ V S P  A  L      G   + F A S +   + A C++++ V D + PTV  CP+S   +L PGQ  +R+ W EP F DN+KI+HV+AS LPG   + G H IVY A+D  GN  +C FTIT+ +   +
Sbjct:  308 CSQECMIEDGHAVCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETGASCEGNCVNSFGSYSCVALDCEEGFEARNGEC-----------VGVCGKDEIYKDGSCFPKCGEGFQLKEGKCSPR---------CGNGYKWADGECIE-------VCEYGFVQTGTECVPVCGDVNPCGRGTCLPKE-----DFYECECDAGFALQN---NECVDIDECA-------------------------------------------DPNTCSRGECVNNEGSYSCDCEAGYRKVDDS-----CRDIDECEENNP-CSQTCTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHGCENTPGGFE--CVCNSGFASDPEDST-KCISTGCPVLNAPEGGVLNCSP----GDPVPGSLCRLECQRGYMRRGKMSRKCMENGNWE-EGRGWCQKVACPALTVTDNVQVYPPNCLSGEQTYKQRCKLTCPPGFDFEGSKAAFCGKRSQWV-FRNGPSTCAEQSKPEYTQIPPPPPPLKKTTPAPPPYIVCPPDISLNLTGPSP-MLVQIPKPKTNADWEKNVRSYPDKAKSLSYYQEPGVVEIKFEASSSL-ANQVAFCKVVVTVNDAVRPTVSYCPQSRSVFLEPGQKSQRVFWKEPAFTDNVKIEHVIASALPGQELNLGKHLIVYQAADKAGNKEKCVFTITVVQFKQE 2500          

HSP 2 Score: 290.426 bits (742), Expect = 2.700e-79
Identity = 217/547 (39.67%), Postives = 281/547 (51.37%), Query Frame = 0
Query:  310 QFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNXXXXXXXXXXXXXXXXXXXHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYC---KCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDK--DECEMDNGGCEQVCNNLEGTFQCG--CKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGYVDV---DNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGY 842
            +FY+K+ VDL  LD +C      A  I +  + RY+ RV N  LPG  Y + +Y+CD GYA      D++FC E  W G  P C  KS+  +   S  SC     E+  C   C ++ G    C C +GF      ECED+DEC D    CD  C NKPGTYMC C  GF        CVD NECL NNGHGPCQD C N +G Y CEC GLPGT+L++ D H+C   + C+ NNG CSH+C  S  + +C CP G EL+EDWKTC D++EC TG   C   C+N  GS  C    C+ G+E  +     EC     +C  + I  +GS    C  GF L  E +C  +  +  +  +G C +VC    G  Q G  C P          C D N C  G         C+     + CEC  GF L  + C+DI+EC +   C  G C N EG+Y C C++GY   + +C DI+EC   NPC    C N    Y CSC  G++ +    +VC+D DEC L    C  G  C N PG F+C C  G+
Sbjct: 1286 EFYQKHFVDLRILDETCEPVSFPAPTIMNGIVLRYE-RVENVLLPGRMYRQAIYQCDAGYALSSRTSDSMFCQEYGWTGLEPDC-EKSSTPVVTESSASCG----EESGCSQECMIEDGHA-VCYCSEGFVETSYNECEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDNHGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAE-DKHSCEPIDMCEENNGDCSHDCYSSQGEAYCTCPQGLELEEDWKTCRDVDECETG-ASCEGNCVNSFGSYSCVALDCEEGFEARN----GECVG---VCGKDEIYKDGSCFPKCGEGFQLK-EGKCSPRCGNGYKWADGECIEVCEY--GFVQTGTECVP---------VCGDVNPCGRGT--------CLPKEDFYECECDAGFALQNNECVDIDECADPNTCSRGECVNNEGSYSCDCEAGYRKVDDSCRDIDECEENNPCSQT-CTNTPGSYKCSCLEGFLKLPGNKDVCKDIDECNLKPAICEHG--CENTPGGFECVCNSGF 2809          

HSP 3 Score: 67.0106 bits (162), Expect = 5.483e-10
Identity = 46/121 (38.02%), Postives = 59/121 (48.76%), Query Frame = 0
Query:  989 GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN--GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            GC Q C+   G   C C+ G++  S +   C D +EC   NGGC   CINK G + CSC  GF+  E N   CV A  C  NN  G C   C + E   +  C    G +L  D  +C+PI
Sbjct: 2150 GCSQECMIEDGHAVCYCSEGFVETSYNE--CEDIDECADGNGGCDEECINKPGTYMCSCPSGFELREDN-HGCVDANECLSNNGHGPCQDTCVNAEGYYYCECNGLPGTELAEDKHSCEPI 2503          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000000097 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1016:54227:61159:-1 gene:EMLSAG00000000097 transcript:EMLSAT00000000097 description:"maker-LSalAtl2s1016-augustus-gene-0.10")

HSP 1 Score: 3345.83 bits (8674), Expect = 0.000e+0
Identity = 1638/1638 (100.00%), Postives = 1638/1638 (100.00%), Query Frame = 0
Query:    1 MRSLNVFIFIQLCILVLVDDSSLASSEKDCNYKLKHGKTSLKKDNRLYFQCRTGYKLIGFQNVPCSMLKDLKERKGIIPKCVPKKNEEAKDKDEEDYKEGSTTILSSTDNTPTTTVIVMEIETTTVSSTSLSPTTTTSTTTTDSTTXESSTSPSPATTTTXLPTTTTKSTTTTSTTTTKSYSDYEYGSGRGFITDDEDFDLGSGDNNGLYDSEDLFPLISTSTTTKILTTATTRTTXASTTTTIATLTTSEVPPVFKSLNNIFITDDEDLIDGSGFDLDYETSGSGYYVHEIEDIGNSSGEKKEQKARVQFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGICVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHCYPNRSSFESRRGRKEYLLNKKRNKEKTGGLRFYKSWMSPPSKLK 1638
            MRSLNVFIFIQLCILVLVDDSSLASSEKDCNYKLKHGKTSLKKDNRLYFQCRTGYKLIGFQNVPCSMLKDLKERKGIIPKCVPKKNEEAKDKDEEDYKEGSTTILSSTDNTPTTTVIVMEIETTTVSSTSLSPTTTTSTTTTDSTTXESSTSPSPATTTTXLPTTTTKSTTTTSTTTTKSYSDYEYGSGRGFITDDEDFDLGSGDNNGLYDSEDLFPLISTSTTTKILTTATTRTTXASTTTTIATLTTSEVPPVFKSLNNIFITDDEDLIDGSGFDLDYETSGSGYYVHEIEDIGNSSGEKKEQKARVQFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGICVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHCYPNRSSFESRRGRKEYLLNKKRNKEKTGGLRFYKSWMSPPSKLK
Sbjct:    1 MRSLNVFIFIQLCILVLVDDSSLASSEKDCNYKLKHGKTSLKKDNRLYFQCRTGYKLIGFQNVPCSMLKDLKERKGIIPKCVPKKNEEAKDKDEEDYKEGSTTILSSTDNTPTTTVIVMEIETTTVSSTSLSPTTTTSTTTTDSTTXESSTSPSPATTTTXLPTTTTKSTTTTSTTTTKSYSDYEYGSGRGFITDDEDFDLGSGDNNGLYDSEDLFPLISTSTTTKILTTATTRTTXASTTTTIATLTTSEVPPVFKSLNNIFITDDEDLIDGSGFDLDYETSGSGYYVHEIEDIGNSSGEKKEQKARVQFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGICVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHCYPNRSSFESRRGRKEYLLNKKRNKEKTGGLRFYKSWMSPPSKLK 1638          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000000337 (pep:novel supercontig:LSalAtl2s:LSalAtl2s104:500942:512548:-1 gene:EMLSAG00000000337 transcript:EMLSAT00000000337 description:"augustus_masked-LSalAtl2s104-processed-gene-5.0")

HSP 1 Score: 369.392 bits (947), Expect = 5.332e-107
Identity = 279/809 (34.49%), Postives = 395/809 (48.83%), Query Frame = 0
Query:  623 CDHNC-INTEGSAHCTCKAGFDLMD-ETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMEDS--CMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVD---NVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFH-SECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV---CVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKP-------IGGICSSAPRPSNGYYRCNKKKVS-GYFVKGTKCKLKCR-KGFMPTGHITRKCINNGTWTGDEDHACEVMNCPP-LPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITL 1404
            CDH C IN  G   C C  G+ ++D ET+C D DEC  D+GGC+ +C N  G+F C C PGF    + L C DENEC     +   +G+C N  GS+ C C   PG  L +DS  C+  +E       G S +C + +G   C C            D   CI N     E + E      +C S   + D   + C D DEC +++N CG  G+C N  GSF+C C+ GY  +++  C DINE   E++ C  +  CVN +GSFEC C  G+I +   SN+C D +EC     C H S C N  G + C C +G+ L E     C+DI+EC L    C+ V   C+N  GS++C C  GY  +  G C   DEC  S R NG C Q+CIN+ G  +C+C  GY  DS +   CVD +EC      C   C+N LG ++CSC  GF+   ++P KC        +   C + C      ++  C+CP G+ L  D  +C P       + G+     R     Y C++ + S G++  GT C+  C    +     + ++C  +G W G  +  C  M CPP L    N  + P  C +      S C  +C  GY++ G    RC +   W                      PD+IE L     S YV IP+P TNVNWE  V ++P  A  L+ E+  G H + F A+  +  +  A C + I++ D  PP V +CP+SF    +P + +K++ W EPNF DN++I H++ + L G  F  G H I+Y A D  GN  RC F   +
Sbjct:  328 CDHKCEINENGEPKCVCAEGYTILDGETDCSDIDECLFDSGGCDHICINKPGSFVCECPPGFA--PEGLECVDENECLSNNGHGPCHGECTNNHGSYVCSCVSLPGTXLGDDSKRCVANDELCKELNGGCSHTCYSSQGQAFCMCPDDMKLDT----DWKNCISNN-DPEEKVKEKK----TCDSNGFEYDPASDSCIDVDECGVNENICGEHGQCVNLNGSFECQCSDGYILYESNMCQDINECESEQNVCDVNSYCVNLEGSFECRCSNGYILE---SNVCQDINECEDEFICNHGSICVNFEGSYRCDCSSGYELDE--NRYCQDIDEC-LQFDSCNNVNSHCINNPGSYFCECNAGYWNN-SGFCDDFDEC--SDR-NGDCSQICINLEGSYRCDCLSGYHTDSVNSNECVDIDECAKGYHTCDQNCVNSLGSYSCSCDWGFEMSHEDPFKCYSL----CDRMNCVYEC------INGTCICPRGYVLSNDNVSCVPKKNNGCSMEGLVDQTHR-----YFCSEMESSPGFYPVGTICQSLCTPHNYTSVRKMKKECQFDGQW-GLSNQTCAKMECPPLLDNFGNVILEPPNCESKPQALQSVCRVSCLPGYKLMGSHIIRCRKDLRWHY--------------------PDIIEFLHDGRNSAYVEIPRPATNVNWENNVVAEPPIAKSLKLELPPGTHYIRFVAQ--LQGQREANCNLSINIIDRTPPKVYDCPESFEVKYNPRE-LKKVFWEEPNFSDNVRIAHMITNKLSGELFQYGRHTIIYEAGDDHGNKIRCMFHFNV 1076          

HSP 2 Score: 328.561 bits (841), Expect = 2.915e-93
Identity = 231/675 (34.22%), Postives = 335/675 (49.63%), Query Frame = 0
Query:  183 DYEYGSGRGFITDDEDFDLGSGDNNGLYDSEDLFPLIS-TSTTTKILTTATTRTTXASTTTTIATLTTSEVPPVFKSLNNIFITDDEDLIDGSGFDLDYETSGSGYYVHEIEDIGNSSGEKKEQKARV--QFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCV------AKSTLEI-ADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGF-FLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWK------------------------------TCVDINECVTGDIQC--LNKCMNVPGSAYCKCDSG---YEGDDCSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ--VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY---IFHNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGY 802
            D +YGS   +   D D +  S      Y +E    + + T  T++++   TT         T  ++ T+ V        + +   ++   +   +  +YE   S Y   E     ++  E   Q   +   FY+ Y VDL  +D SC         I+H  +  +  +  N  L G+ Y+ +LYKC+EGYA        LFC E  WIG +P C       A +T  I ++ S P+     Q  K C+H C +++   P C C +G+  L+ + +C D+DEC+ D   CDHIC NKPG+++C+C  GF  +G  CVD NECL NNGHGPC  EC N  G Y C C  LPGT L D       +DE C+  NGGCSH C  S  Q FC+CPD  +LD DWK                              +C+D++EC   +  C    +C+N+ GS  C+C  G   YE + C DINECE++  +CD N  C+N EGS  C C  G+ +++   C D +ECE D   C    +C N EG+++C C  G+ L+ +N  C D +EC    +   +   CIN PGS++CEC+ G+      C D +EC++     S  C NLEG+Y C C SGY     +++ C+DI+EC +  + C    C+N    YSCSC  G+
Sbjct:   90 DNDYGSYYEYNYSDYDVNETS---TSAYSTEPYTEMTTLTMDTSQVIPEETTTHVEIQEGVTEESIETTTVLTPEDKERDDYEEGEDTQEEEEDYPSEYENYESDYENEE----ADAETEILYQNYEILSNFYKLYYVDLRVIDTSCTSHKPPPPEISHGYVAEFITK-ENILLKGKSYSVILYKCEEGYALSSESTGQLFCQENGWIGIQPTCXIDXSSNAXTTXSINSNTSDPNESLLSQCNKDCDHKCEINENGEPKCVCAEGYTILDGETDCSDIDECLFDSGGCDHICINKPGSFVCECPPGFAPEGLECVDENECLSNNGHGPCHGECTNNHGSYVCSCVSLPGTXLGDDSKRCVANDELCKELNGGCSHTCYSSQGQAFCMCPDDMKLDTDWKNCISNNDPEEKVKEKKTCDSNGFEYDPASDSCIDVDECGVNENICGEHGQCVNLNGSFECQCSDGYILYESNMCQDINECESEQNVCDVNSYCVNLEGSFECRCSNGY-ILESNVCQDINECE-DEFICNHGSICVNFEGSYRCDCSSGYELD-ENRYCQDIDECLQFDSCNNVNSHCINNPGSYFCECNAGYWNNSGFCDDFDECSDRNGDCSQICINLEGSYRCDCLSGYHTDSVNSNECVDIDECAKGYHTCDQN-CVNSLGSYSCSCDWGF 752          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000002446 (pep:novel supercontig:LSalAtl2s:LSalAtl2s146:201796:210139:1 gene:EMLSAG00000002446 transcript:EMLSAT00000002446 description:"augustus_masked-LSalAtl2s146-processed-gene-2.2")

HSP 1 Score: 179.104 bits (453), Expect = 3.334e-46
Identity = 162/501 (32.34%), Postives = 222/501 (44.31%), Query Frame = 0
Query:  447 CEDVDECVDDPELCD--HICTNKPGTYMC------DCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKD-----------NHTCISDEACQVNNGGC--SHECIHSYNQIFCL----CPDGYELDEDWKTCVDINECVTGDIQCLN-----KCMNVPGSAYC---KCDSGYEGDDCSDINECETQDLICDHNCINTEGS-AHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQC--GCKPGFHLNTDNLTCTDENECTIGIANC-GIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGS-CNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY---------VDVDNVCRDYDE-CLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPC-GPHGDCVNNDGSFECV---CHQGFIHDQNDSN 891
            C+D+DEC ++   CD    C N  G YMC      +C  GF     +C+DI+EC+ N      ++ C N++G Y+CE        L +K+           ++ C     CQ  +  C  S  C ++     C+    C  GY L+     C D +EC  G   C +      C N+ GS  C   +CD G                       +N EG+ A   C+ GF       C D DECEMD     Q C N  G+F+C   C  G  LN  N  C D +EC IG+A C GIY  C+NT GS+ C+C  GF + +  C DI+EC    +CG  S C N  G++ C C +G+      C+D NEC   P  C  G C N    Y C C +GY         +D+D  CRD+D  CL        G C N PGS+ C C  GY   +    C DI+E     + C   H  C N  G F+C    C  G+  +++ +N
Sbjct:  182 CDDIDECEEESGXCDXSQTCINTIGDYMCQSMEEQNCPPGFKFFLLSCLDIDECMENKHSCSKRETCVNLEGSYKCE----KEVTLPNKNKCKVGYKYNFMSNQCEDINECQTGHHSCLESQRCDNTMGSFTCIRYTTCGTGYTLNLHTGRCDDNDECAMGMDNCASLGRGYLCRNIQGSFRCEKRRCDIG---------------------EILNDEGTCAPIQCQIGFVPGSSGSCVDVDECEMDLCFRGQSCENTMGSFRCTNQCSMGLRLNPLNSQCEDIDECLIGMAACVGIYKSCLNTIGSYKCQCTDGFAIDQGECKDIDECIKPGICGMDSDCQNSPGSFRCVCKAGFKSVGGECIDTNECKEIPGICQQG-CTNIWGSYRCHCQAGYKLSSDSRSCIDIDE-CRDFDNLCL--------GNCENIPGSYRCSCPDGYLLSSNSRSCQDIDECLERNNVCEKKHQHCSNTRGGFKCTDVSCPNGYTPEEDTTN 647          

HSP 2 Score: 159.844 bits (403), Expect = 4.183e-40
Identity = 152/481 (31.60%), Postives = 205/481 (42.62%), Query Frame = 0
Query:  560 CPDGYELDEDWKTCVDINECV--TGDIQCLNKCMNVPGSAYCK------CDSGYEG--DDCSDINECETQDLICD--HNCINTEGSAHC----------TCKAGFDL-MDETECFDKDECEMDNGGC--EQVCNNLEGTFQC----GCKPGFHLNTDNLTCTDENECTIGIANCGIYGD---CINTPGSFYCE---CHPGFELMED-------------------SCMDINECTNSTLCGSGSCNNLEGTYEC--KCDSGYIFH--NSTCLDINECIRNPCG----HGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCS---QVCVNILGSHYC---RCYEGYKKDE 970
            CP GY  ++    C DI+EC   +G       C+N  G   C+      C  G++     C DI+EC      C     C+N EGS  C           CK G+       +C D +EC+  +  C   Q C+N  G+F C     C  G+ LN     C D +EC +G+ NC   G    C N  GSF CE   C  G E++ D                   SC+D++EC         SC N  G++ C  +C  G   +  NS C DI+EC+         +  C+N    Y C C  G+      C+D DEC+    CG+   C N PGSF C C  G++   G C D NE   ++ P      C N  GS+ C C  G+    +DS  CID DEC    + C    C+N  G + C C  G+ LS     +C+DI+EC   N  C    Q C N  G   C    C  GY  +E
Sbjct:  169 CPRGYNFNQGLNLCDDIDECEEESGXCDXSQTCINTIGDYMCQSMEEQNCPPGFKFFLLSCLDIDECMENKHSCSKRETCVNLEGSYKCEKEVTLPNKNKCKVGYKYNFMSNQCEDINECQTGHHSCLESQRCDNTMGSFTCIRYTTCGTGYTLNLHTGRCDDNDECAMGMDNCASLGRGYLCRNIQGSFRCEKRRCDIG-EILNDEGTCAPIQCQIGFVPGSSGSCVDVDECEMDLCFRGQSCENTMGSFRCTNQCSMGLRLNPLNSQCEDIDECLIGMAACVGIYKSCLNTIGSYKCQCTDGFAIDQGECKDIDECIKPGICGMDSDCQNSPGSFRCVCKAGFKSVGGECIDTNE--CKEIPGICQQGCTNIWGSYRCHCQAGY-KLSSDSRSCIDIDECRDFDNLCL-GNCENIPGSYRCSCPDGYLLSSN-SRSCQDIDECLERNNVCEKKHQHCSNTRGGFKCTDVSCPNGYTPEE 643          

HSP 3 Score: 139.813 bits (351), Expect = 1.191e-33
Identity = 138/436 (31.65%), Postives = 191/436 (43.81%), Query Frame = 0
Query:  732 CMDINECTN-STLC-GSGSCNNLEGTYECK------CDSGYIFHNSTCLDINECIRN--PCGHGE-CINESPGYSC----------SCHSGYVD--VDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDC----DCAPGYEFK--NGXCHDINEXSLEKDPCGPHGD---CVNNDGSFEC--------------------VCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECL--CETGFALSEILPNTCEDINECALNNGDCSQV---CVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNG-GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C DI+EC   S  C  S +C N  G Y C+      C  G+ F   +CLDI+EC+ N   C   E C+N    Y C           C  GY    + N C D +EC    + C    +C+N  GSF C     C  GY      G C D +E ++  D C   G    C N  GSF C                     C  GF+   + S  C+D DEC    CF  + C+NT+G F C   C  G  L+  L + CEDI+EC +    C  +   C+N +GS+ C+C +G+  D+ G C   DEC    +P   G    C N PG  +C C  G+     +   C+D NEC    G CQ  C N  G + C C  G+K    +   C+    C   +  C   C++      +RC CP G+ L +++R+C+ I
Sbjct:  182 CDDIDECEEESGXCDXSQTCINTIGDYMCQSMEEQNCPPGFKFFLLSCLDIDECMENKHSCSKRETCVNLEGSYKCEKEVTLPNKNKCKVGYKYNFMSNQCEDINECQTGHHSCLESQRCDNTMGSFTCIRYTTCGTGYTLNLHTGRCDDNDECAMGMDNCASLGRGYLCRNIQGSFRCEKRRCDIGEILNDEGTCAPIQCQIGFVPGSSGS--CVDVDECEMDLCFRGQSCENTMGSFRCTNQCSMGLRLNP-LNSQCEDIDECLIGMAACVGIYKSCLNTIGSYKCQCTDGFAIDQ-GECKDIDECI---KPGICGMDSDCQNSPGSFRCVCKAGFKSVGGE---CIDTNECKEIPGICQQGCTNIWGSYRCHCQAGYKL-SSDSRSCIDIDECRDFDNLCLGNCENIPGS--YRCSCPDGYLLSSNSRSCQDI 604          

HSP 4 Score: 103.99 bits (258), Expect = 1.573e-22
Identity = 95/279 (34.05%), Postives = 123/279 (44.09%), Query Frame = 0
Query:  415 EKKRCEHICYL-DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMC--DCRLGFTSQ--GTACVDINECLLNNGHGPC---QDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCE---QVCNNLEGTFQC 676
            EK+RC+    L D+G     +C  GF     G C DVDEC  D       C N  G++ C   C +G       + C DI+ECL+  G   C      C N  G Y+C+C  G    Q   KD   CI    C     G   +C +S     C+C  G++       C+D NEC      C   C N+ GS  C C +GY    +   C DI+EC   D +C  NC N  GS  C+C  G+ L   +  C D DEC   N  CE   Q C+N  G F+C
Sbjct:  361 EKRRCDIGEILNDEGTCAPIQCQIGFVPGSSGSCVDVDECEMDLCFRGQSCENTMGSFRCTNQCSMGLRLNPLNSQCEDIDECLI--GMAACVGIYKSCLNTIGSYKCQCTDGFAIDQGECKDIDECIKPGIC-----GMDSDCQNSPGSFRCVCKAGFK--SVGGECIDTNECKEIPGICQQGCTNIWGSYRCHCQAGYKLSSDSRSCIDIDECRDFDNLCLGNCENIPGSYRCSCPDGYLLSSNSRSCQDIDECLERNNVCEKKHQHCSNTRGGFKC 630          

HSP 5 Score: 100.138 bits (248), Expect = 2.544e-21
Identity = 73/216 (33.80%), Postives = 100/216 (46.30%), Query Frame = 0
Query:  434 ECHDGFFLND-DGECEDVDECVDDPELCDHI---CTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICD---HNCINTEGSAHCT 637
            +C  G  LN  + +CED+DEC+     C  I   C N  G+Y C C  GF      C DI+EC+   G      +C+N  G ++C C  G             CI    C+   G C   C + +    C C  GY+L  D ++C+DI+EC   D  CL  C N+PGS  C C  GY        C DI+EC  ++ +C+    +C NT G   CT
Sbjct:  423 QCSMGLRLNPLNSQCEDIDECLIGMAACVGIYKSCLNTIGSYKCQCTDGFAIDQGECKDIDECI-KPGICGMDSDCQNSPGSFRCVCKAGFKSV------GGECIDTNECKEIPGICQQGCTNIWGSYRCHCQAGYKLSSDSRSCIDIDECRDFDNLCLGNCENIPGSYRCSCPDGYLLSSNSRSCQDIDECLERNNVCEKKHQHCSNTRGGFKCT 631          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000003435 (pep:novel supercontig:LSalAtl2s:LSalAtl2s188:581193:593418:1 gene:EMLSAG00000003435 transcript:EMLSAT00000003435 description:"snap_masked-LSalAtl2s188-processed-gene-6.23")

HSP 1 Score: 110.923 bits (276), Expect = 1.665e-24
Identity = 185/669 (27.65%), Postives = 279/669 (41.70%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTAC-VDINECLLNNGHGPCQ--DECKNVDGGYQCEC-GGLPGTQ-------------------LSDKDNHTCI-----SDEACQVNNGGCS-HECIHS---------YNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDC-SDINECETQDLICDHNCINTEGSAHCTCKAGF--DLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF-----ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCL-DINECIRNPCGHGECINESPGYSCSCHSGYV----DVDNV-CRDY---------DECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRCYEGYKKDE-RGNCFLKDECRLSR-RPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF 1051
            DV+EC  DP L    C N+   Y+C C+ G+  +G  C  ++NEC  N    PCQ   +C      Y C C  G  G                     +   D   CI     + + C+     C+ H C  +         Y   FC CP G++     + C VDI+EC+T        C+N  GS  CKC+ G+EG DC  +I++C +   +    C++      C C  GF  +L +E    D +EC  +      +C+    ++ C CK GF         T++ +CT   ++C   G CI+   ++ C C  G+     +   + C D N C N+  C  G  N+    Y C C SG+   N   L D  +   +PC +G C      Y+C C  G+     DV  V CR           D CL+      GG+C ++  S  C+C  G+    G      +      PC     C +  G++ C C +GF     + NI    DEC  +PC +   C + + GF+C C  G      +   CE +INEC          C++ +G + C+C  G+      G+    +EC  SR  P G   Q CI +    KC+C P Y+    + +    ++    N GGC +  +    GH CSC  G+
Sbjct:  252 DVNECSPDPCLNGATCENEFNDYVCRCQPGY--EGKRCEYEVNECKSN----PCQHGGKCLTHFNSYSCICPSGFTGNNCESNIDDCRLFPCKNSGLCIDQVDGFKCICSAPYTGKTCESEMNPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFK----GRYCSVDIDECLTYPCHNGASCVNTEGSYECKCEEGFEGRDCLLNIDDCASSPCVNGGTCLDETAGFKCLCVDGFGGNLCEE----DINECASNPCKNGAICHEYVNSYTCECKIGFSGTNCQ---TNDEDCT--ASSCMNGGKCIDGVNNYTCVCPRGYSGRNCQTRINPC-DKNPCQNNGTCVDGGYND----YSCHCSSGWTGRNCDRLVDWCQQGASPCENGRCYQSGTSYNCVCEDGWTGKVCDVRKVSCRIAAKLRSVDVSDLCLN------GGRCRDEWNSHVCECQDGFY---GSXCQYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGHNCEFNI----DECDPNPCQNEGVCHDLIDGFQCTCPYG-----TVGKLCEFNINECLEGTCHHGGTCIDKIGGYECQCRPGFVGQRCEGD---INECLTSRCSPYG--TQDCIQLTNAYKCQCKPDYMGKYCETKKNFCESSPCENGGGCTN--LIDGSGHKCSCLYGY 871          

HSP 2 Score: 108.227 bits (269), Expect = 1.006e-23
Identity = 179/612 (29.25%), Postives = 254/612 (41.50%), Query Frame = 0
Query:  596 SAYCKCDSGYEGDDCSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMD-ETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTC-TDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELME---DSC--------------------------------MDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPC-GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECLCETGFA----LSEILP---NTCE------------------------------DINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLK-DECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLC-VDKNECTIN---NGGCQHACINKLGGHTCSCHLGFKPD--EKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNG 1120
            + Y   D GY GD+C +++E E +   C +   C +   +  C C  GF  ++ E    D +     NGG    C N    ++C C PGF    + L C  ++N+C          G+C +   +F C+C+PG+  +L E   D C                                   NEC  S  C +G C +  G Y C CD G+   N     INEC  +PC  +G CI+   GY C C SGY        D +EC  D PC  G  C N+   + C C PGYE K    +++NE   + +PC   G C+ +  S+ C+C  GF  +  +SNI    D+C   PC +S  C + + GF+C+C   +      SE+ P   ++C                               DI+EC          CVN  GS+ C+C EG+   E  +C L  D+C  S   NGG    C++   G KC C     VD     LC  D NEC  N   NG   H  +N    +TC C +GF     + N E C  +   S  NGG     K  +   ++ C+CP G+      R C+     C   P  +NG
Sbjct:    9 ATYAAGDKGYGGDNC-ELDEDECKSFPCQNGGICTDDVNNYKCQCVEGFTGVNCEKTINDCERYPCLNGG---TCRNSIIAYKCDCLPGF----EGLNCERNKNDCKGEPCK---NGECFDGTDAFTCKCYPGYTGQLCEHEIDQCEPSPCKHGGRCERHANGFKCNCPLGTWGQRCEEQKNECY-SNPCYNGKCEDGFGIYTCICDPGFSGVNCE-TPINECKSSPCENNGLCIDLIAGYKCDCPSGYYGPRCT-SDVNECSPD-PCLNGATCENEFNDYVCRCQPGYEGKRCE-YEVNE--CKSNPCQHGGKCLTHFNSYSCICPSGFTGNNCESNI----DDCRLFPCKNSGLCIDQVDGFKCICSAPYTGKTCESEMNPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFKGRYCSVDIDECLTYPCHNGASCVNTEGSYECKCEEGF---EGRDCLLNIDDCASSPCVNGG---TCLDETAGFKCLC-----VDGFGGNLCEEDINECASNPCKNGAICHEYVNS---YTCECKIGFSGTNCQTNDEDCTAS---SCMNGG-----KCIDGVNNYTCVCPRGYS----GRNCQTRINPCDKNPCQNNG 572          

HSP 3 Score: 104.76 bits (260), Expect = 1.055e-22
Identity = 198/672 (29.46%), Postives = 277/672 (41.22%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVD-INEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQ-LSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGY--ELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDI-NECETQDLICDHNCINTEGSAHCTCKAGFDLMD-ETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCT-DENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGH-GECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGK-CNNKPGSFDCDCAPGYEFKNGXCH-DINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTC-EDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDE-CRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLC-VDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCV---KAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKT 1099
            D DEC   P     ICT+    Y C C  GFT  G  C   IN+C     LN G       C+N    Y+C+C  LPG + L+ + N      E C+      + EC    +   C C  GY  +L E      +I++C     +   +C        C C  G  G  C +  NEC +     +  C +  G   C C  GF  ++ ET   +      +N G   +C +L   ++C C  G++       CT D NEC+     C     C N    + C C PG+E       ++NEC ++     G C     +Y C C SG+  +N    +I++C   PC + G CI++  G+ C C + Y      C       +++ C   G  C   P   D  C+    FK   C  DI+E      PC     CVN +GS+EC C +GF       +  ++ D+C SSPC +   C +   GF+CLC  GF       N C EDINECA N      +C   + S+ C C  G+      NC   DE C  S   NGG    CI+      C C  GY   +   R+   DKN C  NNG C     N       SCH       +N ++ V   +  A    NG C       +SG  + C+C  G+  K 
Sbjct:   26 DEDECKSFPCQNGGICTDDVNNYKCQCVEGFT--GVNCEKTINDCERYPCLNGG------TCRNSIIAYKCDC--LPGFEGLNCERNKNDCKGEPCK------NGECFDGTDAFTCKCYPGYTGQLCEH-----EIDQCEPSPCKHGGRCERHANGFKCNCPLGTWGQRCEEQKNECYSNPCY-NGKCEDGFGIYTCICDPGFSGVNCETPINECKSSPCENNG---LCIDLIAGYKCDCPSGYY----GPRCTSDVNECSPDP--CLNGATCENEFNDYVCRCQPGYEGKRCE-YEVNECKSNPCQHGGKCLTHFNSYSCICPSGFTGNNCE-SNIDDCRLFPCKNSGLCIDQVDGFKCICSAPY--TGKTCESEMNPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFKGRYCSVDIDECLTY--PCHNGASCVNTEGSYECKCEEGF----EGRDCLLNIDDCASSPCVNGGTCLDETAGFKCLCVDGFG-----GNLCEEDINECASNPCKNGAICHEYVNSYTCECKIGFSGT---NCQTNDEDCTASSCMNGG---KCIDGVNNYTCVCPRGYSGRNCQTRINPCDKNPCQ-NNGTCVDGGYNDY-----SCHCSSGWTGRNCDRLVDWCQQGASPCENGRC------YQSGTSYNCVCEDGWTGKV 633          

HSP 4 Score: 101.293 bits (251), Expect = 1.234e-21
Identity = 190/728 (26.10%), Postives = 288/728 (39.56%), Query Frame = 0
Query:  432 TCECHDGFFLNDDGECE-DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDE--CKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGF--DLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF-----ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCL-DINECIRNPCGHGECINESPGYSCSCHSGY--------------------VDVDNVCRDYDECLHD--------------------------NPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCE-DINECALNN------GDCSQV----------------------------------CVNIL--GSHYCRCYEGYKKDERGNC-FLKDECRLSRRPNGGCQQLCI-NIPGGLKCECNPGYIVD--SQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
             C C  G+   +   CE +V+EC  +P      C     +Y C C  GFT       +I++C L     PC++   C +   G++C C      +  + + + C ++ +C  N   C       Y   FC CP G++     + C VDI+EC+T        C+N  GS  CKC+ G+EG DC  +I++C +   +    C++      C C  GF  +L +E    D +EC  +      +C+    ++ C CK GF         T++ +CT   ++C   G CI+   ++ C C  G+     +   + C D N C N+  C  G  N+    Y C C SG+   N   L D  +   +PC +G C      Y+C C  G+                    VDV ++C +   C  +                          +PC  G  C +  G++ C C  G++  N    + N    + +PC   G C +    F+C C  G +    + NI    +ECL   C H   C + +GG+EC C  GF     +   CE DINEC  +        DC Q+                                  C N++    H C C  GY      NC F    C+ +   +GG    C+ +  GG  C C PG       QD R     NEC  N   CQ   CI+K+G + C C+  F
Sbjct:  275 VCRCQPGY---EGKRCEYEVNECKSNPCQHGGKCLTHFNSYSCICPSGFTGNNCE-SNIDDCRLF----PCKNSGLCIDQVDGFKCICSAPYTGKTCESEMNPC-NEHSCAANGAVCKP--TPDYKDYFCSCPLGFK----GRYCSVDIDECLTYPCHNGASCVNTEGSYECKCEEGFEGRDCLLNIDDCASSPCVNGGTCLDETAGFKCLCVDGFGGNLCEE----DINECASNPCKNGAICHEYVNSYTCECKIGFSGTNCQ---TNDEDCTA--SSCMNGGKCIDGVNNYTCVCPRGYSGRNCQTRINPC-DKNPCQNNGTCVDGGYND----YSCHCSSGWTGRNCDRLVDWCQQGASPCENGRCYQSGTSYNCVCEDGWTGKVCDVRKVSCRIAAKLRSVDVSDLCLNGGRCRDEWNSHVCECQDGFYGSXCQYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGHN---CEFNIDECDPNPCQNEGVCHDLIDGFQCTCPYGTVGKLCEFNI----NECLEGTCHHGGTCIDKIGGYECQCRPGF-----VGQRCEGDINECLTSRCSPYGTQDCIQLTNAYKCQCKPDYMGKYCETKKNFCESSPCENGGGCTNLIDGSGHKCSCLYGYSGQ---NCEFYGSVCQSNPCRHGG---TCLEHSGGGFTCVCPPGTTGSFCEQDTR-----NECAYNP--CQKGYCIDKIGDYDCFCNPRF 948          

HSP 5 Score: 75.485 bits (184), Expect = 1.017e-13
Identity = 163/598 (27.26%), Postives = 259/598 (43.31%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACV-DINECLLN---NGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL------DEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDC-SDINECETQDLICDHNCINTEGSAH-CTCKAGFDLMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFH---LNTDNLTCTDENEC-TIGIAN-CGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPC-GHGECINESPGYSCSCHSGYVDVDNVCR-DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHG--DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTL--GGFECLCETGFALS--EILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYI---VDSQDP 1016
            D+DEC+  P      C N  G+Y C C  GF  +G  C+ +I++C  +   NG G C DE      G++C C    G  L ++D + C S+      NG   HE ++SY    C C  G+        DED       + C+ G      KC++   +  C C  GY G +C + IN C+      +  C++   + + C C +G+   +     D   C+     CE   C     ++ C C+ G+     +   ++C    +  ++ +++ C   G C +   S  CEC  GF          +EC +S      SC ++ GTY C+C  G+  HN    +I+EC  NPC   G C +   G+ C+C   Y  V  +C  + +ECL +  C  GG C +K G ++C C PG+  +     DINE    +  C P+G  DC+    +++C C   ++    ++      + C SSPC +   C N +   G +C C  G++    E   + C+  N C  + G C +   +  G   C C  G         F + + R     N   +  CI+  G   C CNP ++    D  DP
Sbjct:  407 DIDECLTYPCHNGASCVNTEGSYECKCEEGF--EGRDCLLNIDDCASSPCVNG-GTCLDE----TAGFKCLCVDGFGGNLCEEDINECASNP---CKNGAICHEYVNSYT---CECKIGFSGTNCQTNDED----CTASSCMNG-----GKCIDGVNNYTCVCPRGYSGRNCQTRINPCDKNPCQNNGTCVDGGYNDYSCHCSSGWTGRNCDRLVDW--CQQGASPCENGRCYQSGTSYNCVCEDGWTGKVCDVRKVSCRIAAKLRSVDVSDLCLNGGRCRDEWNSHVCECQDGF-YGSXCQYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGHNCE-FNIDECDPNPCQNEGVCHDLIDGFQCTCP--YGTVGKLCEFNINECL-EGTCHHGGTCIDKIGGYECQCRPGFVGQRCE-GDINECLTSR--CSPYGTQDCIQLTNAYKCQCKPDYMGKYCETKK----NFCESSPCENGGGCTNLIDGSGHKCSCLYGYSGQNCEFYGSVCQS-NPCR-HGGTCLE---HSGGGFTCVCPPGTTGS-----FCEQDTRNECAYNPCQKGYCIDKIGDYDCFCNPRFVGKNCDISDP 958          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000008732 (pep:novel supercontig:LSalAtl2s:LSalAtl2s542:459239:479456:-1 gene:EMLSAG00000008732 transcript:EMLSAT00000008732 description:"maker-LSalAtl2s542-augustus-gene-4.8")

HSP 1 Score: 108.612 bits (270), Expect = 1.118e-23
Identity = 157/559 (28.09%), Postives = 233/559 (41.68%), Query Frame = 0
Query:  431 PTCECHDGFFLNDDGECE-DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVD-INECLLNNGHGPCQDE--CKNVDGG--YQCEC-GGLPGTQLSDK----DNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSD-INECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEM----DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPG----SFYCECHPGFELMEDSC-MDINECTNST--LCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGHG-ECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRC 962
            P C C  GF  N    CE D+DEC  +P      C +KP  + C C  G+   G  C+D I++C  N    PC D   CKN  G   + C C  G  G + +       ++ C +D  C+    G          +  C C  G+E       C VD N+C         KC ++     C C SG+ G  C + ++ C+  D I +  C++      C C +G+         + ++C +    +NG C    N+    F C C+PGF             +C   +  C I   C N        F+C+C PGF  +  +C   I+EC  +   L G+  C +L+  ++C+C  G  F    C ++ N+CI NPC +G  C++E  GY CSC SG+    N  +D   C    PC     C N    F C C  G + K   C    E  +  +PC   G C +      C C   +           +FD C    C H S C +    +EC+C  G+       N  E+IN+C   +   S  C++++   YCRC
Sbjct: 2007 PKCFCPSGFSGNS---CEIDIDECESNPCYNGGTCFDKPQGFTCKCPEGYL--GHQCMDEISDCDSN----PCPDRAMCKNEAGXGIFSCLCRDGYEGERCNSVVDPCQSNPCFNDATCKTLEQG----------RFTCQCMPGWE----GSLCEVDSNDCAXQPCLLGAKCKDLVNDFLCDCPSGFSGKRCEEKVDLCKNSDCI-NGKCVDMLFRYECHCNSGWS--GPMCNININDCTVSPCKNNGQCIDDIND----FNCVCEPGF----------TGKKCQHTVDYC-ISHPCQNGGSYKGEGFFCDCRPGF--LGLTCEAAIDECAANLCDLSGTAKCIDLDNEFKCECRDG--FEGEKCQINSNDCIENPCLNGGTCLDEINGYKCSCLSGWTG-GNCEKDIGYC-DSQPCQNDATCVNLFQDFFCVCPSGTDGK--FCETAPERCI-GNPCVNGGFCRDFGSGLNCSCPSSY----TGIGCQYEFDACAEDSCQHGSTCIDNGKEYECICSPGYNGK----NCEENINDCTPGSCPPSSTCIDLIDDFYCRC 2507          

HSP 2 Score: 105.145 bits (261), Expect = 1.493e-22
Identity = 136/495 (27.47%), Postives = 213/495 (43.03%), Query Frame = 0
Query:  533 ISDEACQ--------VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSD-INECETQDLICDHNCINTEGSA--HCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLE-GTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMD-INECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPC-GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCH-DINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY 1009
            IS ++CQ          NGG    C+   ++  C CP G+  +    +C +DI+EC +        C + P    CKC  GY G  C D I++C++        C N  G     C C+ G++   E      D C+ +    +  C  LE G F C C PG+     +L   D N+C      C +   C +    F C+C  GF      C + ++ C NS  C +G C ++   YEC C+SG+      C ++IN+C  +PC  +G+CI++   ++C C  G+      C+   +    +PC  GG  + K   F CDC PG  F    C   I+E +           C++ D  F+C C  GF  ++      I+ ++C+ +PC +   C + + G++C C +G+       N  +DI  C          CVN+    +C C  G   D +      + C  +   NGG    C +   GL C C   Y
Sbjct: 1979 ISKDSCQEVKCMPNICENGGL---CVPVNHRPKCFCPSGFSGN----SCEIDIDECESNPCYNGGTCFDKPQGFTCKCPEGYLGHQCMDEISDCDSNPCPDRAMCKNEAGXGIFSCLCRDGYE--GERCNSVVDPCQSNPCFNDATCKTLEQGRFTCQCMPGWE---GSLCEVDSNDC--AXQPCLLGAKCKDLVNDFLCDCPSGFS--GKRCEEKVDLCKNSD-CINGKCVDMLFRYECHCNSGW--SGPMCNININDCTVSPCKNNGQCIDDINDFNCVCEPGF--TGKKCQHTVDYCISHPCQNGG--SYKGEGFFCDCRPG--FLGLTCEAAIDECAANLCDLSGTAKCIDLDNEFKCECRDGFEGEKCQ----INSNDCIENPCLNGGTCLDEINGYKCSCLSGWTGG----NCEKDIGYCDSQPCQNDATCVNLFQDFFCVCPSG--TDGKFCETAPERCIGNPCVNGG---FCRDFGSGLNCSCPSSY 2435          

HSP 3 Score: 71.633 bits (174), Expect = 1.795e-12
Identity = 87/286 (30.42%), Postives = 120/286 (41.96%), Query Frame = 0
Query:  776 ECIRNPCGHGEC---INESPGYSCSCHSGYVDVDNVCR-DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGS--FECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTL--GGFECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLK-DECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF 1051
            +C+ N C +G     +N  P   C C SG+    N C  D DEC   NPC  GG C +KP  F C C  GY      C D      + +PC     C N  G   F C+C  G+  ++ +S +    D C S+PCF+     TL  G F C C  G+  S      CE D N+CA         C +++    C C  G+       C  K D C+ S   NG C  +        +C CN G+      P   ++ N+CT++       CI+ +    C C  GF
Sbjct: 1988 KCMPNICENGGLCVPVNHRP--KCFCPSGFSG--NSCEIDIDEC-ESNPCYNGGTCFDKPQGFTCKCPEGY--LGHQCMD-EISDCDSNPCPDRAMCKNEAGXGIFSCLCRDGYEGERCNSVV----DPCQSNPCFNDATCKTLEQGRFTCQCMPGWEGS-----LCEVDSNDCAXQPCLLGAKCKDLVNDFLCDCPSGFSGKR---CEEKVDLCKNSDCINGKCVDMLFR----YECHCNSGW----SGPMCNININDCTVSPCKNNGQCIDDINDFNCVCEPGF 2245          

HSP 4 Score: 65.4698 bits (158), Expect = 1.469e-10
Identity = 118/468 (25.21%), Postives = 185/468 (39.53%), Query Frame = 0
Query:  560 CPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDET---ECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTP--GSFYC-ECHPGFELME------DSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGH-GECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGS--FDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVN-NDGSFECVCHQGFIHDQNDSNIC-IDFDECLSSPC-FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY 1009
            CP G+   E  + C+  ++    D     +C   P   + + +      DC           +C +   +  G   C  +  ++    T   E F   EC        Q C     TFQ G +      T    C        G+A C         P  G   C ECH   E ++      DSC ++ +C  +     G C  +    +C C SG+   NS  +DI+EC  NPC + G C ++  G++C C  GY  + + C D       NPC     C N+ G   F C C  GYE +   C+ + +   + +PC     C     G F C C  G+     + ++C +D ++C   PC   ++CK+ +  F C C +GF+        CE+  +   N+   +  CV++L  + C C  G+      N  + D C +S   N G    CI+      C C PG+
Sbjct: 1823 CPAGFFAAEGRRICIPCSKGEYQDSARQGQCKKCPHGQWTEEEGSKNKSDCLP---------VCGYGTYSPSGLVPCL-ECPYNSYSSTPPPEGF--KEC--------QACPENHFTFQSGTQNSKDCRTK---CIQGTYSVTGLAPCAPCPQHFFQPLSGQNQCFECHTTEETLQKGMISKDSCQEV-KCMPNICENGGLCVPVNHRPKCFCPSGFS-GNSCEIDIDECESNPCYNGGTCFDKPQGFTCKCPEGY--LGHQCMDEISDCDSNPCPDRAMCKNEAGXGIFSCLCRDGYEGER--CNSVVD-PCQSNPCFNDATCKTLEQGRFTCQCMPGW-----EGSLCEVDSNDCAXQPCLLGAKCKDLVNDFLCDCPSGFSGKR-----CEEKVDLCKNSDCINGKCVDMLFRYECHCNSGW-SGPMCNININD-CTVSPCKNNG---QCIDDINDFNCVCEPGF 2245          

HSP 5 Score: 58.5362 bits (140), Expect = 1.939e-8
Identity = 34/95 (35.79%), Postives = 49/95 (51.58%), Query Frame = 0
Query: 1317 CQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVM--ASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDS 1409
            CQ+L   KD IPP+V+ CP   I +++       + W+EP F DN+K+  V+      PG     G + + Y A D  GN  +C F I +  LDS
Sbjct: 2752 CQIL--EKDKIPPSVEYCPPGDI-WVATSNGTAYVHWDEPLFNDNVKVDQVINVEGLKPGQALQWGTYNVAYVAYDEAGNTAQCSFKIYV--LDS 2841          

HSP 6 Score: 57.7658 bits (138), Expect = 3.211e-8
Identity = 44/147 (29.93%), Postives = 66/147 (44.90%), Query Frame = 0
Query: 1019 CVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTG 1165
            C D+NEC  NNGGC H C+N  GG+TC C +G+                 + NG  +    ++E+G+        G   + + +TC P   +C +   P NG    N+++V  Y   G + K KC  G+   G     C + G W G
Sbjct:  974 CNDENECLSNNGGCGHKCLNNPGGYTCMCKIGYD--------------LFIKNGTSNLYIPASETGIR------DGDTYQIN-KTCVP--KMCPNIEEPENGIIL-NRREVYRY---GDEIKFKCNFGYNLIGGSILFCSSGGLWNG 1093          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000004441 (pep:novel supercontig:LSalAtl2s:LSalAtl2s231:582105:629669:-1 gene:EMLSAG00000004441 transcript:EMLSAT00000004441 description:"maker-LSalAtl2s231-augustus-gene-6.9")

HSP 1 Score: 97.8265 bits (242), Expect = 1.981e-20
Identity = 159/559 (28.44%), Postives = 224/559 (40.07%), Query Frame = 0
Query:  540 VNNGGCS-HECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDH--NCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNN----LEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF-----ELMEDSCMDINECTNSTLC--GSGSCNNLEGTYECKCDSGYI-FHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLH--DNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-----------------------SECKNTLGGFECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCEC-NPGYI-------VDSQDPRLCVDKNECT--INNGGCQHACINKLGGHTCS 1046
            +N G CS +E    +N   C C  G+E D+    C  ++ C     +CLN       +  C C SGYEG +C+ DINEC + + IC+    C N  G   C C+ G+             CE   G     C N       T  C C  GF  N   L  +  N        C   G+C +T     C C  GF     E     C   N C N  +C   SG+ ++    Y C+C   Y+  +  T +D    I  P G   C++++  + C C +G+  VD    + DEC    DNPC  GG C ++ G + C C  G E  N    DI+E S+ ++ C  HG C N  GS+ C C  GF  +       ++FDECLS PC +                       + C + +  F C C  GF         CE +INEC +     S + + I+           +  E  N FL    + S   NGG    C++      C C + G+        +D   P  CV+   CT  IN+  C   C    GG  C+
Sbjct:  460 LNGGLCSPNETDRGFN---CSCAPGFEGDD----CSLVSPCGG---ECLNDGTCDEVTNTCVCASGYEGLNCATDINECSSDENICNQKGTCQNYNGGYRCICEEGWS---------GSNCESSLGCSSLPCKNDGTCSSETGYCVCPEGFSGNFCELI-SRSNSGHCNPNPCQNAGNCTSTETGALCSCAEGFGGPTCENSASPCYPSNSCKNGAICIPTSGTLSSGAEPYTCECSPEYVGLYCETKIDNCTGIVCPPGR-VCMDKAGTHQCVCPTGFKGVD-CAENIDECGEGDDNPCLYGGTCIDEVGKYSCKCTSGREGDNCE-EDIDECSILQNICN-HGICKNTAGSYTCYCRPGFTGNH----CSLEFDECLSHPCKNGGSCRQNCEINIDECASKPCENDALCIDGINNFTCSCNPGFT-----GRICETNINECEV-----SSILLIIIN------MAXIQXXEPTNAFLH-PFQXSPCVNGG---QCVDKINAYVCNCTDTGFEGPECQINIDECAPGPCVNNATCTDGINDYACN--CFEGYGGKNCA 968          

HSP 2 Score: 85.5001 bits (210), Expect = 1.032e-16
Identity = 119/441 (26.98%), Postives = 181/441 (41.04%), Query Frame = 0
Query:  558 CLCPDGYELDEDWKTCVDINECVTGDIQ-CL--NKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHN-CINTEGSAHCTCKAGFD----LMDETECFD---------KDECEMDNGGC-------EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKC-DSGYIFHNSTC-LDINECIRNPC-GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXS----LEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGY 966
            C+CP G++         +I+EC  GD   CL    C++  G   CKC SG EGD+C  DI+EC     IC+H  C NT GS  C C+ GF      ++  EC           +  CE++   C       + +C +    F C C PGF   T  +  T+ NEC +      I    IN             +  E +   ++    S     G C +    Y C C D+G  F    C ++I+EC   PC  +  C +    Y+C+C  GY    N   D  ECL + PC  G  C              +E  N   + + E      ++  P         +   + C C  G+  D  + NI    +EC+SSPC + EC++ +  + C+C  G+       N  E+I+EC   +      C + +  ++C C  G+
Sbjct:  711 CVCPTGFK---GVDCAENIDECGEGDDNPCLYGGTCIDEVGKYSCKCTSGREGDNCEEDIDECSILQNICNHGICKNTAGSYTCYCRPGFTGNHCSLEFDECLSHPCKNGGSCRQNCEINIDECASKPCENDALCIDGINNFTCSCNPGF---TGRICETNINECEVS----SILLIIINMAX---------IQXXEPTNAFLHPFQXSPCVNGGQCVDKINAYVCNCTDTG--FEGPECQINIDECAPGPCVNNATCTDGINDYACNCFEGYGG-KNCAIDISECL-ETPCHNGALC--------------FEKSNQSLYSMTELVDALPIDVLPVFDKNFSYFDASGYVCSCMSGYEGDNCEVNI----NECVSSPCRNGECQDGIAEYICVCSPGYEGK----NCEEEIDECERFSPCQHGSCEDGVADYFCDCEXGW 1106          

HSP 3 Score: 80.8777 bits (198), Expect = 2.996e-15
Identity = 131/491 (26.68%), Postives = 195/491 (39.71%), Query Frame = 0
Query:  568 EDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQ---DLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ--VCNNLEGTFQCGCKPGFH-------LNTDNLTCTDENECTIGIANC-------GIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGV----GGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKD--PCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLK-DECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLC-VDKNECTINN 1029
            E   +C D N C+ G +   N+         C C  G+EGDDCS ++ C  +   D  CD      E +  C C +G++ ++     D +EC  D   C Q   C N  G ++C C+ G+        L   +L C ++  C+     C       G + + I+   S +C  +P        C +   CT++      SC    G   C+  +   + +++C +   CI      G   + +  Y+C C   YV +      Y E   DN  G+    G  C +K G+  C C  G  FK   C +  +   E D  PC   G C++  G + C C  G   D  +     D DEC  L + C H  CKNT G + C C  GF             N C+L   +C         SH C+         R NC +  DEC      N     LCI+      C CNPG+       R+C  + NEC +++
Sbjct:  448 ETTPSCPDPNPCLNGGLCSPNE---TDRGFNCSCAPGFEGDDCSLVSPCGGECLNDGTCD------EVTNTCVCASGYEGLNCAT--DINECSSDENICNQKGTCQNYNGGYRCICEEGWSGSNCESSLGCSSLPCKNDGTCSSETGYCVCPEGFSGNFCELISRSNSGHCNPNP--------CQNAGNCTSTETGALCSCAEGFGGPTCENSASPCYPSNSCKNGAICIPT---SGTLSSGAEPYTCECSPEYVGL------YCETKIDNCTGIVCPPGRVCMDKAGTHQCVCPTG--FKGVDCAENIDECGEGDDNPCLYGGTCIDEVGKYSCKCTSGREGDNCEE----DIDECSILQNICNHGICKNTAGSYTCYCRPGFTG-----------NHCSLEFDECL--------SHPCK----NGGSCRQNCEINIDECASKPCEN---DALCIDGINNFTCSCNPGFT-----GRICETNINECEVSS 873          

HSP 4 Score: 69.3218 bits (168), Expect = 8.547e-12
Identity = 128/458 (27.95%), Postives = 182/458 (39.74%), Query Frame = 0
Query:  425 LDKGVTPTCECHDGFFLNDDGECEDVDECV---DDPELCDHICTNKPGTYMCDCRLGFTSQGTACV-DINEC-LLNN--GHGPCQDECKNVDGGYQCECG-GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDC-SDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLT---CTDENECTIGI-------------ANCGI-YGDCINTPGSFYCECHPG---FELMEDSCMDINECTNS-------TLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN 846
            +DK  T  C C  GF   D  E  ++DEC    D+P L    C ++ G Y C C  G   +G  C  DI+EC +L N   HG C    KN  G Y C C  G  G   S + +  C+S   C+ N G C   C                        ++I+EC +   +    C++   +  C C+ G+ G  C ++INECE   ++     +        T  A       + C +  +C         VCN  +  F+    P   +N D      C +   CT GI              NC I   +C+ TP      CH G   FE    S   + E  ++           + S  +  G Y C C SGY   N   ++INEC+ +PC +GEC +    Y C C  GY +  N   + DEC   +PC   G C +    + CDC  G+  KN
Sbjct:  703 MDKAGTHQCVCPTGFKGVDCAE--NIDECGEGDDNPCLYGGTCIDEVGKYSCKCTSG--REGDNCEEDIDECSILQNICNHGIC----KNTAGSYTCYCRPGFTGNHCSLEFDE-CLS-HPCK-NGGSCRQNCE-----------------------INIDECASKPCENDALCIDGINNFTCSCNPGFTGRICETNINECEVSSILLIIINMAXIQXXEPT-NAFLHPFQXSPCVNGGQCVDKINA--YVCNCTDTGFE---GPECQINIDECAPGPCVNNATCTDGINDYACNCFEGYGGKNCAIDISECLETP------CHNGALCFEKSNQSLYSMTELVDALPIDVLPVFDKNFSYFDASG-YVCSCMSGYEGDNCE-VNINECVSSPCRNGECQDGIAEYICVCSPGY-EGKNCEEEIDECERFSPC-QHGSCEDGVADYFCDCEXGWGGKN 1110          

HSP 5 Score: 63.5438 bits (153), Expect = 4.737e-10
Identity = 45/126 (35.71%), Postives = 68/126 (53.97%), Query Frame = 0
Query:  747 GSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVC-RDYDECLHDNPCGVGGKCNNK--PGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDC 868
            GSC N    +EC+C  G  F + TC  +I+EC+ N C +G C++    Y+C+C+SG+     +C  D DEC   +PC  GG C     PG + C+C   YE  +  C ++   + E++PC   G C
Sbjct: 1949 GSCANPSEVFECECPKG--FKDPTCRTNIDECVENSCQNGLCVDGVANYTCACNSGWAGW--LCDTDIDEC-ELSPCQNGGTCTQTAIPGDYSCNCLDDYEGHD--CEELKIKTCEQEPCQNGGTC 2067          

HSP 6 Score: 61.2326 bits (147), Expect = 2.445e-9
Identity = 81/283 (28.62%), Postives = 125/283 (44.17%), Query Frame = 0
Query:  793 GYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFD-----CDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-------SQVCVNILGSHYCRCYEGYK----KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLK-------CECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK 1052
            G++CSC  G+        + D+C   +PCG  G+C N  G+ D     C CA GYE  N    DINE S +++ C   G C N +G + C+C +G+     +S++      C S PC +    ++  G+ C+C  GF+      N CE I+    N+G C       +  C +      C C EG+     ++    C+  + C+     NG    +CI   G L        CEC+P Y+    + ++    + CT         C++K G H C C  GFK
Sbjct:  473 GFNCSCAPGF--------EGDDCSLVSPCG--GECLND-GTCDEVTNTCVCASGYEGLN-CATDINECSSDENICNQKGTCQNYNGGYRCICEEGWSGSNCESSL-----GCSSLPCKNDGTCSSETGY-CVCPEGFS-----GNFCELISRS--NSGHCNPNPCQNAGNCTSTETGALCSCAEGFGGPTCENSASPCYPSNSCK-----NGA---ICIPTSGTLSSGAEPYTCECSPEYVGLYCETKI----DNCTGIVCPPGRVCMDKAGTHQCVCPTGFK 718          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000009873 (pep:novel supercontig:LSalAtl2s:LSalAtl2s641:175569:241875:1 gene:EMLSAG00000009873 transcript:EMLSAT00000009873 description:"maker-LSalAtl2s641-augustus-gene-1.18")

HSP 1 Score: 90.5077 bits (223), Expect = 3.367e-18
Identity = 120/483 (24.84%), Postives = 179/483 (37.06%), Query Frame = 0
Query: 1085 LHHRCM--CPSGFKLK--TDARTCKPIGGICSSAPR-----------PSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEW----KRIR---VNPPKCNPTFNRPQIHCPPD-MIEPLPRDSKSVYVFIPKPRT--NVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDN-IKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELK-RFIPDCSPV-HKSQLKSNCDAGWEYRSDEGI 1539
            +H  C   C SG+ L   +  R C P G    + P            P NG  +C     S   +  ++C++ C KG+   G   R C+    W+G   + C+ + C  L     G + P TC       G +C FTC++G+++ G    +C     W    KR R   + P         P I CP D  IE L      V +   KP    N  +E  V+  P     ++ ++   K    F+  +         C  +I V+D  PP V  C    + +L+  +  + + W+EP F DN +K   V  S   G  F  G   + Y A+D  GN   C+  ITL +      ++P                                           NG  NC +    Q GI C   C  GY       S    Y CN +   W+ K    PDCS V H S + ++    +E   +EG+
Sbjct:  315 VHEACAFECRSGYSLSGGSALRVCLPNGTWSGNQPECKPKRCKNLSTPRNGKVKC----ASSSNIVDSECQITCNKGYRLIGSKRRVCLPISLWSGLPSY-CKPLKCHRLRRPSFGQVYPVTCQRQKQLFGRRCAFTCHSGFKLLGPALRKCVAPGMWDGGSKRSRCIDITP---------PSIKCPEDTAIETLQGKHYGVLLNFSKPIVDDNSGYEPNVEMYPAVTSFMKLKIGINK----FKYVASDVSGNKNRCTTVISVRDEEPPVVDVCSSPPV-FLTQNE-WENVEWDEPIFHDNSLKELQVTKSRDFGR-FDIGTTIVHYTATDTFGNVATCDVEITLLKHFCSVPDDPI------------------------------------------NGHSNCTD---QQRGIYCTMSCSDGYALAM---SSIQDYECNYREGIWKPKIEPFPDCSIVSHASLVVASGVLTFETSLEEGL 728          

HSP 2 Score: 64.3142 bits (155), Expect = 3.098e-10
Identity = 75/260 (28.85%), Postives = 114/260 (43.85%), Query Frame = 0
Query:  770 TCLDINECIRNPCGHGE-CINESPGYSCSCHSGYVDVDNVC-RDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCH-DINEXSLEKDP---CGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRC---YEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCI---------NIPGGLKCECNPGY 1009
            + L +N+C  +PC     C   + G+ C C +G+     +C +  D CL  NPC  GG C++    + C CA G  FK   C  D+NE   E+DP   C   G C N  G ++C C +GF       +  ++ + C +  CF+   C+N      CLC  GF+       + E I+   +N G C    ++I     C C   +EG+  + E  +C    +C      NGG    C+          +P   KCEC P +
Sbjct: 1057 SILYMNDCFSSPCSLDSICRPLTFGFQCVCSTGFTGT--LCDKKMDGCL-SNPCNNGGICSHNEERYSCKCAKG--FKGVNCELDVNE--CEEDPSNICANEGTCTNEFGDYQCTCQEGF----TGKHCLVNLNNCHTQGCFNGGTCQND--SVSCLCPHGFSGQFCEVESTECISSPCINGGSC----MSIDDGFRCLCPLQFEGHLCETEVRDCRFDFKCL-----NGGS---CVATETLLEEEGLPTNYKCECGPDF 1291          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000011664 (pep:novel supercontig:LSalAtl2s:LSalAtl2s80:828712:850785:-1 gene:EMLSAG00000011664 transcript:EMLSAT00000011664 description:"maker-LSalAtl2s80-snap-gene-8.46")

HSP 1 Score: 84.3445 bits (207), Expect = 2.789e-16
Identity = 85/262 (32.44%), Postives = 118/262 (45.04%), Query Frame = 0
Query:  558 CLCPDGYELDEDWKTCV-DINECVTGDIQC----LNKCMNVPGSAYCK-CDSGYEGDD--CSDINECETQDLICDH----NCINTEGSAHC-TCKAGFDLMDETECFDKDECEMDNGGCEQVCNNL--EGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGHGE-CINESPGYSCSCHSGY 802
            C+C  G++ D     CV D+NEC      C    L +C+N PGS  C+ C SGY G+   C DINEC   +  C      +CINT+GS  C  C  G+    +T C     C ++NGGC  +   L   G  QC C+PG+            N   IG   C         PG+      PG     +S   ++ C +S       C  +   + C C  GY    STC ++INEC  NPC +G  CI+ +  + C C+ G+
Sbjct:  246 CICQQGWKTDGVNPACVVDVNECNGPISPCSKDPLVQCINTPGSFSCQSCPSGYSGNGFYCQDINECLNNNGGCSRSPSVDCINTKGSFRCGECPIGYQGNGQT-CAFMGPCHINNGGCSPMAXCLVSSGIVQCFCRPGY------------NGMGIGPMGC--------LPGASQYPNLPGPSGGGESTPALSPCISSPCQHDSVCIPMANGFICNCVPGYT--GSTCSIEINECDSNPCFNGATCIDMNNDFRCVCNEGF 484          

HSP 2 Score: 73.9442 bits (180), Expect = 4.444e-13
Identity = 77/256 (30.08%), Postives = 118/256 (46.09%), Query Frame = 0
Query:  772 LDINECIRNPCGHG-ECINESPGYSCSCHSGYVDVDNVCRD-YDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFE---CVCHQGFIHDQNDSNICIDFDECLS--SPCFHS---ECKNTLGGFECL-CETGFALSEILPNTCEDINECALNNGDCSQV----CVNILGSHYC-RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL--CINIPGGLKCECNPGY 1009
            ++ + C   PC +G +CIN   G  C C   +    N C D  +EC+      +G    ++ G+ + DC+ G                 ++ CG HG C++  G  +   C+C QG+  D  +    +D +EC    SPC      +C NT G F C  C +G++ +      C+DINEC  NNG CS+     C+N  GS  C  C  GY+ + +  C     C ++   NGGC  +  C+   G ++C C PGY
Sbjct:  154 MNRDHCANAPCRNGGKCINTFQGPVCQCSDNWEG--NTCEDDINECIRFTGTDLGYVIVHQNGTRNDDCSSG---------------TNEEICG-HGTCIDQPGGSKGHTCICQQGWKTDGVNPACVVDVNECNGPISPCSKDPLVQCINTPGSFSCQSCPSGYSGNGFY---CQDINECLNNNGGCSRSPSVDCINTKGSFRCGECPIGYQGNGQ-TCAFMGPCHIN---NGGCSPMAXCLVSSGIVQCFCRPGY 384          

HSP 3 Score: 72.7886 bits (177), Expect = 9.794e-13
Identity = 92/324 (28.40%), Postives = 123/324 (37.96%), Query Frame = 0
Query:  428 GVTPTCECHDGFFLNDDGECED-VDECVDDPELCDHICTNKPGTYMCD-CRLGFTSQGTACVDINECLLNNG---HGPCQDECKNVDGGYQC-ECG-GLPGTQLSDKDNHTCISDEACQVNNGGCS--HECIHSYNQIFCLCPDGYE---------------------LDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCE 720
            GV P C       + D  EC   +  C  DP +    C N PG++ C  C  G++  G  C DINECL NNG     P  D C N  G ++C EC  G  G      +  TC     C +NNGGCS    C+ S   + C C  GY                           ++   ++ C++   Q  + C+ +     C C  GY G  CS +INEC++        CI+      C C  G         F    CE +   C     N EG+       G  L    L CT + + T+      I    IN   SF CE
Sbjct:  256 GVNPAC-------VVDVNECNGPISPCSKDPLVQ---CINTPGSFSCQSCPSGYSGNGFYCQDINECLNNNGGCSRSPSVD-CINTKGSFRCGECPIGYQG------NGQTCAFMGPCHINNGGCSPMAXCLVSSGIVQCFCRPGYNGMGIGPMGCLPGASQYPNLPGPSGGGESTPALSPCISSPCQHDSVCIPMANGFICNCVPGYTGSTCSIEINECDSNPCFNGATCIDMNNDFRCVCNEG---------FKGSNCEEEVESCGGTYQNEEGSIVFPPSQG-DLYNHELDCTFDIQ-TVFSKVLNITFHSINIEDSFNCE 551          

HSP 4 Score: 59.6918 bits (143), Expect = 7.190e-9
Identity = 102/381 (26.77%), Postives = 136/381 (35.70%), Query Frame = 0
Query:  733 MDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCL-DINECIR---------------------------NPCGHGECINE---SPGYSCSCHSGYVDVDNV----CRDYDECLHD-NPCGVGG--KCNNKPGSFDCD-CAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFEC-LCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRC-----YEGYKKDERGNCFLKDECRLSRRPNGG--------------CQQ--LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK 1052
            M+ + C N+     G C N      C+C   +    +TC  DINECIR                             CGHG CI++   S G++C C  G+   D V      D +EC    +PC      +C N PGSF C  C  GY      C DINE             C+NN+G                         C  SP    +C NT G F C  C  G+  +     TC  +  C +NNG CS +   ++ S   +C     Y G      G      +      P+GG              CQ   +CI +  G  C C PGY   +      ++ NEC  N       CI+      C C+ GFK
Sbjct:  154 MNRDHCANAPCRNGGKCINTFQGPVCQCSDNW--EGNTCEDDINECIRFTGTDLGYVIVHQNGTRNDDCSSGTNEEICGHGTCIDQPGGSKGHTCICQQGW-KTDGVNPACVVDVNECNGPISPCSKDPLVQCINTPGSFSCQSCPSGYSGNGFYCQDINE-------------CLNNNGG------------------------CSRSPSV--DCINTKGSFRCGECPIGYQGNG---QTCAFMGPCHINNGGCSPMAXCLVSSGIVQCFCRPGYNGMGIGPMGCLPGASQYPNLPGPSGGGESTPALSPCISSPCQHDSVCIPMANGFICNCVPGYTGST----CSIEINECDSNPCFNGATCIDMNNDFRCVCNEGFK 485          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000003434 (pep:novel supercontig:LSalAtl2s:LSalAtl2s188:577956:580566:1 gene:EMLSAG00000003434 transcript:EMLSAT00000003434 description:"snap_masked-LSalAtl2s188-processed-gene-6.21")

HSP 1 Score: 76.2554 bits (186), Expect = 8.392e-15
Identity = 107/326 (32.82%), Postives = 144/326 (44.17%), Query Frame = 0
Query:  599 CKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETEC---FDKDECEMDNGGC-EQVCNN----LEGT--FQCGCKPGFHLNTDNLTCT-DENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKC---DSGYIFHNSTCLDINECIRNPCGHGECINE----SPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHD-INEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIH--DQNDSNICIDFDECLSSP 903
            C C+ G+ G +C      ETQ   C  N    E    CT K G D   E  C   F    CE++   C   +C N    ++G   + C C P +      + CT D NEC +    C     C N  G + C C  G+   ++   D+++C        G C++    Y+C+C    +G + H    LD + C+ NPC +GE I E    S  Y+CSC  G         D DEC   +PC   G C N PGSF CDC  G  FK   C + INE   +  PC  HG C++  G + C+C  G I   DQN     +D   CL SP
Sbjct:   11 CMCNPGFTGKNC------ETQYYPCSPN--PCEYGGRCT-KVG-DYEYECTCPKGFKGRRCEINLDDCGRHLCENNSTCVDGVNNYSCKCPPEYT----GIYCTKDVNECELKDKPCQNGATCTNEDGGYSCICVNGYA-GKNCETDVDDCALXPCLNGGXCHDRVSDYDCECPVGKTGLLCH----LD-DLCVNNPC-NGEAICETSMVSGNYACSCPKGRTGPKCD-EDIDECAEGSPCEHEGTCVNTPGSFRCDCKKG--FKGLRCEENINE--CDTSPCINHGTCIDERGGYRCICMPGKIQLTDQNYIFFLVD-RSCLLSP 309          

HSP 2 Score: 66.6254 bits (161), Expect = 1.135e-11
Identity = 96/310 (30.97%), Postives = 134/310 (43.23%), Query Frame = 0
Query:  670 LEGTFQCGCKPGF---HLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINEC--IRNPCGHGE-CINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNN--DGSFECVCHQGFIHDQNDSNICIDFDECL-SSPCFH-SECKNTLGGFECLCETGFALSEILPNTCEDINEC----ALNNGDCSQVCVNILGSHYCRCYEG 965
            LE    C C PGF   +  T    C+  N C  G   C   GD       + C C  GF+      +++++C       + +C +    Y CKC   Y     T  D+NEC     PC +G  C NE  GYSC C +GY    N   D D+C    PC  GG C+++   +DC+C  G   K G    +++  +  +PC     C  +   G++ C C +G    + D     D DEC   SPC H   C NT G F C C+ GF          E+INEC     +N+G     C++  G + C C  G
Sbjct:    5 LELLMVCMCNPGFTGKNCETQYYPCS-PNPCEYG-GRCTKVGD-----YEYECTCPKGFKGRRCE-INLDDCGRHLCENNSTCVDGVNNYSCKCPPEYTGIYCT-KDVNECELKDKPCQNGATCTNEDGGYSCICVNGYAG-KNCETDVDDCAL-XPCLNGGXCHDRVSDYDCECPVG---KTGLLCHLDDLCV-NNPCNGEAICETSMVSGNYACSCPKGRTGPKCDE----DIDECAEGSPCEHEGTCVNTPGSFRCDCKKGFKGLRCE----ENINECDTSPCINHG----TCIDERGGYRCICMPG 287          

HSP 3 Score: 51.6026 bits (122), Expect = 8.775e-7
Identity = 70/218 (32.11%), Postives = 93/218 (42.66%), Query Frame = 0
Query:  448 EDVDEC--VDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLN---NGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQI----FCLCPDGY---ELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSD-INECETQDLICDHNCINTEGSAHCTCKAG-FDLMDETECF 651
            +DV+EC   D P      CTN+ G Y C C  G+  +     D+++C L    NG G C D   +    Y CEC          K    C  D+ C VNN  C+ E I   + +     C CP G    + DED   C + + C          C+N PGS  C C  G++G  C + INEC+T   I    CI+  G   C C  G   L D+   F
Sbjct:  101 KDVNECELKDKPCQNGATCTNEDGGYSCICVNGYAGKNCE-TDVDDCALXPCLNG-GXCHDRVSD----YDCEC-------PVGKTGLLCHLDDLC-VNNP-CNGEAICETSMVSGNYACSCPKGRTGPKCDEDIDECAEGSPCEH-----EGTCVNTPGSFRCDCKKGFKGLRCEENINECDTSPCINHGTCIDERGGYRCICMPGKIQLTDQNYIF 298          
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Match: EMLSAP00000008650 (pep:novel supercontig:LSalAtl2s:LSalAtl2s534:330167:366744:1 gene:EMLSAG00000008650 transcript:EMLSAT00000008650 description:"maker-LSalAtl2s534-augustus-gene-2.23")

HSP 1 Score: 75.8702 bits (185), Expect = 7.294e-14
Identity = 82/272 (30.15%), Postives = 113/272 (41.54%), Query Frame = 0
Query:  560 CPDGYELDEDWKTC--VDINECVTG-DIQCLNKCMNVPGSAYCKCDSGYEGD--DCSDINECE----------TQDLICDHN---CINTEGSAHCTCKAGFDLMDET-------ECFDKDECEMDNGGCEQVCNNLEGT----FQCGCKPGFH---LNTDNLTC----------------------------TDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS-------CMDINEC-TNSTLCG-SGSCNNLEGTYECKCDS 762
            CP   ++ E  K C     + C  G D     KC+N+     C C  G+ G+  +C DI+EC+           +   C  N   C+NT GS  CTCK G++  ++         C  K+ C++ NG C      L       F+C CK GF    L T +  C                             D +ECT G   CG    CIN PG +YC+C  G    +D        C+D NEC   S  C  S +C N++G+YECKCD+
Sbjct:  441 CPPEDQILEHGKCCKVCKADHCAQGNDCHSHAKCINLSTKYRCVCPHGFVGNGKNCEDIDECQRLGDSIDFPFLKGHYCTGNHSICVNTLGSYTCTCKEGYEKANDNTDSDYGFHCKRKNICDIKNGPCHANATCLATLSPDGFECQCKEGFSGDGLRTCSPKCDEGCENGSTCAEPGICLCTAGFKGRQCELDIDECTEGFNRCGGEARCINKPGWYYCQCRSGXRTBQDPLSNSQTICIDENECEMGSHSCHPSMTCINVDGSYECKCDA 712          

HSP 2 Score: 65.855 bits (159), Expect = 7.347e-11
Identity = 93/328 (28.35%), Postives = 128/328 (39.02%), Query Frame = 0
Query:  780 NPCGHGECINESPGYSCSCHSGYVD-------------VD--------------NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPC-----------GPHGDCVNNDGSFECVCHQGF--IHDQNDS---------NICIDFDECLSSPCF-HSECKNTLG--GFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLK-DECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDP-----RLCVDKNECTINNGGCQ--HACINKLGGHTCSC 1047
            N   HGE  + S   +CSC +G +              +D               VC+  D C   N C    KC N    + C C  G+      C DI+E     D             G H  CVN  GS+ C C +G+   +D  DS         NIC    +  + PC  ++ C  TL   GFEC C+ GF+  + L       +E   N   C++  +       C C  G+K  +   C L  DEC       GG +  CIN PG   C+C  G   + QDP      +C+D+NEC + +  C     CIN  G + C C
Sbjct:  401 NKYSHGESFSPSLCLTCSCDNGKLACLRENTSKNPCPVLDCPPEDQILEHGKCCKVCK-ADHCAQGNDCHSHAKCINLSTKYRCVCPHGFVGNGKNCEDIDECQRLGDSIDFPFLKGHYCTGNHSICVNTLGSYTCTCKEGYEKANDNTDSDYGFHCKRKNIC----DIKNGPCHANATCLATLSPDGFECQCKEGFS-GDGLRTCSPKCDEGCENGSTCAEPGI-------CLCTAGFKGRQ---CELDIDECTEGFNRCGG-EARCINKPGWYYCQCRSGXRTB-QDPLSNSQTICIDENECEMGSHSCHPSMTCINVDGSYECKC 710          

HSP 3 Score: 65.0846 bits (157), Expect = 1.576e-10
Identity = 80/250 (32.00%), Postives = 104/250 (41.60%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDEC------VDDPELCDH-------ICTNKPGTYMCDCRLGF--------TSQGTACVDINECLLNNGHGPCQDECKNVD----GGYQCECG-GLPGTQLSDKDNHTCIS--DEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLN--KCMNVPGSAYCKCDSGYEGDD---------CSDINECETQDLIC--DHNCINTEGSAHCTCKA 640
            C C  GF  N    CED+DEC      +D P L  H       IC N  G+Y C C+ G+        +  G  C   N C + N  GPC      +      G++C+C  G  G  L      TC    DE C+ N   C+   I       CLC  G++     + C +DI+EC  G  +C    +C+N PG  YC+C SG   +          C D NECE     C     CIN +GS  C C A
Sbjct:  483 CVCPHGFVGNGKN-CEDIDECQRLGDSIDFPFLKGHYCTGNHSICVNTLGSYTCTCKEGYEKANDNTDSDYGFHCKRKNICDIKN--GPCHANATCLATLSPDGFECQCKEGFSGDGL-----RTCSPKCDEGCE-NGSTCAEPGI-------CLCTAGFK----GRQCELDIDECTEGFNRCGGEARCINKPGWYYCQCRSGXRTBQDPLSNSQTICIDENECEMGSHSCHPSMTCINVDGSYECKCDA 712          

HSP 4 Score: 62.3882 bits (150), Expect = 1.089e-9
Identity = 77/260 (29.62%), Postives = 103/260 (39.62%), Query Frame = 0
Query:  784 HGECINESPGYSCSCHSGYVDVDNVCRDYDEC-----------LHDNPC-GVGGKCNNKPGSFDCDCAPGYEFKNGX--------CHDINEXSLEKDPCGPHGDCVNN---DGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFE---CLCETGFALSEILPNTCE-DINECALNNGDC--SQVCVNILGSHYCRCYEGYKKDE------RGNCFLKDECRLSRRPNGGCQ--QLCINIPGGLKCECN 1006
            H +CIN S  Y C C  G+V     C D DEC           L  + C G    C N  GS+ C C  GYE  N          C   N   ++  PC  +  C+     DG FEC C +GF  D            C  SP     C+N     E   CLC  GF   +     CE DI+EC      C     C+N  G +YC+C  G + ++      +  C  ++EC +       C     CIN+ G  +C+C+
Sbjct:  471 HAKCINLSTKYRCVCPHGFVGNGKNCEDIDECQRLGDSIDFPFLKGHYCTGNHSICVNTLGSYTCTCKEGYEKANDNTDSDYGFHCKRKNICDIKNGPCHANATCLATLSPDG-FECQCKEGFSGD--------GLRTC--SPKCDEGCENGSTCAEPGICLCTAGFKGRQ-----CELDIDECTEGFNRCGGEARCINKPGWYYCQCRSGXRTBQDPLSNSQTICIDENECEMGSH---SCHPSMTCINVDGSYECKCD 711          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|296439346|sp|Q75N90.3|FBN3_HUMAN (RecName: Full=Fibrillin-3; Contains: RecName: Full=Fibrillin-3 C-terminal peptide; Flags: Precursor)

HSP 1 Score: 261.922 bits (668), Expect = 6.168e-69
Identity = 216/632 (34.18%), Postives = 297/632 (46.99%), Query Frame = 0
Query:  435 CHDGFFLNDDGECEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFT--SQGTACVDIN--ECLLNNGHGPCQDECK-NVDGGYQ-----CECGGLPGTQ---------------------------LSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINEC-VTGDIQCLNKCMNVPGSAYCKCDSGYEG-----DDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDLMDE-TECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNV--CRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDE-RGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCEC 1005
            C  GF       C+DV+EC   P +C +  C N  G++ C+C  G    + G  CVD+    C L       +DEC   + G Y+     C  G + G +                           LS +  +  +++  C+V  G C+H  C ++     C C  G+ LD   + C DI+EC ++ D+     C+N PGS  C+C  GYE       +C D++EC    L+C    C NT+GS  C C  G +L  + T C D DEC + +G C    C N+ G FQC C  GF    D   C D NEC +    C ++  CINT GS+ C C  G+ LM D  +C D++EC  N  +C  G C N+ G + C C  G++      TC+D++EC  NP  C HG+C N    + C C  GY+       C D DEC +  + C     C N PGSF C C PG+      CHD++E   ++  C P GDC+N  GS+ C C QGF     D   C D DEC  +   C + +C N  GG+ C CE GF  +E     C+D++ECA  N      C N+ G   C C  GY+ D   GNC   +EC     P      +CIN PG   C C
Sbjct:  855 CARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWD----EDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNE--CKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFA---GDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDH-RACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINEC---ADPVNCINGVCINTPGSYLCSC 1471          

HSP 2 Score: 235.343 bits (599), Expect = 7.586e-61
Identity = 189/584 (32.36%), Postives = 274/584 (46.92%), Query Frame = 0
Query:  448 EDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE-----GDDCSDINECETQ-DLICDHNCINTEGSAHCTCKAGFDLMDE-TECFDKDECEMDNGGCEQVCNNLEGTFQCGCK--------------------PGF--------HLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI-RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHG---DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            EDV+EC ++P +C + +C N  G++ C+C  G++    G  CVD +EC +  GH   Q  C NV GG++C C  G  PG  +      TC   + C +N   C+  C ++     C CP GY L ED   C D++EC  G   C  +   C N+ G+  C C  G       G+ C+D NEC  Q DL  +  C+NT GS  C C  GF      TEC D  +        + +C +L  + +   +                    PG         H +       D +EC + +A+   +G+CIN+ GSF C C  G+  +    +C+D++EC+      +  C N +G++ C C  GY+      TC D++EC  R       C+N    ++C C  G+      C D DEC     PCG  G C+N PGSF C+C  G+   +    C D+NE        GPH     C N  G + C C QGF      +  C+D +EC  SP  C  + C+NTLGGF C+C +GF   + L   C++++ECA   G CS  C N  G   C C +GY +  +G+C 
Sbjct: 2083 EDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSV--GHPCGQGTCTNVIGGFECACADGFEPGLMM------TCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRM-LAHLCAHGECINSLGSFRCHCQAGYTPDATATTCLDMDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD------GPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQ-CVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQAL-GGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGYFRAGQGHCV 2649          

HSP 3 Score: 231.876 bits (590), Expect = 1.035e-59
Identity = 250/783 (31.93%), Postives = 335/783 (42.78%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQGT--ACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECET-----QDLICDHNCINTEGSAHCTCK---AGFD---------------------LMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDI-----------NECIRNPCG---HGEC---INESPGYSC-------SCHSGYVDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEX----SLEKDPCGP-------HGDCVNNDGS----------------FECVCHQGFIHDQND----SNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD--ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            CEC+ G+  +  GEC DVDEC   P  C H  C N PGTY C C  GF +  T  ACVD++EC+++ G   C    C N +G +QC C    G +LS  D   C+    C  +    +  C++      CLC  G+ L      C+DI+EC T  I     C N  GS  C+C  G     +G  C D +   T     +   C      T   + C C     GF                      L   T+  D +EC +D   C   VC NL G+++C C  G+        CTD +EC +    C   G C N+PGS+ C C PGF   +D+  C D++EC +S  C SG C NL G+Y CKC  G     S   CLD            + C  N  G     EC   +  + G  C       +C  G+  +  V C D +EC         G+C N  GSF C+C  G         C D+         ++D CG           C  + G+                F  +C +G      D         D +EC   P  C H  C+NT+G F C C  GFAL     N C DI+EC ++   C Q  CVN  GS  C C+ GY+       NC   DEC  +R P       C N  G  KC+C PG+ + ++    C D +EC++++G C H  C+N +G   CSCH GF+  PD +    CV    C V NGGC   C +TE    +RC C  G+ L  D R C  +
Sbjct:  433 CECNVGYTQDVRGECIDVDECTSSP--CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGL--CHLGRCVNTEGSFQCVCNA--GFELS-PDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCD-NGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSP-CVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERN-CTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDEC--ARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKG-TACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQG---CVDINECRVQNGGCDVHCINTEG--SYRCSCGQGYSLMPDGRACADV 1197          

HSP 4 Score: 231.106 bits (588), Expect = 1.529e-59
Identity = 252/797 (31.62%), Postives = 344/797 (43.16%), Query Frame = 0
Query:  402 ADPSRPSCDPDVQEKKRCEHICYLDKGVTP----TCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEA-----CQVNNGGCSH---------ECI-----HSYNQIFCLCP------------DGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTD-----------ENECTIGIANCGIYGDCINTPGSFY------CE----CHPGFELMED-SCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECIRNPC----GHGECINESPGY----SCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHI-CKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            A P+R +C  DV E      +C+L + V       C C+ GF L+ DG+ C D +EC       + +C N+ G++ C C+ GF     G  C+DI+EC    +  NGH      C N +G ++C+C GGL        D   C+           +  G C+          EC      H + +   LCP             G  +  D +   DINEC      C N  C N+ GS  C C+ GYE    G DC+D++EC    L+CD+  C N+ GS  C+C  GF    +TE C D DEC + +     VC NL G++ C C PG  L+     C D           E+ C + +    +  +C  T G+ +      CE    C  GF  M   +C D+NEC +   +C +G C N  G++ C+C  G +   S   C+D+      PC       EC    PG      C C  G V       + + C           C    G    D   G  F      D+NE  +    C  HG C N  GSF C C  GF  D  + N C D DEC  SP  C    C NT G FEC C  G+    +L   C D++ECA +   C    C N  GS+ C+C  G++   +G  C   DEC LS   +G C    C+N+ G  +C C+ G+   + D + CVD NEC + NGGC   CIN  G + CSC  G+   PD +    C     C  N   C    C +   G  HRC+C  GF    D RTC  +
Sbjct:  480 ATPTRQAC-VDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGH------CTNTEGSFRCQCLGGL----AVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGR---DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDEC-LSSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVR---LEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWG----VECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYK----DVNECKVFPGLC-THGTCRNTVGSFHCACAGGFALDAQERN-CTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLS---DGLCPHGQCVNVIGAFQCSCHAGF-QSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGR---ACADVDECEENPRVCDQGHCTNMPGG--HRCLCYDGFMATPDMRTCVDV 1239          

HSP 5 Score: 227.639 bits (579), Expect = 1.773e-58
Identity = 244/770 (31.69%), Postives = 327/770 (42.47%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTACVDINEC-----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEAC----QVNNGGCSHECIHSYNQIFC---------------------------LCPDGYEL---DEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYG-DCINTPGSFYCECHPGFELMEDS---CMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFD----CDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC-SHICKSTESGLHHRCMCPSGFKLKTDARTCKPIG------GICSSAPRPSNGYYRCNKKKVSGYFVKG 1136
            C C DGF L  DG+ C D +EC+     C    C N  G++ C C  GF  Q   C+DI+EC     L   G       C N  G +QC C   PG  LSD + H C          +   G CS     +  +  C                           LCP G+      +D +   D+NEC      C N  C+N  GS  C+C  GY     G +C D +EC          C N  G   C C  GF+      C D DEC ++   C   C+N EG++ C C  G+ L  D   C D +EC  G  +C   G +C N  G+F C C PG   +  S   C D NEC     LC +G C N  G++ C CD G+    +   C DI +        G C  E       C S     + V R    C      G   +    PG+      C    GY  +     D++E  +    C  HG+C+N+ GSF C C  G+  D   +  C+D DEC  +  PC    CKNT G F C C  G+ L E    TC+D++EC     +C  +CVN +G+  CRC  G+ +  +  CF  DEC     P G     C N PG  +CEC+ G+ + S     C D NEC   +  CQH C N+LGG+ CSC  GF        +CV    C+++   C S  C++T  G   RC+CPSGF        C+ +       G CS +   + G + C   +  GYF  G
Sbjct: 1912 CLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFG------TCTNSPGSFQCLC--PPGFVLSD-NGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSRE--DVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQ--------GPCFAEV--LQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEG---RDVDECRMLAHLCA-HGECINSLGSFRCHCQAGYTPDAT-ATTCLDMDECSQVPKPCTFL-CKNTKGSFLCSCPRGYLLEED-GRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQA-CFDNDECSAQPGPCGA-HGHCHNTPGSFRCECHQGFTLVSSG-HGCEDVNECDGPH-RCQHGCQNQLGGYRCSCPQGFT-QHSQWAQCVDENECALSPPTCGSASCRNTLGGF--RCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQ--GYFRAG 2644          

HSP 6 Score: 219.164 bits (557), Expect = 7.526e-56
Identity = 247/772 (31.99%), Postives = 328/772 (42.49%), Query Frame = 0
Query:  410 DPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPC-QDECKNVDGGYQCECGGLPGTQLS-------DKDNHTC---ISDEACQVNNGGCS--HECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDL---------MDETECF---DKDECEMDNGG------------------CEQVCNNLEGTFQCGCKPGFHLNTDNLTC-----TDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECTNST-LCGSGSCNNLEGTYECKCDSGY---IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV-CVNILGSHYCRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGC--QHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            DP+V     CE++    +G +  C C+ G+     G +C DVDEC  +  LCD+  C N PG+Y C C  GF        C D++ECL +    PC    C+N+ G Y C+CG  PG++L        D    TC   I +  C+VN  G S   EC  +          G       + C     C  G  +                     G  C D+NECE+   +C +  C+NT GS  C C  G  L         +    CF   D+DEC +   G                  CE   +     F   C  G    + +         D NEC +    C  +G C NT GSF+C C  GF L   E +C DI+EC  S  LCG G+C N  G++EC+C  GY         C+D++EC R+P  C  G C N    Y C C  G+        C D DEC L D  C   G+C N  G+F C C  G++       C DINE  ++   C  H  C+N +GS+ C C QG+     D   C D DEC  +P  C    C N  GG  CLC  GF  +  +  TC D++EC LN   C    C N  GS  C C  GY  +K   G C   DEC +    N      C+NIPG   C C PG++ D  +   C D +EC      C  +  C+N  G + C+C  GF  D      C     C+ N   C +  C +   G  +RC C  GF    D R C+ +
Sbjct:  689 DPEVCANGVCENL----RG-SYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSS----PCVSGVCRNLAGSYTCKCG--PGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATL---------GAAWGSPCERCEIDPACARGFAR-------------------MTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLC-THGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVH--CINTEGSYRCSCGQGY-SLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDM-RTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATG-CSDVDECEVGGH-NCDSHASCLNIPGSFSCRCLPGWVGDGFE---CHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGF---FCEDRDECAENVDLCDNGQCLNAPGG--YRCECEMGFDPTEDHRACQDV 1405          

HSP 7 Score: 215.698 bits (548), Expect = 7.795e-55
Identity = 227/723 (31.40%), Postives = 309/723 (42.74%), Query Frame = 0
Query:  432 TCECHDGFFLNDDGECEDVDECVDDPELCDHI--CTNKPGTYMCDCRLGFTSQGTACVDINEC-----LLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINE----CETQD-----LICDHNCINTEGSAHCTCKAGFDLMDETECF----------------------------DKDECEMDNGGCEQV-CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME--DSCMDINECTNSTLCG---SGSCNN-------------------------------LEGTYECKCDS---GYI--FHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSG--YVDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQV--CVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGC-QQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            +C C  G+ + D  EC D+DECV     C     C N PG+Y C CR GF   G  C D +EC     L +NG      +C N  GGY+CEC  G   T+    D+  C   + C   N      C +      C+C  GYELD     C DINEC    + C+N  C+N PGS  C C   +E    G  C D        ET D     + C          A C C  G    +  E                              D DEC+   G C+   C N  G+FQC C PG+HL+     C D +EC+     CG  G C NT G++ C C   +  +   ++CMD+ +    ++C    +G+C N                               +   Y+  C +   G++   H    LDI+EC   P  C +G CIN+   + C C +G  Y  +   C D DEC   ++PC     C N PGS+ C C  GY+    G C   NE     + C  HGDC++ +GS+ C+CH+GF     D  +C+D DEC   PC +  CKN +G + CLC  GF ++      C D +EC    G   +   C+N  GS +C C +G++    G NC   +EC LS    G C    C N+ G  +C C PG+ V S     C+D +EC+     C    C N  G   C C  GF
Sbjct: 1305 SCRCLPGW-VGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNG------QCLNAPGGYRCECEMGFDPTE----DHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECAD-PVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGP-GTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRK----SVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVCS-HGDCMDTEGSYMCLCHRGF-QASADQTLCMDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTH--NGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNEC-LSLA--GTCLPGTCQNLEGSFRCICPPGFQVQSDH---CIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGF 2000          

HSP 8 Score: 214.542 bits (545), Expect = 1.656e-54
Identity = 219/711 (30.80%), Postives = 307/711 (43.18%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHI-CTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLS------DKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDET-ECFDKDEC----EMDNGGCE--QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHG-DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLK----CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C+C  G+ L+  G C   +EC + P +C H  C +  G+YMC C  GF +    T C+DI+EC       PC +  CKN+ G Y C C   PG  ++      D D  T +  + C+  +      C+++     CLC DG+EL  D K CVD NEC++    CL   C N+ GS  C C  G+  + D C DI+EC  +  +C    C N+ GS  C C  GF L D    CFD  +       + G C   +  N  +    C  +PG         C  E   +        +G             H      +DS  D+NEC  N  +C +G C N +G++ C+C  GY   F    C+D +EC + +PCG G C N   G+ C+C  G+   +   C D DEC   NP     +C+N  GS+ C C  GY  +     C D++E +  +  C   G +C N  G+F CVC  G          C D +EC + P  C +  C NT G F C C+ GF  S  L   C DI +     G C    +  +        E   + E              R  G   +LC  +PG       C    GY  + +      D +EC +    C H  CIN LG   C C  G+ PD      C+    CS     C+ +CK+T+      C CP G+ L+ D RTCK +
Sbjct: 1789 CKCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQ----PCGNGTCKNIIGSYNCLC--FPGFVVTHNGDCVDFDECTTLVGQVCRFGH------CLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEG--SAAFQELCPFG-------------HGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDEC-SLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTL-TECHDIRQ-----GPCFAEVLQTMCRSLSSSSEAVTRAECCC--------GGGRGWGPRCELC-PLPGTSAYRKLCPHGSGYTAEGR------DVDECRMLAHLCAHGECINSLGSFRCHCQAGYTPD-ATATTCLDMDECSQVPKPCTFLCKNTKGSF--LCSCPRGYLLEEDGRTCKDL 2447          

HSP 9 Score: 187.193 bits (474), Expect = 4.312e-46
Identity = 229/757 (30.25%), Postives = 308/757 (40.69%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVD--INECLLNN--------------GHGPCQDECKNVDG---GYQCECGGL----------PGTQLSDKDNHTCISDEA--CQVNNGGC-SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGY----EGDDCSDINE----------CETQDLI--------CDHNC--------------INTEGSAHCTCKAGFDLMD--ETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME-DSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNV-CRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIP--GGLK----CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFK 1096
            C C+ G+ L+   G C D++EC D     + +C N PG+Y+C C   F     G  CVD     C L                G G  +  C    G   G  CE   +          PG +    +  T I ++   CQ   G C   +C++++    C CP GY L E  + C DI+EC T    C    C N  G+  C C + Y     G++C D+ +          C+ +           C +N               I+ +    C  +A   L D    +  D DEC      C   +C N  G+F+C C  GF+ N+  L C D +EC    + C    DCIN PGS+ C+C  G++L    +C+  NEC     +C  G C + EG+Y C C  G+      + C+DI+EC R PCG+G C N    Y+C C  G+V   N  C D+DEC  L    C   G C N  GSF C C  G+E       C D NE       C P G C N +GSF C+C  GF   Q  S+ CID DEC   P  C    C N+ G F+CLC  GF LS+   + C D  +           C     +  C   + +          K  C  S+RP  G    C   P  G       C    G +    D R   D NEC  N G C +  C+N  G   C C  G+  D      CV    CSV +      C +   G    C C  GF+
Sbjct: 1428 CICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRF-GHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLP-GTCQNLEGSFRCICPPGF---QVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDN-GHRCFDTRQ---------SFCFTRFEAGKCSVPKAFNT-------TKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSR--EDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTG-INCVDTDECSVGHPCGQGTCTNVIGGF--ECACADGFE 2157          

HSP 10 Score: 114.775 bits (286), Expect = 4.096e-24
Identity = 134/481 (27.86%), Postives = 194/481 (40.33%), Query Frame = 0
Query:  741 STLCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNGGCQQLCINIPGGLKCE----CNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKC 1203
            + LC +G C     +Y C+C+ GY       C+D++EC  +PC HG+C+N    Y C C+ G+        C D DEC+        G+C N  GSF C C  G+E       C D NE +        +G C+N DGSF C+C  GF+      + C+D DEC +   C +  C NT G F C C  G A+                  G   +VCV+      C     Y   E+G+C         K EC     P+ G  + C   P     E    C+ G  + + D R   D NEC ++   C +  C N  G + C C+LG++      + C     C++N+  C +       G  + C CP GF    D   CK +   C S+P  S        + ++G +     CK        P+G           W   ++  CEV        L   ++  E C T  +  GS C
Sbjct:  416 TNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTMC--VNGVCLNEDGSFSCLCKPGFLLAPG-GHYCMDIDECQTPGICVNGHCTNTEGSFRCQCLGGLAV------------------GTDGRVCVDTHVRSTC-----YGAIEKGSCARPFPGTVTKSEC-CCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGI-TTDGR---DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASG-KDCTDVDECALNSLLCDNGWCQNSPG-SYSCSCPPGFHFWQDTEICKDV-DECLSSPCVSG-----VCRNLAGSYT----CKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVN-------LQGASLRSECCATLGAAWGSPC 846          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|1042782301|sp|Q61554.2|FBN1_MOUSE (RecName: Full=Fibrillin-1; Contains: RecName: Full=Asprosin; Flags: Precursor)

HSP 1 Score: 261.151 bits (666), Expect = 9.842e-69
Identity = 237/705 (33.62%), Postives = 327/705 (46.38%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINE----------------------------CLLNNGHG---PCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGV---GGKCNNKP----GSFDCDCAPGYE----------------------FKNGXCHDINEXSLEKDPCGP-----HGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            C C  G++LN+D   C+DV+EC + P +C    C N  G Y C C   +   + G  C+D+                              C  N G     PC+         +   CG      + D      +  + C+   G C +  CI+      C CP G+  ++    C DI+EC  G +   N +C+N  GS  C C  GY       C+D NEC+    IC H  CI+T GS +C C  GF   +D+T C D +ECE D  G    C N  G+F C C  GF L+ +N  C D +EC  G  N    G C+NT GSF C C+ G+E+  D  +C+DINEC  +   C  G+C NL+G+Y C C  GY   N  C DI+EC+  P  C  G C N    + C C  G+        C+D    L  + C     GGKC++         +C CA   E                      F +G     ++ +++ D C       HG C+N DGS+ C C  G+I + N+   C+D DEC + +PC +  CKN +GGFEC CE GF    ++  TCEDINECA N   C+  CVN  GS+ C+C  GY  +++R  C  +DEC   +      Q  C N+ G   C C PGY     D   C+D+NEC    G C++  C+N LG +TC C+ GF
Sbjct: 1633 CRCPTGYYLNEDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNN-DCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQD----LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMM--TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGY-QRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGF 2324          

HSP 2 Score: 240.736 bits (613), Expect = 1.658e-62
Identity = 229/648 (35.34%), Postives = 308/648 (47.53%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQ-QLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSC 1047
            C C  GF L+ ++  C D+DEC   P+LC    C N PG + C C  G+ S       C+DI+EC    LL  G       C N +G Y+CEC   PG QLS  +   CI    C+++   C H  C++   +  C C  GY    D   CVDI+EC   +  C   C N  GS  C C  G+    +   C+DI+ECE    ICD   C N  G   C C  GF   ++ + C D +EC+++   C    C N +G+F C C  G+        CTD NEC IG  NCG +  C NT GSF C C PG+      C D++EC+N T +C     C N  G+Y C C  GY     TC D++EC    N CG+G+C+N   GY C C  G+V   +   C D DEC   N C V G C+N PG F C+C  GYE     G C D+NE  L+   C   G+CVN  GS+ C C   F  + N + + C+D     S  C+     +   G   C  E G  +S+   + C     C+L    G   ++C ++  S Y   C   EG++ +      L+D       P G CQ   CIN  G  +C C  GY ++ +D R+C D NEC          C N +G +TC C
Sbjct: 1055 CRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRG-----GICHNTEGSYRCEC--PPGHQLS-PNISACIDINECELSANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNIC-VFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-CLDPTTC-ISGNCVNTPGSYTCDCPPDF--ELNPTRVGCVDT---RSGNCYLDIRPRGDNGDTACSNEIGVGVSKA--SCC-----CSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPI-TVILEDIDECQELP-GLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCIC 1676          

HSP 3 Score: 237.269 bits (604), Expect = 2.425e-61
Identity = 208/608 (34.21%), Postives = 289/608 (47.53%), Query Frame = 0
Query:  426 DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLM-DETECFD--------------------------KDECEMDNGG-----CEQVCNNLEGTFQ----CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            D+     C    G  +  D    D+DEC  +P++C H  C N  G+Y C+C  G+  +G  CVD +EC + N   PC +  CKNV GG++C C  G  PG  +      TC     C  N   C+  C+++Y    C CP GY L ED + C D +EC  G   C  K   C N+ G+  C C  GY+    G+ C D NEC+T+  IC++  C+NT GS  C C  GF     + EC D                          K EC  D G      CE +C   EGT      C    GF  N       D +EC + I +    G+C+N  GS++C C  G+  ++   +C+D+NEC  +    +  C N EG+Y+C C  GYI      +C D++EC   ++ C    C+N   G++C C  G+      C D +EC  D N CG  G C N PGSF C+C  G+        C D++E   E +    HG C N  G + C C QG++      N C+D +ECLS+  C  + C NTLG ++C+C TGF   E     C+DINEC  +   CS  C N  G + C C  GY +  +G+C 
Sbjct: 2106 DEAFRQICPFGSGIIVGPDDSAVDMDEC-KEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGN---PCGNGTCKNVIGGFECTCEEGFEPGPMM------TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCE-IC-PFEGTVAYKKLCPHGRGFMTNG-----ADIDECKV-IHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHTACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDE--CEGNHRCQHG-CQNIIGGYRCSCPQGYLQ-HYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQY-EQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCV 2689          

HSP 4 Score: 225.713 bits (574), Expect = 6.569e-58
Identity = 270/836 (32.30%), Postives = 376/836 (44.98%), Query Frame = 0
Query:  369 YAF-DPSKPDTLFCSERRWIGKRPLCVAKSTLEIA--DPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLPGTQLSDKDNHTCIS-----------DEACQVNNGGCS--HECIHSYN----------QIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDIN-----------ECETQDLICDHN---CINTEGSAH-------------------CTCKAGFDLMDET--ECFDKD--ECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL--CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN----GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            YAF +P +P    C  +     + LC +   +  A  D +  + DPD+     CE++    +G T  C C+ G+ ++  G+ C D++ECV +  LCD+  C N PG+++C C  GF  +     C DI+EC       PC +  CKN  G + CEC   P + L D     CI            D  C++N  G +   EC  S            Q+  +C  G+   +  + C DINEC      C N  C+N  GS  C+C +G      G  C DI            EC T  +   H    C  + G+A                    C    GF   D T  + F KD  EC+M    C    C N  G+F+C C  GF L+++   CTD +EC I    CG  G C+NTPG F C+C  G+E   +M  +CMDI+EC  +  LC  G C+N EG+Y C+C  G+    + S C+DINEC    N C HG C+N    Y C+C+ GY    +   C D DEC   N  G    C N  GS++C C PG+        C DI+E     + C   G C N  G + C+C+ GF+  + D   C+D +EC  +P  C    C+NT G F C C+ G++  +     C DINEC +   +C +  VC N  GS  C C  G+  D    C   DEC         C Q   C N  G  +C C  GY   + D   C D +EC+ N   C +  C+N  GG+ C C +GF P   + + C     CS+ N    G C ++      GL  RC C  G++L      C  +
Sbjct:  692 YAFGEPCQP----CPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENL----RG-TYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECE----SSPCINGVCKNSPGSFICECS--PESTL-DPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQ-CEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEEC-TLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCG-RGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACIDINECELSANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIMNG-GCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASE-DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYS-GKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGI-KCTDLDECSNGTHM---CSQHADCKNTMGSYRCLCKDGY---TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVP-SADGKACEDIDECSLPNICVFGTCHNL-----PGL-FRCECEIGYELDRSGGNCTDV 1490          

HSP 5 Score: 224.557 bits (571), Expect = 1.627e-57
Identity = 241/792 (30.43%), Postives = 347/792 (43.81%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCP---DGY---------ELDEDWK---------------TCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-IYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLD------INECIRNPCGHGE-----------CINESPGYSCSCH----SGYVDVDNVC----------RDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS---ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP---------SNGYYRCNKKKVSGYFVKGTK 1138
            C C++G+ +  DG  C D++ECV DP  C    C N  G+Y C C  G++ Q   C DI+EC+           C N +G ++C C  G   +    +     +S    +   G CS     ++++  C C    +G+         E DE ++               + VD++EC   D+    +C+N  GS  C+C  GY  EG++C D +EC   +   +  C N  G   CTC+ GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C DE+EC  G  +C     +C N  G++ C C PG++   D   C+D NEC T   +C +G C N  G+Y C+C+ G+        CLD       +E ++N C  G            C +   G+   C      G V    +C           D DEC   +     G+C N  GS+ C C  GY  +     C D+NE +    PC  +  C N +GS++C C +G+I  Q D   C D DEC +    H+    C NT+GGF C C  GF         C D NEC  +   C    VC N  GS  C C  G+  D+ G +C   DEC  + R    CQ  C NI GG +C C  GY+   Q  + CVD+NEC   +     +C N LG + C C  GF+  E+    C     C  +   CS+ C +TE G  + C CP G+  +     C    G+    P P         S     C + K++GY  +G K
Sbjct: 1958 CRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECV-EEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPC--NFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQ--HNCQFLCVNTIGGFTCKCPPGFTQHHT---ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHR----CQHGCQNIIGGYRCSCPQGYLQHYQWNQ-CVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQY-EQFSGGCQDINECGSSQAPCSYGCSNTEGG--YLCGCPPGY-FRIGQGHCVSGMGMGRGGPEPPASSEMDDNSLSPEACYECKINGYPKRGRK 2731          

HSP 6 Score: 205.682 bits (522), Expect = 1.015e-51
Identity = 233/737 (31.61%), Postives = 328/737 (44.50%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT-SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCS-HECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTG-DIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQ--CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECL---HDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPC-FHSECKNTLGGFECLCETGFALS---EILP------------------NTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACS--VNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C H   +D   +  C CH GF  N D   C D++EC  D    +  C N  G++ C C  GF  S    C+D++EC   NG+     +C N  G +QC C    G +++  D  TC+    C ++ G C+   C +      C+CP GY L  D   C DI+ECV   +I  L  C N  GS  C C  G+     S    C  QDL   +     EG    + K+      E  C  K E   D   CE      +  F+  C    G  +  D+ +  D +EC     +   +G CINT GS+ CEC  G+ L  + C+D +EC+    CG+G+C N+ G +EC C+ G+      TC DINEC +NP  C    C+N    Y C C  GYV  ++  +C+D DEC    HD       +C N  G++ C C PGY+ +     C D NE   +   C  +G C+N  GS+ C C+ GF         C+D      F E L + C   S  +N +   EC C+ G       EI P                      DI+EC + +  C    CVN  GS++C C  GY  D  G  C   +EC  + +P   C  +C N  G  +C C  GYI+  +D R C D +EC      CQ  C+N +GG TC C  GF    ++   C+    C+  +N  G   +C++T       C C  GF L     +C+ +
Sbjct: 1862 CSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERD-ACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCN--EGYEVA-PDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQND--KCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLS--STGRRC--QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDP--CELCPTEPDEAFRQICPFGSGIIVGPDD-SAVDMDECK--EPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCT-EKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGIC-ENGRCLNTLGSYTCECNDGFTASPTQDE-CLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKP---CNFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFT---QHHTACIDNNECTSDINLCGSKGVCQNTPGSF--TCECQRGFSLDQSGASCEDV 2570          

HSP 7 Score: 199.519 bits (506), Expect = 7.089e-50
Identity = 237/766 (30.94%), Postives = 322/766 (42.04%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINE--CV--------TGDIQCLNKCMNVPGSAYCKCDSGYEG----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF-DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENEC-TIGIANCGIYGDCINTPGSFYCECHPGFELME--DSCMDINE--CTNSTLCGSGSCN----------------NLEGTYECKCDS------------------GYIFHNSTCL--DINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN-GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI----------GGICSSAPRPSN 1119
            C C DG+   D   C D+DEC ++  LC +  C N PG Y C+C +GF  ++ G AC DI+EC L N    C    C N+ G ++CEC    G +L D+    C     C       S  C+++     C CP  +EL+     CVD     C          GD  C N+       A C C  G       + C  +N  E + L              C    GF     T    D DEC+   G C+   C N  G+FQC C  G++LN D   C D NEC T GI  CG  G C NT G++ C C P +  +   ++CMD+    C  +    + +C+                N+   +   C+                   G++    T L  DI+EC   P  C +G CIN    + C C  G+   D   VC D DEC +   C    +C N  GS+ CDC PGY   + G C+D NE     + C  HG C++  GSF C+CH GF  +  D  +C+D +EC    C +  C+NT+G F C C  GF LS    N C D++ECA  NG+  +   CVN +GS  CRC EGY+    G  C   +EC L   P       C N+ G  +C C PGY + +     C D +EC                              + PE C                C +TE     +C+CP GF L +  R C+ +          GG CSS P+  N
Sbjct: 1391 CLCKDGY-TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPN---ICVFGTCHNLPGLFRCEC--EIGYEL-DRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKIL--------------CPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGI--CGP-GTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNICS-HGQCIDTVGSFYCLCHTGFKTNV-DQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSH--NNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLD--PGKCAPGTCQNLDGSYRCICPPGYSLQNDK---CEDIDECV-----------------------------EEPEICALG------------TCSNTEGSF--KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSS-PKSRN 2079          

HSP 8 Score: 194.897 bits (494), Expect = 2.068e-48
Identity = 244/834 (29.26%), Postives = 328/834 (39.33%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKC----DSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETEC--------------------------------------FDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF----HSECKNTLGGFE----CLCETGFALS----------------EILPNT--------------CEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY------------IVDSQ-DPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            CEC+ GF L+  GEC DVDEC  +P      C N  G+Y C CR G+ S    T C DI+ECL  NG       C N DG + C C    G  ++ +D   C   + C + N   +  CI+      C+C  G++L  D + C DINEC T  I    +C+N  GS  C+C      G +G  C D +   T        C        C  K  F  + ++EC                                       D +EC +D   C   +C NL GT++C C  G+ ++     C D NEC +    C   G C NTPGSF C C  GF    D  +C DI+EC  S+ C +G C N  G++ C+C         + LD  + I      G C        C  +     + + C         +PC +           D  C  G+   K   C DINE  +    C  +G CVN+ GSF+C C  G   D     IC+D        CF      EC   + G      C C  G A                  E+ P                 +DINEC +    C+   C N +GS  CRC  G+  D E  NC   DECR+S  P+   +  C+N PG  +C+C+ GY            I + Q DP L                             C+D NEC ++   C H  C+N +G + C+C+ G+ P       CV    CS+ NGGC   C  T S   + C C  GF L  D R+C  I           GG C++ P    G YRC
Sbjct:  476 CECNKGFQLDIRGECIDVDECEKNP-CTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECL-QNGRICNNGRCINTDGSFHCVCNA--GFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST--------CYGGYRRGQCV-KPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCD-NGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDEC-ESSPCINGVCKNSPGSFICECSP------ESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTI--------CQLDPICGKGFSRIKGTQCEDINECEVFPGVC-KNGLCVNSRGSFKCECPNGMTLDAT-GRICLDI---RLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRIS--PDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACIDINECELSANLCPHGRCVNLIGKYQCACNPGYHPTHDR-LFCVDIDECSIMNGGCETFC--TNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP----GEYRC 1265          

HSP 9 Score: 172.94 bits (437), Expect = 9.501e-42
Identity = 165/504 (32.74%), Postives = 229/504 (45.44%), Query Frame = 0
Query:  589 KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFD-LMDETECFDKDECEMDNGGCEQVCN-----NLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECIRNPC----GHGECINESPGY----SCSCHSGYVDVDNVCR-------------------------DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE--FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALS-------EILPNTC-----EDINECALNNGDCSQVCVNILGSHY------CR----CYEGYKKDERGNCFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVD 1021
            +C+  PGS  C+C+ G++ D   +C D++ECE         CIN +GS  C C+AG+   +  TEC D DEC + NG   ++CN     N +G+F C C  GFH+  D   C D +EC+  I N  + G CIN  GSF C C PGF+L  D   C DINEC    +C +G C N +G+Y C+C  G         C+D +  +R+ C      G+C+    G      C C S        C+                         D +EC  D      G C N  G++ C C  GYE       C DINE  L    C  +G C N  GSF C C +GF++ + D   C D DEC SSPC +  CKN+ G F C C     L        E +  TC     +   E  +N       C + LG+ +      C+    C +G+ + +   C   +EC +     G C+  LC+N  G  KCEC  G  +D+   R+C+D
Sbjct:  466 RCIPTPGSYRCECNKGFQLDIRGECIDVDECEKNPCT-GGECINNQGSYTCHCRAGYQSTLTRTECRDIDEC-LQNG---RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECS--IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTH--MRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFVY-KPDLKTCEDIDECESSPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFP---GVCKNGLCVNSRGSFKCECPNGMTLDATG-RICLD 954          

HSP 10 Score: 137.887 bits (346), Expect = 3.855e-31
Identity = 133/415 (32.05%), Postives = 188/415 (45.30%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDK---DNHTCISDEA----CQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGC--EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV 805
            P + E  RC     L+   + TCEC+DGF  +        DEC+D+ E     C ++    M  C++G +++    V  +EC  + G G           G  CE     GT    K        +++ A    C+V +  C + EC++      C+C  GY  D     CVD+NEC      C   C N  GS  C C  GY    +G  C D++EC T+   C   C+NT G   C C  GF     T C D +EC  D   C  + VC N  G+F C C+ GF L+    +C D +EC     N      C N  G + C C  G+      + C+D NEC ++ +CG  SC+N  G+Y+C C +G+ +   +  C DINEC   + PC +G C N   GY C C  GY  +
Sbjct: 2301 PGICENGRC-----LNTLGSYTCECNDGFTAS-----PTQDECLDNRE---GYCFSEVLQNM--CQIGSSNRNP--VTKSECCCDGGRG----------WGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGF-TQHHTACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECE---GNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDINECGSSQAPCSYG-CSNTEGGYLCGCPPGYFRI 2683          

HSP 11 Score: 137.502 bits (345), Expect = 5.401e-31
Identity = 162/510 (31.76%), Postives = 216/510 (42.35%), Query Frame = 0
Query:  616 CETQDLICDHN-CINTEGSAHCTCKAGFDLMDETECFDKDECEMD--NGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC-IRNPCGHGECINESPGYSCSCHSGY-VDVDN-VCRDY-------------------------DEC-------LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCY-EGYKKDERGNCF--LKDECRLSRRPNGGCQQLCINIPGG-LKCECNPGYIVDSQDP-------------------RLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPD 1054
            C+    +C +  CI T GS  C C  GF L    EC D DECE +   GG    C N +G++ C C+ G+        C D +EC      C   G CINT GSF+C C+ GF +  D  +C D++EC+   +C +G C N +G+++C C  G+   +    C DINEC     C +G C+N    Y C C  G  V +D  VC D                           EC           PC      N+      C   PG         DINE +L+ D C P+G C N  G+++C+C+ G+  D    N C+D +EC+  S  C + +C+NT G F C C  GF     L  TCEDI+EC  +   NG    VC N  GS  C C  E      +  C   +K  C      +G C+   INI G  LK EC          P                     C D NEC +  G C++  C+N  G   C C  G   D
Sbjct:  455 CQLVRYLCQNGRCIPTPGSYRCECNKGFQLDIRGECIDVDECEKNPCTGG---ECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAG---TDINECALDPDIC-PNGICENLRGTYKCICNSGYEVDITGKN-CVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDL-KTCEDIDECESSPCING----VCKNSPGSFICECSPESTLDPTKTICIETIKGTC-WQTVIDGRCE---ININGATLKSECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLD 946          

HSP 12 Score: 126.331 bits (316), Expect = 1.236e-27
Identity = 149/507 (29.39%), Postives = 218/507 (43.00%), Query Frame = 0
Query:  743 LCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVD--VDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF-KNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNG---GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLF-----TCNNGYQITGVKKTRCTRLSE 1226
            LC +G C    G+Y C+C+ G+       C+D++EC +NPC  GECIN    Y+C C +GY        CRD DECL +      G+C N  GSF C C  G+   ++G  C D++E S+ ++ C  +G C+N DGSF+C+C  GF    +D   C D +EC +   C +  C NT G + C C  G A+                  G   +VCV+        CY GY+   RG C         K EC  +         CQ          +  C+ G  + S       D NEC ++   C +  C N  G + C C+ G++ D    + CV    C +N+  C +  C++T       C CP GF  K D +TC+ I   C S+P   NG      K   G F+    C+        PT  I  + I    W    D  CE+        ++   +  E C +  +  GS C        C  G+  + +K T+C  ++E
Sbjct:  461 LCQNGRCIPTPGSYRCECNKGFQLDIRGECIDVDECEKNPCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSI-RNMC-LNGMCINEDGSFKCICKPGF-QLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAV------------------GLDGRVCVDTHMRS--TCYGGYR---RGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAG----TDINECALDPDICPNGICENLRGTYKCICNSGYEVDITG-KNCVDINECVLNSLLCDNGQCRNTPGSF--VCTCPKGFVYKPDLKTCEDIDE-CESSP-CINGVC----KNSPGSFI----CECSPESTLDPTKTICIETIKGTCWQTVIDGRCEIN-------INGATLKSECCSSLGAAWGSPCTICQLDPICGKGF--SRIKGTQCEDINE 915          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|13626617|sp|Q9TV36.1|FBN1_PIG (RecName: Full=Fibrillin-1; Contains: RecName: Full=Asprosin; Flags: Precursor)

HSP 1 Score: 260.766 bits (665), Expect = 1.238e-68
Identity = 238/705 (33.76%), Postives = 326/705 (46.24%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINE----------------------------CLLNNGHG---PCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGV---GGKCNNKP----GSFDCDCA----------------PGYEFK------NGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            C C  G++LN+D   C+DV+EC + P +C    C N  G Y C C   +   + G  C+D+                              C  N G     PC+         +   CG      + D      +  + C+   G C +  CI+      C CP G+  ++    C DI+EC  G +   N +C+N  GS  C C  GY       C+D NEC+    IC H  CI+T GS +C C  GF    D+T C D +ECE D  G    C N  G+F C C  GF L+ +N  C D +EC  G  N    G CINT GSF C+C+ G+E+  D  +C+DINEC      C  G+C NL+G+Y C C  GY   N  C DI+EC+  P  C  G C N    + C C  G+        C+D    L  + C     GGKC++         +C CA                P   F+      +G     ++ +++ D C       HG C+N DGS+ C C  G+I + N+   C+D DEC + +PC +  CKN +GGFEC CE GF    ++  TCEDINECA N   C+  CVN  GS+ C+C  GY  +++R  C  +DEC   +      Q  C N+ G   C C PGY     D   CVD+NEC    G C++  C+N  G +TC C+ GF
Sbjct: 1631 CRCPTGYYLNEDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNN-DCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQD----LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILEGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMM--TCEDINECAQNPLLCAFRCVNTYGSYECKCPTGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGMYICICGPGY-QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGF 2322          

HSP 2 Score: 236.113 bits (601), Expect = 4.779e-61
Identity = 203/604 (33.61%), Postives = 283/604 (46.85%), Query Frame = 0
Query:  426 DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLM-DETECFD--------------------------KDECEMDNGG-----CEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            D+     C    G  +  D    D+DEC  +P++C H  C N  G+Y C+C  G+  +G  CVD +EC + N   PC +  CKNV GG++C C  G  PG  +      TC     C  N   C+  C+++Y    C CP GY L ED + C D +EC  G   C  K   C N+ G   C C  GY+    G+ C D NEC+T+  IC++  C+NT GS  C C  GF     + EC D                          K EC  D G      CE         F+  C  G    T+     D +EC + I +    G+CIN  GS++C C  G+  ++   +C+D+NEC  +    +  C N EG+Y+C C  GYI      +C D++EC   ++ C    C+N    ++C C  G+      C D +EC  D N CG  G C N PGSF C+C  G+        C D++E   E +    HG C N  G + C C QG++      N C+D +ECLS+  C  + C NTLG ++C+C  GF   E     C+DINEC  +   CS  C N  G + C C  GY +  +G+C 
Sbjct: 2104 DEAFRQICPYGSGIIVGPDDSAVDMDEC-KEPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGN---PCGNGTCKNVIGGFECTCEEGFEPGPMM------TCEDINECAQNPLLCAFRCVNTYGSYECKCPTGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGMYICICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPTQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG---ADIDECKV-IHDVCRNGECINDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGSFACKCPPGFTQHHTACIDNNECTSDINLCGAKGICQNTPGSFTCECQRGFSLDQSGASCEDVDE--CEGNHRCQHG-CQNIIGGYRCSCPQGYLQ-HYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQY-EQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCV 2687          

HSP 3 Score: 224.557 bits (571), Expect = 1.726e-57
Identity = 225/697 (32.28%), Postives = 332/697 (47.63%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFT--SQGTACVDI--NECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCP--DGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-IYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKP----GSFDCDCAPGYEF-KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP-CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHIC--KSTESGL-HHRCMCPSGFKLKTDARTCKPI 1107
            C C  G+ L +D +CED+DECV++PE+C    C+N  G++ C C  GF+  S G  C D+  + C      G C    K+ +   Q  C  L G    D           C++    C  E   ++ QI   CP   G  +  D  + VD++EC   D+    +C+N  GS  C+C  GY  EG++C D +EC   +   +  C N  G   CTC+ GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C DE+EC  G  +C     +C N  G + C C PG++   D   C+D NEC T   +C +G C N  G+Y C+C+ G+    +     +EC+ N    G C  E       C  G  + + V +   EC  D   G G  C   P     +F   C  G  F  NG   DI+E  +  D C  +G+C+N+ GS+ C+C  G+  D   +  C+D +EC  +P   +  CKNT G ++C C  G+ L E    +C+D++ECA    +C  +CVN +GS  C+C  G+ +     C   +EC       G  + +C N PG   CEC  G+ +D Q    C D +EC  N+  CQH C N +GG+ CSC  G+        +CV    C       +HIC   S  + L  ++CMCP+GF+ +  +  C+ I
Sbjct: 1998 CICPPGYSLQND-KCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSP-KSRNHSKQECCCALKGEGWGD----------PCEL----CPTEPDEAFRQI---CPYGSGIIVGPD-DSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPTGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGMYICICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPTQ----DECLDNR--EGYCFTEV--LQNMCQIGSSNRNPVTK--SECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGA--DIDECKVIHDVC-RNGECINDRGSYHCICKTGYTPDITGT-ACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQED-GRSCKDLDECATKQHNCQFLCVNTIGSFACKCPPGFTQHHTA-CIDNNECTSDINLCGA-KGICQNTPGSFTCECQRGFSLD-QSGASCEDVDECEGNH-RCQHGCQNIIGGYRCSCPQGYL-QHYQWNQCVDENECLS-----AHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDI 2649          

HSP 4 Score: 213.001 bits (541), Expect = 5.434e-54
Identity = 216/645 (33.49%), Postives = 283/645 (43.88%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCF----------HSECKNTLG----GFECLCETGFALS--------------EIL--------PN----TCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYI 1010
            C C  GF L+ ++  C D+DEC   P+LC    C N PG + C C  G+ S       C+DI+EC    LL  G       C N +G Y+CEC   P       +   CI    C+++   C H  C++   +       GY    D   CVDI+EC   +  C   C N  GS  C C  G+    +   C+DI+ECE    ICD   C N  G   C C  GF   ++ + C D +EC+++   C    C N +G+F C C  G+        CTD NEC IG  NC  +  C NT GSF C C PG+      C D++EC+N T +C     C N  G+Y C C  GY     TC D++EC  N   CG+ +C+    GY C    G+V   +   C D DEC   N C V G C+N PG F C+C  GYE     G C D+NE  LE   C   G+CVN  GS+ CVC   F  + N + + C+D     S  C+           + C N +G       C C  G A                +IL        PN      EDI+EC    G C    C+N  GS  CRC  GY  +E     + D+      P       C N  G   C C P Y+
Sbjct: 1053 CRCDSGFALDSEERNCIDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRG-----GVCLNTEGSYRCEC---PSGHQMSPNISACIDINECELSAHLCPHGRCVNLIGKYQRARNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCDRHAVCTNTAGSFNCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCADLDECSENVKLCGNVQCLYAPGGYHCEYDMGFVPSADRKSCVDSDECSLPNIC-VFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-CLEPPTC-ISGNCVNTPGSYTCVCPPDF--ELNPTRVGCVDT---RSGNCYLDVRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEQCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTR--VCDDVNECETPGICGPGTCYNTVGNYTCICPPDYM 1679          

HSP 5 Score: 204.912 bits (520), Expect = 1.774e-51
Identity = 230/737 (31.21%), Postives = 328/737 (44.50%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT-SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCS-HECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTG-DIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQ--CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDEC---LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPC-FHSECKNTLGGFECLCETG---------------FALSEILPN------TCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACS--VNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C H   +D   +  C CH GF  N D   C D++EC  D    +  C N  G++ C C  GF  S    C+D++EC   NG+     +C N  G +QC+C    G +++  D  TC+    C +  G C+   C +      C+CP GY L  D   C DI+ECV   +I  L  C N  GS  C C  G+     S    C  QDL   +     EG    + K+      E  C  K E   D   CE      +  F+  C    G  +  D+ +  D +EC     +   +G CINT GS+ CEC  G+ L  + C+D +EC+    CG+G+C N+ G +EC C+ G+      TC DINEC +NP  C    C+N    Y C C +GYV  ++  +C+D DEC    HD       +C N  G + C C PGY+ +     C D NE   +   C  +G C+N  GS+ C C+ GF         C+D      F E L + C   S  +N +   EC C+ G                A  ++ P+         DI+EC + +  C    C+N  GS++C C  GY  D  G  C   +EC  + +P   C  +C N  G  +C C  GYI+  +D R C D +EC      CQ  C+N +G   C C  GF    ++   C+    C+  +N  G   IC++T       C C  GF L     +C+ +
Sbjct: 1860 CSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERD-ACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCN--EGYEVA-PDGRTCVDINECLLEPGKCAPGTCQNLDGSYRCICPPGYSLQND--KCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLS--STGRRC--QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDP--CELCPTEPDEAFRQICPYGSGIIVGPDD-SAVDMDECK--EPDVCKHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPTGYVLREDRRMCKDEDECEEGKHDCA-EKQMECKNLIGMYICICGPGYQRRPDGEGCVDENECQTKPGIC-ENGRCLNTRGSYTCECNDGFTASPTQDE-CLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECINDRGSYHCICKTGYTPDITGTACVDLNECNQAPKP---CNFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQHNCQFLCVNTIGSFACKCPPGFT---QHHTACIDNNECTSDINLCGAKGICQNTPGSF--TCECQRGFSLDQSGASCEDV 2568          

HSP 6 Score: 192.586 bits (488), Expect = 8.627e-48
Identity = 245/833 (29.41%), Postives = 335/833 (40.22%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKC----DSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETEC--------------------------------------FDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDF----------DECLSSPCF----HSECKNTLGG-----------------FECLCET--GFALSEILPNT--CEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY------------IVDSQ-DPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEK--CVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            CEC+ GF L+  GEC DVDEC  +P      C N  G+Y C CR G+ S    T C DI+ECL  NG       C N DG + C C    G  ++ +D   C   + C + N   +  CI+      C+C  G++L  D + C DINEC T  I    +C+N  GS  C+C      G +G  C D +   T        C        C  K  F  + ++EC                                       D +EC +D   C   +C NL GT++C C  G+ +++    C D NEC +    C   G C NTPGSF C C  GF    D  +C DI+EC  S+ C +G C N  G++ C+C S       + LD  + I      G C        C  +     + + C         +PC         P   D  C  GY   K   C DI+E  +    C  +G CVN+ GSF+C C  G   D     IC+D           DE  + P         C  ++G                  +E LC    GFA  EI       +DINEC +    C+   C N +GS  CRC  G+  D E  NC   DECR+S  P+   +  C+N PG  +C+C+ GY            I + Q DP L                             C+D NEC ++   C H  C+N +G +  + + G+      P++  CV    CS+ NGGC   C ++E    + C C  GF L  D R+C  I           GG C++ P    G YRC
Sbjct:  474 CECNKGFQLDLRGECIDVDECEKNP-CAGGECINNQGSYTCQCRPGYQSTLTRTECRDIDECL-QNGRICNNGRCINTDGSFHCVCNA--GFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETSGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST--------CYGGYKRGQCV-KPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCD-NGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDEC-ESSPCINGVCKNSPGSFICECSS------ESTLDPTKTICIETIKGTCWQTIIDGRCEININGATLKSQCCSSLGAAWGSPC--------TPCQVDPICGKGYSRIKGTQCEDIDECEVFPGVC-KNGLCVNSKGSFKCQCPNGMTLDAT-GRICLDIRLETCFLRYEDEECTLPVVGRHRMDACCCSVGAAWGTEECEECPPRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCIDIDECRIS--PDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCECPSGHQMSPNISACIDINECELSAHLCPHGRCVNLIGKYQRARNPGY---HSTPDRLFCVDIDECSIMNGGCETFCTNSEG--SYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP----GEYRC 1263          

HSP 7 Score: 178.333 bits (451), Expect = 2.108e-43
Identity = 165/500 (33.00%), Postives = 229/500 (45.80%), Query Frame = 0
Query:  589 KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFD-LMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECIRNPC----GHGECINESPGY----SCSCHSGYVDVDNVCR-------------------------DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN--GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALS-------EILPNTC-----EDINECALNNGDCSQVCVNILGSHY------CR----CYEGYKKDERGNCFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVD 1021
            +C+  PGS  C+C+ G++ D   +C D++ECE ++      CIN +GS  C C+ G+   +  TEC D DEC  +   C    C N +G+F C C  GFH+  D   C D +EC+  I N  + G CIN  GSF C C PGF+L  D   C DINEC  S +C +G C N +G+Y C+C  G         C+D +  +R+ C      G+C+    G      C C S        C+                         D +EC  D      G C N  G++ C C  GYE  +    C DINE  L    C  +G C N  GSF C C +GFI+ + D   C D DEC SSPC +  CKN+ G F C C +   L        E +  TC     +   E  +N       C + LG+ +      C+    C +GY + +   C   DEC +     G C+  LC+N  G  KC+C  G  +D+   R+C+D
Sbjct:  464 RCIPTPGSYRCECNKGFQLDLRGECIDVDECE-KNPCAGGECINNQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECS--IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETSGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTH--MRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFIY-KPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTIIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGYSRIKGTQCEDIDECEVFP---GVCKNGLCVNSKGSFKCQCPNGMTLDATG-RICLD 952          

HSP 8 Score: 144.05 bits (362), Expect = 5.794e-33
Identity = 154/494 (31.17%), Postives = 209/494 (42.31%), Query Frame = 0
Query:  627 CINTEGSAHCTCKAGFDLMDETECFDKDECEMD--NGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC-IRNPCGHGECINESPGYSCSCHSGY-VDVDN-VCRDY-------------------------DEC-------LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDE---------RGNCF---LKDECRLSRRPNGGCQQLCINIPGGLKCECNP-------GYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPD 1054
            CI T GS  C C  GF L    EC D DECE +   GG    C N +G++ C C+PG+        C D +EC      C   G CINT GSF+C C+ GF +  D  +C D++EC+   +C +G C N +G+++C C  G+   +    C DINEC     C +G C+N    Y C C  G  V +D  VC D                           EC           PC      N+      C   PG         DINE +L+ D C P+G C N  G+++C+C+ G+  D    N C+D +EC+  S  C + +C+NT G F C C  GF     L  TCEDI+EC  +   NG    VC N  GS  C C      D          +G C+   +   C ++        Q C ++       C P       G          C D +EC +  G C++  C+N  G   C C  G   D
Sbjct:  465 CIPTPGSYRCECNKGFQLDLRGECIDVDECEKNPCAGG---ECINNQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETSGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGMTSAG---SDINECALDPDIC-PNGICENLRGTYKCICNSGYEVDSTGKN-CVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDL-KTCEDIDECESSPCING----VCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTIIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPNGMTLD 944          

HSP 9 Score: 141.739 bits (356), Expect = 2.733e-32
Identity = 134/415 (32.29%), Postives = 188/415 (45.30%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDK---DNHTCISDEA----CQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNG--GCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV 805
            P + E  RC     L+   + TCEC+DGF  +        DEC+D+ E     C  +    M  C++G +++    V  +EC  + G G           G  CE     GT    K        +++ A    C+V +  C + ECI+      C+C  GY  D     CVD+NEC      C   C N  GS  C C  GY    +G  C D++EC T+   C   C+NT GS  C C  GF     T C D +EC  D    G + +C N  G+F C C+ GF L+    +C D +EC     N      C N  G + C C  G+      + C+D NEC ++ +CG  SC+N  G+Y+C C +G+ +   +  C DINEC   + PC +G C N   GY C C  GY  +
Sbjct: 2299 PGICENGRC-----LNTRGSYTCECNDGFTAS-----PTQDECLDNRE---GYCFTEVLQNM--CQIGSSNRNP--VTKSECCCDGGRG----------WGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECINDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFACKCPPGF-TQHHTACIDNNECTSDINLCGAKGICQNTPGSFTCECQRGFSLDQSGASCEDVDECE---GNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSSQAPCSYG-CSNTEGGYLCGCPPGYFRI 2681          

HSP 10 Score: 124.02 bits (310), Expect = 6.831e-27
Identity = 147/494 (29.76%), Postives = 207/494 (41.90%), Query Frame = 0
Query:  773 DINECIRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE--FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG-------------------YKKDERGNC-------FLKDECRLSRRPNG---GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCL-----FTCNNGYQITGVKKTRCTRLSE 1226
            D  +  R  C +G CI     Y C C+ G+ +D+   C D DEC   NPC  GG+C N  GS+ C C PGY+       C DI+E       C  +G C+N DGSF CVC+ GF H   D   C D DEC + + C +  C N  G F+C+C+ GF L+      C+DINEC  +    +  CVN  GS+ C C+ G                   Y   +RG C         K EC  +         CQ          +  C+ G  + S       D NEC ++   C +  C N  G + C C+ G++ D    + CV    C +N+  C +  C++T       C CP GF  K D +TC+ I   C S+P   NG      K   G F+    C+        PT  I  + I    W    D  CE+        ++   +  + C +  +  GS C        C  GY  + +K T+C  + E
Sbjct:  451 DYCQLFRYLCHNGRCIPTPGSYRCECNKGFQLDLRGECIDVDEC-EKNPC-AGGECINNQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGF-HVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASD-GRYCKDINECETSGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGMTSAGS----DINECALDPDICPNGICENLRGTYKCICNSGYEVDSTG-KNCVDINECVLNSLLCDNGQCRNTPGSF--VCTCPKGFIYKPDLKTCEDIDE-CESSP-CINGVC----KNSPGSFI----CECSSESTLDPTKTICIETIKGTCWQTIIDGRCEIN-------INGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGY--SRIKGTQCEDIDE 913          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|1042782300|sp|P98133.2|FBN1_BOVIN (RecName: Full=Fibrillin-1; AltName: Full=MP340; Contains: RecName: Full=Asprosin; Flags: Precursor)

HSP 1 Score: 260.381 bits (664), Expect = 1.928e-68
Identity = 238/705 (33.76%), Postives = 326/705 (46.24%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINE----------------------------CLLNNGHG---PCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGV---GGKCNNKP----GSFDCDCA----------------PGYEFK------NGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            C C  G++LN+D   C+DV+EC + P +C    C N  G Y C C   +   + G  C+D+                              C  N G     PC+         +   CG      + D      +  + C+   G C +  CI+      C CP G+  ++    C DI+EC  G +   N +C+N  GS  C C  GY       C+D NEC+    IC H  CI+T GS +C C  GF    D+T C D +ECE D  G    C N  G+F C C  GF L+ +N  C D +EC  G  N    G CINT GSF C+C+ G+E+  D  +C+DINEC  +   C  G+C NL+G+Y C C  GY   N  C DI+EC+  P  C  G C N    + C C  G+        C+D    L  + C     GGKC++         +C CA                P   F+      +G     ++ +++ D C       HG C+N DGS+ C C  G+I   N+   C+D DEC + +PC +  CKN +GGFEC CE GF    ++  TCEDINECA N   C+  CVN  GS+ C+C  GY  +++R  C  +DEC   +      Q  C N+ G   C C PGY     D   CVD+NEC    G C++  C+N  G +TC C+ GF
Sbjct: 1631 CRCPTGYYLNEDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNN-DCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLDPRKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQD----LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILQGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMM--TCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGY-QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGF 2322          

HSP 2 Score: 236.498 bits (602), Expect = 3.318e-61
Identity = 203/604 (33.61%), Postives = 284/604 (47.02%), Query Frame = 0
Query:  426 DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLM-DETECFD--------------------------KDECEMDNGG-----CEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            D+     C    G  +  D    D+DEC  +P++C H  C N  G+Y C+C  G+  QG  CVD +EC + N   PC +  CKNV GG++C C  G  PG  +      TC     C  N   C+  C+++Y    C CP GY L ED + C D +EC  G   C  K   C N+ G+  C C  GY+    G+ C D NEC+T+  IC++  C+NT GS  C C  GF    ++ EC D                          K EC  D G      CE         F+  C  G    T+     D +EC + I +    G+C+N  GS++C C  G+  ++   +C+D+NEC  +    +  C N EG+Y+C C  GYI      +C D++EC   ++ C    C+N    ++C C  G+      C D +EC  D N CG  G C N PGSF C+C  G+        C D++E   E +    HG C N  G + C C QG++      N C+D +ECLS+  C  + C NTLG ++C+C  GF   E     C+DINEC      CS  C N  G + C C  GY +  +G+C 
Sbjct: 2104 DEAFRQICPYGSGIIVGPDDSAVDMDEC-KEPDVCKHGQCINTDGSYRCECPFGYILQGNECVDTDECSVGN---PCGNGTCKNVIGGFECTCEEGFEPGPMM------TCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG---ADIDECKV-IHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGSFTCKCPPGFTQHHTACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDPSGASCEDVDE--CEGNHRCQHG-CQNIIGGYRCSCPQGYLQ-HYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQY-EQFSGGCQDINECGSAQAPCSYGCSNTEGGYLCACPPGYFRIGQGHCV 2687          

HSP 3 Score: 236.498 bits (602), Expect = 3.705e-61
Identity = 227/648 (35.03%), Postives = 306/648 (47.22%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQ-QLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSC 1047
            C C  GF L+ ++  C D+DEC   P+LC    C N PG + C C  G+ S       C+DI+EC    LL  G       C N +G Y+CEC   PG QL+  +   CI    C+++   C H  C++   +  C C  GY    D   CVDI+EC   +  C   C N  GS  C C  G+    +   C+DI+ECE    ICD   C N  G   C C  GF   ++ + C D +EC+++   C    C N +G+F C C  G+        CTD NEC IG  NC  +  C NT GSF C C PG+      C D++EC+N T +C     C N  G+Y C C  GY     TC D++EC    N CG+G+C+N   GY C C  G+V   +   C D DEC   N C V G C+N PG F C+C  GYE     G C D+NE  L+   C   G+CVN  GS+ C C   F  + N + + C+D     S  C+     +   G   C  E G  +S+   + C     C+L    G   ++C  +  S Y   C   EG++ +      L+D       P G CQ   CIN  G  +C C  GY ++ +D R+C D NEC          C N +G +TC C
Sbjct: 1053 CRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRG-----GVCLNTEGSYRCEC--PPGHQLA-PNISACIDINECELSAHLCPHGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNIC-VFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-CLDPTTC-ISGNCVNTPGSYTCDCPPDF--ELNPTRVGCVDT---RSGNCYLDIRPRGDNGDTACSNEIGVGVSKA--SCC-----CSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPI-TVILEDIDECQELP-GLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCIC 1674          

HSP 4 Score: 224.172 bits (570), Expect = 2.302e-57
Identity = 226/732 (30.87%), Postives = 340/732 (46.45%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCP---DGY---------ELDEDWK---------------TCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-IYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKP----GSFDCDCAPGYEF-KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP-CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHIC--KSTESGL-HHRCMCPSGFKLKTDARTCKPIGGICSSAPRP 1117
            C+C++G+ +  DG  C D++EC+ DP  C    C N  G+Y C C  G++ Q   C DI+EC+           C N +G ++C C  G   +    +     +S    +   G CS     ++++  C C    +G+         E DE ++               + VD++EC   D+    +C+N  GS  C+C  GY  +G++C D +EC   +   +  C N  G   CTC+ GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C DE+EC  G  +C     +C N  G++ C C PG++   D   C+D NEC T   +C +G C N  G+Y C+C+ G+    +   CLD  E        G C  E       C  G  + + V +   EC  D   G G  C   P     +F   C  G  F  NG   DI+E  +  D C  +G+CVN+ GS+ C+C  G+  D   +  C+D +EC  +P   +  CKNT G ++C C  G+ L E    +C+D++ECA    +C  +CVN +GS  C+C  G+ +     C   +EC       G  + +C N PG   CEC  G+ +D      C D +EC  N+  CQH C N +GG+ CSC  G+        +CV    C       +HIC   S  + L  ++CMCP+GF+ +  +  C+ I   C SA  P
Sbjct: 1956 CQCNEGYEVAPDGRTCVDINECLLDPRKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECV-EEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILQGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNRE--------GYCFTEV--LQNMCQIGSSNRNPVTK--SECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGA--DIDECKVIHDVC-RNGECVNDRGSYHCICKTGYTPDITGT-ACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQED-GRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFTQHHTA-CIDNNECTSDINLCGS-KGICQNTPGSFTCECQRGFSLDPSGAS-CEDVDECEGNH-RCQHGCQNIIGGYRCSCPQGYL-QHYQWNQCVDENECLS-----AHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINE-CGSAQAP 2658          

HSP 5 Score: 216.853 bits (551), Expect = 3.381e-55
Identity = 235/770 (30.52%), Postives = 332/770 (43.12%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT-SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICD-HNCINTEGSAHCTCKAGFDL---------MDETECFDKDE------------------CEMDNGG----CEQVCNNLEGTFQ--CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDEC---LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPC-FHSECKNTLGGFECLCETG---------------FALSEILPN------TCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACS--VNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C H   +D   +  C CH GF  N D   C D++EC  D    +  C N  G++ C C  GF  S    C+D++EC   NG+     +C N  G +QC+C                                             +GYE+  D +TCVDINEC+    +C    C N+ GS  C C  GY  + D C DI+EC  +  IC    C NTEGS  C C  GF L         +  + C+ K E                  C +   G    CE      +  F+  C    G  +  D+ +  D +EC     +   +G CINT GS+ CEC  G+ L  + C+D +EC+    CG+G+C N+ G +EC C+ G+      TC DINEC +NP  C    C+N    Y C C +GYV  ++  +C+D DEC    HD       +C N  G++ C C PGY+ +     C D NE   +   C  +G C+N  GS+ C C+ GF    N    C+D      F E L + C   S  +N +   EC C+ G                A  ++ P+         DI+EC + +  C    CVN  GS++C C  GY  D  G  C   +EC  + +P   C  +C N  G  +C C  GYI+  +D R C D +EC      CQ  C+N +G  TC C  GF    ++   C+    C+  +N  G   IC++T       C C  GF L     +C+ +
Sbjct: 1860 CSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERD-ACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCN--------------------------------------------EGYEVAPDGRTCVDINECLLDPRKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDD-SAVDMDECK--EPDVCKHGQCINTDGSYRCECPFGYILQGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCA-EKQMECKNLIGTYLCICGPGYQRRPDGEGCVDENECQTKPGIC-ENGRCLNTRGSYTCECNDGFTASPNQDE-CLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKP---CNFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFT---QHHTACIDNNECTSDINLCGSKGICQNTPGSF--TCECQRGFSLDPSGASCEDV 2568          

HSP 6 Score: 197.208 bits (500), Expect = 3.624e-49
Identity = 247/834 (29.62%), Postives = 337/834 (40.41%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKC----DSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETEC--------------------------------------FDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------------------------FDECLSS--------PCFHSECKNTLGGFECLCET--GFALSEIL--PNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY------------IVDSQ-DPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEK--CVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            CEC+ GF L+  GEC DVDEC  +P      C N  G+Y C CR G+ S    T C DI+ECL  NG       C N DG + C C    G  ++ +D   C   + C + N   +  CI+      C+C  G++L  D + C DINEC T  I    +C+N  GS  C+C      G +G  C D +   T        C        C  K  F  + ++EC                                       D +EC +D   C   +C NL GT++C C  G+ +++    C D NEC +    C   G C NTPGSF C C  GF    +  +C DI+EC  S+ C +G C N  G++ C+C S      +  + I E I+     G C        C  +     + + C         +PC         P   D  C  GY   K   C DI+E  +    C  +G CVN+ GSF+C C  G   D     IC+D                         D C  S         C     +NT   +E LC    GFA  EI       +DINEC +    C+   C N +GS  CRC  G+  D E  NC   DECR+S  P+   +  C+N PG  +C+C+ GY            I + Q DP L                             C+D NEC ++   C H  C+N +G + C+C+ G+      P++  CV    CS+ NGGC   C ++E    + C C  GF L  D R+C  I           GG C++ P    G YRC
Sbjct:  474 CECNKGFQLDLRGECIDVDECEKNP-CAGGECINTQGSYTCQCRPGYQSTLTRTECRDIDECL-QNGRICNNGRCINTDGSFHCVCNA--GFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST--------CYGGYKRGQCV-KPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCD-NGQCRNTPGSFVCTCPKGFIYKPELKTCEDIDEC-ESSPCINGVCKNSPGSFICECSSESTLDPTKTICI-ETIK-----GTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPC--------TPCQVDPICGKGYSRIKGTQCEDIDECEVFPGVC-KNGLCVNSKGSFKCQCPSGMTLDAT-GRICLDIRLETCFLRYEDEECTLPVAGRHRMDACCCSVGAAWGTEECEECPVRNTP-EYEELCPRGPGFATKEITNGKRFFKDINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRIS--PDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCECPPGHQLAPNISACIDINECELSAHLCPHGRCVNLIGKYQCACNPGY---HSTPDRLFCVDIDECSIMNGGCETFCTNSEG--SYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP----GEYRC 1263          

HSP 7 Score: 177.178 bits (448), Expect = 4.546e-43
Identity = 166/505 (32.87%), Postives = 234/505 (46.34%), Query Frame = 0
Query:  589 KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFD-LMDETECFDKDECEMDNGGCEQVCN-----NLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECIRNPC----GHGECI------------------------------NESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN--GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALS-------EILPNTC-----EDINECALNNGDCSQVCVNILGSHY------CR----CYEGYKKDERGNCFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVD 1021
            +C+  PGS  C+C+ G++ D   +C D++ECE ++      CINT+GS  C C+ G+   +  TEC D DEC + NG   ++CN     N +G+F C C  GFH+  D   C D +EC+  I N  + G CIN  GSF C C PGF+L  D   C DINEC    +C +G C N +G+Y C+C  G         C+D +  +R+ C      G+C+                                S  Y   C SG   + +   D +EC  D      G C N  G++ C C  GYE  +    C DINE  L    C  +G C N  GSF C C +GFI+ + +   C D DEC SSPC +  CKN+ G F C C +   L        E +  TC     +   E  +N       C + LG+ +      C+    C +GY + +   C   DEC +     G C+  LC+N  G  KC+C  G  +D+   R+C+D
Sbjct:  464 RCIPTPGSYRCECNKGFQLDLRGECIDVDECE-KNPCAGGECINTQGSYTCQCRPGYQSTLTRTECRDIDEC-LQNG---RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECS--IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTH--MRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSG-PGITSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFIY-KPELKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGYSRIKGTQCEDIDECEVFP---GVCKNGLCVNSKGSFKCQCPSGMTLDATG-RICLD 952          

HSP 8 Score: 144.05 bits (362), Expect = 6.094e-33
Identity = 154/494 (31.17%), Postives = 209/494 (42.31%), Query Frame = 0
Query:  627 CINTEGSAHCTCKAGFDLMDETECFDKDECEMD--NGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC-IRNPCGHGECINESPGYSCSCHSGY-VDVDN-VCRDY-------------------------DEC-------LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDE---------RGNCF---LKDECRLSRRPNGGCQQLCINIPGGLKCECNP-------GYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPD 1054
            CI T GS  C C  GF L    EC D DECE +   GG    C N +G++ C C+PG+        C D +EC      C   G CINT GSF+C C+ GF +  D  +C D++EC+   +C +G C N +G+++C C  G+   +    C DINEC     C +G C+N    Y C C  G  V +D  VC D                           EC           PC      N+      C   PG         DINE +L+ D C P+G C N  G+++C+C+ G+  D    N C+D +EC+  S  C + +C+NT G F C C  GF     L  TCEDI+EC  +   NG    VC N  GS  C C      D          +G C+   +   C ++        Q C ++       C P       G          C D +EC +  G C++  C+N  G   C C  G   D
Sbjct:  465 CIPTPGSYRCECNKGFQLDLRGECIDVDECEKNPCAGG---ECINTQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSAG---SDINECALDPDIC-PNGICENLRGTYKCICNSGYEVDSTGKN-CVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPEL-KTCEDIDECESSPCING----VCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPSGMTLD 944          

HSP 9 Score: 141.739 bits (356), Expect = 2.826e-32
Identity = 133/415 (32.05%), Postives = 190/415 (45.78%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDK---DNHTCISDEA----CQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGC--EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC--IRNPCGHGECINESPGYSCSCHSGYVDV 805
            P + E  RC     L+   + TCEC+DGF  +      + DEC+D+ E     C  +    M  C++G +++    V  +EC  + G G           G  CE     GT    K        +++ A    C+V +  C + EC++      C+C  GY  D     CVD+NEC      C   C N  GS  C C  GY    +G  C D++EC T+   C   C+NT GS  C C  GF     T C D +EC  D   C  + +C N  G+F C C+ GF L+    +C D +EC     N      C N  G + C C  G+      + C+D NEC ++ +CG  SC+N  G+Y+C C +G+ +   +  C DINEC   + PC +G C N   GY C+C  GY  +
Sbjct: 2299 PGICENGRC-----LNTRGSYTCECNDGFTAS-----PNQDECLDNRE---GYCFTEVLQNM--CQIGSSNRNP--VTKSECCCDGGRG----------WGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGF-TQHHTACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDPSGASCEDVDECE---GNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYG-CSNTEGGYLCACPPGYFRI 2681          

HSP 10 Score: 122.094 bits (305), Expect = 2.958e-26
Identity = 146/494 (29.55%), Postives = 206/494 (41.70%), Query Frame = 0
Query:  773 DINECIRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE--FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG-------------------YKKDERGNC-------FLKDECRLSRRPNG---GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCL-----FTCNNGYQITGVKKTRCTRLSE 1226
            D  +  R  C +G CI     Y C C+ G+ +D+   C D DEC   NPC  GG+C N  GS+ C C PGY+       C DI+E       C  +G C+N DGSF CVC+ GF H   D   C D DEC + + C +  C N  G F+C+C+ GF L+      C+DINEC       +  CVN  GS+ C C+ G                   Y   +RG C         K EC  +         CQ          +  C+ G  + S       D NEC ++   C +  C N  G + C C+ G++ D    + CV    C +N+  C +  C++T       C CP GF  K + +TC+ I   C S+P   NG      K   G F+    C+        PT  I  + I    W    D  CE+        ++   +  + C +  +  GS C        C  GY  + +K T+C  + E
Sbjct:  451 DYCQLFRYLCQNGRCIPTPGSYRCECNKGFQLDLRGECIDVDEC-EKNPC-AGGECINTQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGF-HVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASD-GRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSAGS----DINECALDPDICPNGICENLRGTYKCICNSGYEVDSTG-KNCVDINECVLNSLLCDNGQCRNTPGSF--VCTCPKGFIYKPELKTCEDIDE-CESSP-CINGVC----KNSPGSFI----CECSSESTLDPTKTICIETIKGTCWQTVIDGRCEIN-------INGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGY--SRIKGTQCEDIDE 913          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|311033452|sp|P35555.3|FBN1_HUMAN (RecName: Full=Fibrillin-1; Contains: RecName: Full=Asprosin; Flags: Precursor)

HSP 1 Score: 256.914 bits (655), Expect = 1.904e-67
Identity = 238/703 (33.85%), Postives = 325/703 (46.23%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINE----------------------------CLLNNGHG---PCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMD-ETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGV---GGKCNNKP----GSFDCDCA----------------PGYEFK------NGXCHDINEXSLEKDPCG-----PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGF 1051
            C C  G++LN+D   C+DV+EC + P +C    C N  G Y C C   +   + G  C+D+                              C  N G     PC+         +   CG      + D      +  + C+   G C +  CI+      C CP G+  ++    C DI+EC  G +   N +C+N  GS  C C  GY       C+D NEC+    IC H  CI+T GS +C C  GF   D +T C D +ECE D  G    C N  G+F C C  GF L+ +N  C D +EC  G  N    G CINT GSF C+C+ G+E+  D  +C+DINEC      C  G+C NL+G+Y C C  GY   N  C DI+EC+  P  C  G C N    + C C  G+    +  R  D  L  + C     GGKC++         +C CA                P   F+      +G     ++ +++ D C       HG C+N DGS+ C C  G+I   N+   C+D DEC + +PC +  CKN +GGFEC CE GF    ++  TCEDINECA N   C+  CVN  GS+ C+C  GY  +++R  C  +DEC   +      Q  C N+ G   C C PGY     D   CVD+NEC    G C++  C+N  G +TC C+ GF
Sbjct: 1631 CRCPTGYYLNEDTRVCDDVNEC-ETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNN-DCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQD--LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNE---CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMM--TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGY-QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGF 2322          

HSP 2 Score: 237.654 bits (605), Expect = 1.847e-61
Identity = 228/648 (35.19%), Postives = 307/648 (47.38%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNST-LCGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQ-QLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSC 1047
            C C  GF L+ ++  C D+DEC   P+LC    C N PG + C C  G+ S       C+DI+EC    LL  G       C N +G Y+CEC   PG QLS  +   CI    C+++   C +  C++   +  C C  GY    D   CVDI+EC   +  C   C N  GS  C C  G+    +   C+DI+ECE    ICD   C N  G   C C  GF   ++ + C D +EC+++   C    C N +G+F C C  G+        CTD NEC IG  NCG +  C NT GSF C C PG+      C D++EC+N T +C     C N  G+Y C C  GY     TC D++EC    N CG+G+C+N   GY C C  G+V   +   C D DEC   N C V G C+N PG F C+C  GYE     G C D+NE  L+   C   G+CVN  GS+ C C   F  + N + + C+D     S  C+     +   G   C  E G  +S+   + C     C+L    G   ++C  +  S Y   C   EG++ +      L+D       P G CQ   CIN  G  +C C  GY ++ +D R+C D NEC          C N +G +TC C
Sbjct: 1053 CRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRG-----GVCHNTEGSYRCEC--PPGHQLS-PNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNIC-VFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-CLDPTTC-ISGNCVNTPGSYICDCPPDF--ELNPTRVGCVDT---RSGNCYLDIRPRGDNGDTACSNEIGVGVSKA--SCC-----CSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPI-TVILEDIDECQELP-GLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCIC 1674          

HSP 3 Score: 235.343 bits (599), Expect = 8.879e-61
Identity = 204/604 (33.77%), Postives = 284/604 (47.02%), Query Frame = 0
Query:  426 DKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLM-DETECFD--------------------------KDECEMDNGG-----CEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEFKN--GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            D+     C    G  +  D    D+DEC  +P++C H  C N  G+Y C+C  G+   G  CVD +EC + N   PC +  CKNV GG++C C  G  PG  +      TC     C  N   C+  C+++Y    C CP GY L ED + C D +EC  G   C  K   C N+ G+  C C  GY+    G+ C D NEC+T+  IC++  C+NT GS  C C  GF    ++ EC D                          K EC  D G      CE         F+  C  G    T+     D +EC + I +    G+C+N  GS++C C  G+  ++   SC+D+NEC  +    +  C N EG+Y+C C  GYI      +C D++EC   ++ C    C+N   G++C C  G+      C D +EC  D N CG  G C N PGSF C+C  G+        C D++E   E +    HG C N  G + C C QG++      N C+D +ECLS+  C  + C NTLG ++C+C  GF   E     C+DINEC      CS  C N  G + C C  GY +  +G+C 
Sbjct: 2104 DEAFRQICPYGSGIIVGPDDSAVDMDEC-KEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGN---PCGNGTCKNVIGGFECTCEEGFEPGPMM------TCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG---ADIDECKV-IHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHTSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDE--CEGNHRCQHG-CQNIIGGYRCSCPQGYLQ-HYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQY-EQFSGGCQDINECGSAQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCV 2687          

HSP 4 Score: 223.402 bits (568), Expect = 3.993e-57
Identity = 261/832 (31.37%), Postives = 369/832 (44.35%), Query Frame = 0
Query:  369 YAF-DPSKPDTLFCSERRWIGKRPLCVAKSTLEIA--DPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQG--TACVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLP-----GTQLSDKDNHTC---ISDEACQVNNGGCS--HECIHSYN----------QIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAH------CTCKAGFDLMDETEC----------------------------FDKD--ECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL--CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNN----GGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            YAF +P +P    C  +     + LC +   +  A  D +  + DPD+     CE++    +G T  C C+ G+ ++  G+ C D++ECV +  LCD+  C N PG+++C C  GF  +     C DI+EC       PC +  CKN  G + CEC          T   +    TC   + D  C++N  G +   +C  S            Q+  +C  GY   +  + C DI+EC      C N  C+N  GS  C+C SG      G  C DI          D  C       H      C+  A +   +  EC                            F KD  EC+M    C    C N  G+F+C C  GF L+++   CTD +EC I    CG  G C+NTPG F C+C  G+E   +M  +CMDI+EC  +  LC  G C+N EG+Y C+C  G+    + S C+DINEC  +   C +G C+N    Y C+C+ GY    +   C D DEC   N  G    C N  GS++C C PG+        C DI+E     + C   G C N  G + C+C+ GF+  + D   C+D +EC  +P  C    C+NT G F C C+ G++  +     C DINEC +   +C +  VC N  GS  C C  G+  D    C   DEC         C Q   C N  G  +C C  GY   + D   C D +EC+ N   C +  C+N  GG+ C C +GF P   + + C     CS+ N    G C ++      GL  RC C  G++L      C  +
Sbjct:  690 YAFGEPCQP----CPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENL----RG-TYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECE----SSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQ-CEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCG-RGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNG-GCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASE-DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYS-GKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGI-KCTDLDECSNGTHM---CSQHADCKNTMGSYRCLCKEGY---TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVP-SADGKACEDIDECSLPNICVFGTCHNL-----PGL-FRCECEIGYELDRSGGNCTDV 1488          

HSP 5 Score: 220.705 bits (561), Expect = 2.686e-56
Identity = 238/796 (29.90%), Postives = 347/796 (43.59%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECG-----GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCP---DGY---------ELDEDWK---------------TCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-IYGDCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLD------INECIRNPCGHGE-----------CINESPGYSCSCH----SGYVDVDNVC----------RDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS---ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP---------SNGYYRCNKKKVSGYFVKGTK 1138
            C+C++G+ +  DG  C D++EC+ +P  C    C N  G+Y C C  G++ Q   C DI+EC+           C N +G ++C C         G +  D     C +    +   G CS     ++++  C C    +G+         E DE ++               + VD++EC   D+    +C+N  GS  C+C  GY   G++C D +EC   +   +  C N  G   CTC+ GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C DE+EC  G  +C     +C N  G++ C C PG++   D   C+D NEC T   +C +G C N  G+Y C+C+ G+    +   CLD        E ++N C  G            C +   G+   C      G V    +C           D DEC   +     G+C N  GS+ C C  GY  +     C D+NE +    PC  +  C N +GS++C C +G+I  Q D   C D DEC +    H+    C NT+GGF C C  GF        +C D NEC  +   C    +C N  GS  C C  G+  D+ G +C   DEC  + R    CQ  C NI GG +C C  GY+   Q  + CVD+NEC   +     +C N LG + C C  GF+  E+    C     C      CS+ C +TE G  + C CP G+  +     C    G+    P P         S     C + K++GY  +G K
Sbjct: 1956 CQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECV-EEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYA----KFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPC--NFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQ--HNCQFLCVNTIGGFTCKCPPGFTQHHT---SCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGNHR----CQHGCQNIIGGYRCSCPQGYLQHYQWNQ-CVDENECLSAHICGGASCHNTLGSYKCMCPAGFQ-YEQFSGGCQDINECGSAQAPCSYGCSNTEGG--YLCGCPPGY-FRIGQGHCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECKINGYPKRGRK 2729          

HSP 6 Score: 218.394 bits (555), Expect = 1.143e-55
Identity = 236/770 (30.65%), Postives = 334/770 (43.38%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT-SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGY--EGDDCSDINECETQDLICD-HNCINTEGSAHCTCKAGFDL---------MDETECFDKDE------------------CEMDNGG----CEQVCNNLEGTFQ--CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDEC---LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID------FDECLSSPC-FHSECKNTLGGFECLCETG---------------FALSEILPN------TCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACS--VNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C H   +D   +  C CH GF  NDD   C D++EC  D    +  C N  G++ C C  GF  S    C+D++EC   NG+     +C N  G +QC+C                                             +GYE+  D +TCVDINEC+    +C    C N+ GS  C C  GY  + + C DI+EC  +  IC    C NTEGS  C C  GF L         +  + C+ K E                  C +   G    CE      +  F+  C    G  +  D+ +  D +EC     +   +G CINT GS+ CEC  G+ L  + C+D +EC+    CG+G+C N+ G +EC C+ G+      TC DINEC +NP  C    C+N    Y C C  GYV  ++  +C+D DEC    HD       +C N  G++ C C PGY+ +     C D NE   +   C  +G C+N  GS+ C C+ GF    N    C+D      F E L + C   S  +N +   EC C+ G                A  ++ P+         DI+EC + +  C    CVN  GS++C C  GY  D  G +C   +EC  + +P   C  +C N  G  +C C  GYI+  +D R C D +EC      CQ  C+N +GG TC C  GF    ++   C+    C+  +N  G   IC++T       C C  GF L     +C+ +
Sbjct: 1860 CSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERD-ACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCN--------------------------------------------EGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDD-SAVDMDECK--EPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCT-EKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGIC-ENGRCLNTRGSYTCECNDGFTASPNQDE-CLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKP---CNFICKNTEGSYQCSCPKGYIL-QEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFT---QHHTSCIDNNECTSDINLCGSKGICQNTPGSF--TCECQRGFSLDQTGSSCEDV 2568          

HSP 7 Score: 201.83 bits (512), Expect = 1.421e-50
Identity = 237/768 (30.86%), Postives = 326/768 (42.45%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINE--CV--------TGDIQCLNKCMNVPGSAYCKCDSGYEG----DDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF-DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENEC-TIGIANCGIYGDCINTPGSFYCECHPGFELME--DSCMDINE--CTNSTLCGSGSCN----------------NLEGTYECKCDS------------------GYIFHNSTCL--DINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN-GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRR--PNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI----------GGICSSAPRPSN 1119
            C C +G+   D   C D+DEC ++  LC +  C N PG Y C+C +GF  ++ G AC DI+EC L N    C    C N+ G ++CEC    G +L D+    C     C       S  C+++     C CP  +EL+     CVD     C          GD  C N+       A C C  G       + C  +N  E + L              C    GF     T    D DEC+   G C+   C N  G+FQC C  G++LN D   C D NEC T GI  CG  G C NT G++ C C P +  +   ++CMD+    C  +    + +C+                N+   +   C+                   G++    T L  DI+EC   P  C +G CIN    + C C  G+   D   VC D DEC +   C    +C N  GS+ CDC PGY F + G C+D NE     + C  HG C++  GSF C+CH GF    +D  +C+D +EC    C +  C+NT+G F C C  GF LS    N C D++ECA  NG+  +   C+N +GS  C+C EGY+    G  C   +EC L  R    G CQ    N+ G  +C C PGY + ++    C D +EC                              + PE C                C +TE     +C+CP GF L +  R C+ +          GG CSS P+  N
Sbjct: 1389 CLCKEGY-TGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPN---ICVFGTCHNLPGLFRCEC--EIGYEL-DRSGGNCTDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKIL--------------CPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGI--CGP-GTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICS-HGQCIDTVGSFYCLCHTGF-KTNDDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSH--NNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQ----NLDGSYRCICPPGYSLQNEK---CEDIDECV-----------------------------EEPEICALG------------TCSNTEGSF--KCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSS-PKSRN 2077          

HSP 8 Score: 194.512 bits (493), Expect = 2.288e-48
Identity = 243/829 (29.31%), Postives = 334/829 (40.29%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKC----DSGYEGDDCSDINE---------------------------CETQDLICDHNC----INTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF----HSECKNTLGG------------------------------FECLCET--GFALSEILPNT--CEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY------------IVDSQ-DPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEK--CVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            CEC+ GF L+  GEC DVDEC  +P      C N  G+Y C CR G+ S    T C DI+ECL  NG       C N DG + C C    G  ++ +D   C   + C + N   +  CI+      C+C  G++L  D + C DINEC T  I    +C+N  GS  C+C      G +G  C D +                            C + +      C              C +G  +       D +EC +D   C   +C NL GT++C C  G+ +++    C D NEC +    C   G C NTPGSF C C  GF    D  +C DI+EC  S+ C +G C N  G++ C+C S      +  + I E I+     G C        C  +     + + C         +PC +   C   P      C  GY   K   C DI+E  +    C  +G CVN  GSF+C C  G   D     IC+D        CF      EC   + G                              +E LC    GFA  EI       +DINEC +    C+   C N +GS  CRC  G+  D E  NC   DECR+S  P+   +  C+N PG  +C+C+ GY            I + Q DP L                             C+D NEC ++   C +  C+N +G + C+C+ G+      P++  CV    CS+ NGGC   C ++E    + C C  GF L  D R+C  I           GG C++ P    G YRC
Sbjct:  474 CECNKGFQLDLRGECIDVDECEKNP-CAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECL-QNGRICNNGRCINTDGSFHCVCNA--GFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGS--DINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCD-NGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDEC-ESSPCINGVCKNSPGSFICECSSESTLDPTKTICI-ETIK-----GTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTL---CQVDP-----ICGKGYSRIKGTQCEDIDECEVFPGVC-KNGLCVNTRGSFKCQCPSGMTLDAT-GRICLDI---RLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRIS--PDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGY---HSTPDRLFCVDIDECSIMNGGCETFCTNSEG--SYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP----GEYRC 1263          

HSP 9 Score: 179.874 bits (455), Expect = 7.916e-44
Identity = 168/504 (33.33%), Postives = 233/504 (46.23%), Query Frame = 0
Query:  589 KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFD-LMDETECFDKDECEMDNGGCEQVCN-----NLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECIRNPC----GHGECINESPGY----SCSCHSGYVDVDNVCR-------------------------DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN--GXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALS-------EILPNTC-----EDINECALNNGDCSQVCVNILGSHY------CR----CYEGYKKDERGNCFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVD 1021
            +C+  PGS  C+C+ G++ D   +C D++ECE ++      CIN +GS  C C+AG+   +  TEC D DEC + NG   ++CN     N +G+F C C  GFH+  D   C D +EC+  I N  + G CIN  GSF C C PGF+L  D   C DINEC    +C +G C N +G+Y C+C  G         C+D +  +R+ C      G+CI    G      C C S        C+                         D +EC  D      G C N  G++ C C  GYE  +    C DINE  L    C  +G C N  GSF C C +GFI+ + D   C D DEC SSPC +  CKN+ G F C C +   L        E +  TC     +   E  +N       C + LG+ +      C+    C +GY + +   C   DEC +     G C+  LC+N  G  KC+C  G  +D+   R+C+D
Sbjct:  464 RCIPTPGSCRCECNKGFQLDLRGECIDVDECE-KNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDEC-LQNG---RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECS--IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTH--MRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFIY-KPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFP---GVCKNGLCVNTRGSFKCQCPSGMTLDATG-RICLD 952          

HSP 10 Score: 138.658 bits (348), Expect = 2.305e-31
Identity = 154/506 (30.43%), Postives = 216/506 (42.69%), Query Frame = 0
Query:  616 CETQDLICDHN-CINTEGSAHCTCKAGFDLMDETECFDKDECEMD--NGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINEC-IRNPCGHGECINESPGYSCSCHSGY-VDVDN-VCRD------------YDECLH--------------------DNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDE---------RGNCF---LKDECRLSRRPNGGCQQLCINIPGGLK-----CECNP--GYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPD 1054
            C+    +C +  CI T GS  C C  GF L    EC D DECE +   GG    C N +G++ C C+ G+        C D +EC      C   G CINT GSF+C C+ GF +  D  +C D++EC+   +C +G C N +G+++C C  G+   +    C DINEC     C +G C+N    Y C C  G  V +D  VC D              +C+                       PC      N+      C   PG         DINE +L+ D C P+G C N  G+++C+C+ G+  D    N C+D +EC+  S  C + +C+NT G F C C  GF     L  TCEDI+EC  +   NG    VC N  GS  C C      D          +G C+   +   C ++        Q C ++          C+ +P  G          C D +EC +  G C++  C+N  G   C C  G   D
Sbjct:  453 CQLVRYLCQNGRCIPTPGSCRCECNKGFQLDLRGECIDVDECEKNPCAGG---ECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICN-NGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAG---SDINECALDPDIC-PNGICENLRGTYKCICNSGYEVDSTGKN-CVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDL-KTCEDIDECESSPCING----VCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLD 944          

HSP 11 Score: 126.716 bits (317), Expect = 1.018e-27
Identity = 149/507 (29.39%), Postives = 216/507 (42.60%), Query Frame = 0
Query:  743 LCGSGSCNNLEGTYECKCDSGYIFH-NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVD--VDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF-KNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF-------LKDECRLSRRPNG---GCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLF-----TCNNGYQITGVKKTRCTRLSE 1226
            LC +G C    G+  C+C+ G+       C+D++EC +NPC  GECIN    Y+C C +GY        CRD DECL +      G+C N  GSF C C  G+   ++G  C D++E S+ ++ C  +G C+N DGSF+C+C  GF    +D   C D +EC +   C +  C NT G + C C  G A+                  G   +VCV+        CY GYK   RG C         K EC  +         CQ          +  C+ G  + S       D NEC ++   C +  C N  G + C C+ G++ D    + CV    C +N+  C +  C++T       C CP GF  K D +TC+ I   C S+P   NG      K   G F+    C+        PT  I  + I    W    D  CE+        ++   +  + C +  +  GS C        C  GY  + +K T+C  + E
Sbjct:  459 LCQNGRCIPTPGSCRCECNKGFQLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSI-RNMC-LNGMCINEDGSFKCICKPGF-QLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAV------------------GLDGRVCVDTHMRS--TCYGGYK---RGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGS----DINECALDPDICPNGICENLRGTYKCICNSGYEVDSTG-KNCVDINECVLNSLLCDNGQCRNTPGSF--VCTCPKGFIYKPDLKTCEDIDE-CESSP-CINGVC----KNSPGSFI----CECSSESTLDPTKTICIETIKGTCWQTVIDGRCEIN-------INGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGY--SRIKGTQCEDIDE 913          

HSP 12 Score: 66.6254 bits (161), Expect = 2.024e-9
Identity = 67/212 (31.60%), Postives = 93/212 (43.87%), Query Frame = 0
Query:  895 DFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRP-NGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            D+ + +   C +  C  T G   C C  GF L   L   C D++EC  N     + C+N  GS+ C+C  GY+    R  C   DEC  + R  N G    CIN  G   C CN G+ V ++D + C D +EC+I N      CIN+ G   C C  GF+    +   C     C       +  C +T+    +RC C  G  +  D R C
Sbjct:  451 DYCQLVRYLCQNGRCIPTPGSCRCECNKGFQLD--LRGECIDVDECEKNPCAGGE-CINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICNNG---RCINTDGSFHCVCNAGFHV-TRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQL-ASDGRYCKDINECETPGICMNGRCVNTDG--SYRCECFPGLAVGLDGRVC 652          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|341940922|sp|Q8K4G1.2|LTBP4_MOUSE (RecName: Full=Latent-transforming growth factor beta-binding protein 4; Short=LTBP-4; Flags: Precursor)

HSP 1 Score: 249.21 bits (635), Expect = 2.424e-65
Identity = 206/585 (35.21%), Postives = 273/585 (46.67%), Query Frame = 0
Query:  511 GYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE--LMEDSCMDINECTNSTLCGSGSCNNLEGTYECK-CDSGYIFHNSTCLDINECIRN-PCG-HGECINESPGYSCSCHSGYVDVD---NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE--FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS---SPCFHSECKNTLGGFECL--CETGFALSEILPNTCEDINEC-ALNNGDC-SQVCVNILGSHYC--RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPE--KCVKAKA 1066
            GY C C   PG +L  +       DE  +V        C ++     C+C  G++       C+D++EC      C   +C N PGS  C C +GY+    G  C D++EC     +C    C N  GS  C C AGF      E  D DEC      C    C+N  G+F C C  GF        C D +EC+   + C  YG C NT GSF C C  GF+       C D++EC N   C    C N  G+++C+ C  G+  H   C D++EC    PCG HG+C N    + CSC +GY         C D +ECL  + C   G+C N  GSF C CAPGY    +   C D++E S E+D C   G C N DGSFEC+C  G      D   C+D DEC     + C    C+N+ G + C+  C+ G+        TC+DI+EC    +  C +Q C N  GS+ C   C  GY+    G C   DECR   R   G   +C N+PG  +C C+ GY   ++D R CVD NEC    G C  A C N  G   C C     P+E +P   +CV  +A
Sbjct:  610 GYTCACD--PGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACEE--DVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPC-AYGRCENTEGSFKCVCPTGFQPNAAGSECEDVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECS-EEDLCQ-SGICTNTDGSFECICPPGH-RAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPE--GTCDDIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECR--NRSFCGAHAMCQNLPGSFQCVCDQGY-EGARDGRHCVDVNECETLQGVCGSALCENVEGSFLCVCP--NSPEEFDPMTGRCVPPRA 1179          

HSP 2 Score: 232.646 bits (592), Expect = 3.119e-60
Identity = 202/587 (34.41%), Postives = 271/587 (46.17%), Query Frame = 0
Query:  453 CVDDPELCDH-ICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGYEGDDC-SDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDE-TECFDKDECEMDNGGCE-QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCE-CHPGFELMEDSCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIF---HNSTCLDINECIRN----PCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN--GXCHDINEXSLEKDP--CGPHGDCVNNDGSFECV--CHQGFIHDQNDSNICIDFDECL---SSPCFHSECKNTLGGFEC--LCETGFALSEILPNTCEDINECALNNGDCS--QVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCEC 1005
            C  +P++C    C  +P  Y C C  GF    QGT C+DI+EC       PC    C+N  G ++C CG   G Q   +       DE  +V        C ++     C+CP GY+      +C D++EC      C    C N+PGS  C C +G+ G  C  D++EC  Q   C    C NT GS HC C AGF        C D DEC      C    C N EG+F+C C  GF  N     C D +EC   +A  G   +C+N+PGSF C  C  G  L    C D++EC++ T CG  G C N +G++ C C +GY         C DINEC+      P  HGEC+N    ++C+C  GY        C D DEC  ++ C   G C N  GSF+C C PG+        C DI+E   E+ P  CG    C N+ GS+ CV  C  G+         C D DEC    S+ C    C+NT G + C   C+ G+  +      C+D++EC  N   C    +C N+ GS  C C +GY+    G +C   +EC   +   G    LC N+ G   C C
Sbjct:  592 CQRNPQVCGPGRCVPRPSGYTCACDPGFRLGPQGTRCIDIDEC--RRVPTPCAPGRCENTPGSFRCVCGT--GFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTEGSFKCVCPTGFQPNAAGSECEDVDECENRLACPGQ--ECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFP--HGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEEDLC-QSGICTNTDGSFECICPPGHRAGPDLASCLDIDE-CRERGPALCGSQ-RCENSPGSYRCVRDCDPGY--HPGPEGTCDDIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPG--GGCQDVDEC-RNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCG--SALCENVEGSFLCVC 1160          

HSP 3 Score: 229.565 bits (584), Expect = 2.525e-59
Identity = 205/613 (33.44%), Postives = 267/613 (43.56%), Query Frame = 0
Query:  534 SDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCL-NKCMNVPGSAYCKCDSGYEGD----DCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDE-TECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNS-TLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECI-RNPCGHGECINESPGYSC-SCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX---CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP-CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC--SQVCVNILGSHYC--RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC--ECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDAR------TCKPIGGICSSA 1114
            S   CQ N   C    C+   +   C C  G+ L      C+DI+EC      C   +C N PGS  C C +G++      +C D++EC      CD   C NT GS  C C AG+        C D DEC    G C + VC NL G+F+C C  GF  +       D +EC      CG  G C NT GSF+C C  GF        C D++EC+ S + C  G C N EG+++C C +G+      S C D++EC  R  C   EC+N    + C +C  G+      C D DEC    PCG+ G+C N  GSF C C+ GY   +G    C DINE  LE D C PHG+C+N DGSF C C  G+      ++ C+D DEC     C    C NT G FEC+C  G      L  +C DI+EC         SQ C N  GS+ C   C  GY     G C   DECR       G Q+ C N PG  +C   C+PGY                    GGCQ                         ++C     C     G   +C++        C+C  G++   D R       C+ + G+C SA
Sbjct:  588 SSSMCQRNPQVCGPGRCVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACE---EDVDECAQQPPPCGP-GRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTEGSFKCVCPTGFQPNAAGSECEDVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINE-CLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGAS-CLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDL-ASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDDIDECREYGSAICGAQR-CENTPGSYRCTPACDPGYQ---------------PTPGGGCQDV-----------------------DECRNRSFC-----GAHAMCQNLPGSFQ--CVCDQGYEGARDGRHCVDVNECETLQGVCGSA 1147          

HSP 4 Score: 194.897 bits (494), Expect = 1.215e-48
Identity = 156/446 (34.98%), Postives = 201/446 (45.07%), Query Frame = 0
Query:  708 GDCINTPGSFYCECHPGFELMEDS--CMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCH-DINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-------GGICSSAP-RPSNGYYRCNKKKVSGY 1132
            G C+  P  + C C PGF L      C+DI+EC    T C  G C N  G++ C C +G+      + CLD++EC R   PC  G C N    + C C +GY    +   C+D DEC         G C N PGSF C C  G  F+   C  D++E + +  PCGP G C N  GSF C C  GF   +     C D DEC    SPC +  C+NT G F+C+C TGF  +    + CED++EC        Q CVN  GS  CR         RG C   DEC  S     G    C N  G   C C+ GY   S  P  C D NEC   +    H  C+N  G  TC+C  G++P  +    C+    CS  +   S IC +T+      C+CP G +   D  +C  I         +C S     S G YRC +    GY
Sbjct:  602 GRCVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAG--FRGSACEEDVDECAQQPPPCGP-GRCDNTAGSFHCACPAGF-RSRGPGAPCQDVDECSRSPSPCAYGRCENTEGSFKCVCPTGFQPNAAG-SECEDVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTDVDEC--SSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRG-ASCLDVDECSEEDLCQSGICTNTDGSFE--CICPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGY 1037          

HSP 5 Score: 188.734 bits (478), Expect = 9.559e-47
Identity = 177/502 (35.26%), Postives = 233/502 (46.41%), Query Frame = 0
Query:  412 DVQEKKRCEHICYLDKGV---TP---TCECHDGFFLNDDG-ECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTAC-VDINECLLNNGHGPC-QDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCK-CDSGY--EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDLM--DETECFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECT-IGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC--TNSTLCGSGSCNNLEGTYEC--KCDSGY-IFHNSTCLDINECIR---NPCGHGECINESPGYSC--SCHSGYVDV-DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE-FKNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC 879
            DV E +R    C  D+G    TP    C C  G+     G  C+DVDEC   P LC   +C N PG++ C C  GF  +G+AC  D++EC       PC    C N  G + C C   P    S      C   + C  +   C++  C ++     C+CP G++ +     C D++EC         +C+N PGS  C+ C  G+      C+D++EC +      H  C NT+GS HC+C  G+         C D +EC E D       C N +G+F C C PG+       +C D +EC+   +   GI   C NT GSF C C PG     D  SC+DI+EC      LCGS  C N  G+Y C   CD GY      TC DI+EC       CG   C N    Y C  +C  GY       C+D DEC + + CG    C N PGSF C C  GYE  ++G  C D+NE    +  CG    C N +GSF CVC
Sbjct:  672 DVDECRRVPPPC--DRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGF--RGSACEEDVDECAQQP--PPCGPGRCDNTAGSFHCAC---PAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTEGSFKCVCPTGFQPNAAGSECEDVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEEDLCQSGI---CTNTDGSFECICPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDDIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCG-SALCENVEGSFLCVC 1160          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|160410003|sp|Q8N2S1.2|LTBP4_HUMAN (RecName: Full=Latent-transforming growth factor beta-binding protein 4; Short=LTBP-4; Flags: Precursor)

HSP 1 Score: 247.284 bits (630), Expect = 9.038e-65
Identity = 217/646 (33.59%), Postives = 286/646 (44.27%), Query Frame = 0
Query:  453 CVDDPELCD-HICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE--LMEDSCMDINECTNSTLCGSGSCNNLEGTYECK-CDSGYIFHNSTCLDINECIRN--PCG-HGECINESPGYSCSCHSGYVDVDN---VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS---SPCFHSECKNTLGGFECL--CETGFALSEILPNTCEDINECALNNGDC--SQVCVNILGSHYC--RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPE--KCVKAK 1065
            C  +P++C    C ++P  Y C C  GF  + QGT C+D+             DEC+ V           PG                           C +S     C+C  G+        C+D++EC      C L +C N PGS  C C +GY+    G  C D++EC     +C    C N  GS  C C AGF      E  D DEC  +   C    C+N  G+F C C  GF        C D +EC      C  YG C NT GSF C C  GF+       C D++EC N   C    C N  G+++C+ C SG+  H   C D++EC     PCG HG C N    + CSC  GY         C D +ECL  + C   G+C N  GSF C CAPGY    +   C D++E S E+D C   G C N DGSFEC+C  G      D   C+D DEC     + C    C+N+ G + C+  C+ G+        TC+D++EC     +   +Q C N  GS+ C   C  GY+    G C   DECR   R   G   +C N+PG  +C C+ GY   ++D R CVD NEC    G C  A C N  G   C C     P+E +P   +CV  +
Sbjct:  549 CQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDV-------------DECRRVPPPC------APG--------------------------RCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACEE--DVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPC-TYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECS-EEDLCQ-SGICTNTDGSFECICPPGH-RAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPE--GTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECR--NRSFCGAHAVCQNLPGSFQCLCDQGY-EGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCP--NSPEEFDPMTGRCVPPR 1136          

HSP 2 Score: 223.787 bits (569), Expect = 1.492e-57
Identity = 186/563 (33.04%), Postives = 257/563 (45.65%), Query Frame = 0
Query:  588 NKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDLMDET-ECFDKDECEMDNGGCE-QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCM-DINECTNSTL-CGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNP--CGHGECINESPGYSCSCHSGYVD--VDNVCRDYDECLHDNPCGVGGKCNNKPGSFDC-DCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP-CF-HSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC--ECNPGYIVDSQDPRLCVDKNECTINNG---GCQHACINKLGGHTC--SCHLGFKPDE----KNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDAR------TCKPIGGICSSA 1114
             +C++ P    C CDSG+    +G  C D++EC      C    C N+ GS  C C  GF       EC D DEC      C+   C N  G+F C C  G+       +C D +ECT     CG  G C N PGSF C C  GF     +C  D++EC      CG G C+N  G++ C C +G+      + C D++EC R+P  C +G C N    + C C  G+      + C D DEC +   C  G +C N PGSF C  C  G+    G C D++E S    PCGPHG C N +GSF C C  G+         C D +ECL    CF H EC NT G F C C  G+        +C D++EC+  +   S +C N  GS  C C  G++   +  +C   DECR  R P     Q C N PG  +C  +C+PGY    +    C D +EC        G Q  C N  G + C  +C  G++P      ++ ++C     C     G   +C++        C+C  G++   D R       C+ + G+C +A
Sbjct:  559 GRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCG-RGACKNLPGSFRCVCPAGFR--GSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLAC-PGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRG-ASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECR-ERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEG--TCDDVDECQEYGPEICGAQR-CENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFC-----GAHAVCQNLPGSFQ--CLCDQGYEGARDGRHCVDVNECETLQGVCGAA 1105          

HSP 3 Score: 185.652 bits (470), Expect = 7.706e-46
Identity = 167/481 (34.72%), Postives = 223/481 (46.36%), Query Frame = 0
Query:  433 CECHDGFFLNDDG-ECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTAC-VDINECLLNNGHGPC-QDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCK-CDSGY--EGDDCSDINECETQDLICD--HNCINTEGSAHCTCKAGFDL--------MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECT-IGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC--TNSTLCGSGSCNNLEGTYEC--KCDSGY-IFHNSTCLDINECIR---NPCGHGECINESPGYSC--SCHSGYVDV-DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE-FKNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC 879
            C C  G+     G  C+DVDEC   P LC    C N PG++ C C  GF  +G+AC  D++EC       PC    C N  G + C C   P    S      C   + C  +   C++  C ++     C+CP G++ +     C D++EC         +C+N PGS  C+ C SG+      C+D++EC +    C    +C NTEGS  C+C  G+           D  EC + D C   +G     C N +G+F C C PG+       +C D +EC+   +   GI   C NT GSF C C PG     D  SC+D++EC      LCGS  C N  G+Y C   CD GY      TC D++EC       CG   C N    Y C  +C  GY       C+D DEC + + CG    C N PGSF C C  GYE  ++G  C D+NE    +  CG    C N +GSF CVC
Sbjct:  654 CVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGF--RGSACEEDVDECAQEP--PPCGPGRCDNTAGSFHCAC---PAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFC-FPHG----ECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGI---CTNTDGSFECICPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCG-AALCENVEGSFLCVC 1118          

HSP 4 Score: 123.25 bits (308), Expect = 1.026e-26
Identity = 110/334 (32.93%), Postives = 143/334 (42.81%), Query Frame = 0
Query:  777 CIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTC-SCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKT 1099
            C RNP  CG G CI+   GY+C+C SG+        C D DEC    P    G+C N PGSF C C PG+    +   C D++E      PC   G C N  GSF CVC  G+    + ++ C D DEC  SP  C    CKN  G F C+C  GF  S       ED++ECA     C    C N  GS +C C  G++    G  C   DEC  +R P       C N  G  +C C  G+  ++     C D +EC  +       C+N  G   C +C  G         +C     CS     C      T +    RC C  G++  +
Sbjct:  549 CQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCD-LGRCENTPGSFLCVCPAGYQAAPHGAS-CQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACE----EDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDEC--ARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSE-CEDVDECENHLACPGQECVNSPGSFQCRTCPSGHHLHRG---RCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPS 870          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|341940690|sp|Q61555.2|FBN2_MOUSE (RecName: Full=Fibrillin-2; Contains: RecName: Full=Fibrillin-2 C-terminal peptide; Flags: Precursor)

HSP 1 Score: 244.973 bits (624), Expect = 1.048e-63
Identity = 220/648 (33.95%), Postives = 306/648 (47.22%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCE-QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGS--GSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCG-PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL-CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSC 1047
            C C++GF L+ ++  C D+DEC   P+LC   IC N PG++ C+C  G+ S       C+DI+EC    LL  G       C N +G +QC+C   P           C+    C +++  C + +C++      C C  GY+   D + C DI+EC+  +  C  +C N  GS  C C  GY    +G  C+DI+ECE    ICD   C N  G   C C  GF   MD   C D +EC+++   C    C N +G+F C C+ G+ +      CTD +EC IG  NC ++  C+N PGSF C C  G+      C+D++EC N T   S    C N  G+Y C C  G+     TC D++EC  N   C +G+C+N    Y C C  G+    +   C+D DEC   N C V G CNN PG F C C  GYE     G C DI+E +   DP    +G CVN  G +EC C   F  +      C+D        C+        G   C  E G  +S    + C     C+L    G+  + C  +  + Y   C   EG++ +      L+D       P G CQ   CIN  G  +CEC  GY + S++ R+C D +EC  + G C    C N LG +TC C
Sbjct: 1091 CRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRG-----GTCVNTEGSFQCDC---PLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNIC-VFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA---DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVG-CVDN---RVGNCYLKFGPRGDGSLSCNTEVGVGVSR--SSCC-----CSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPI-TIILEDIDECQELP-GLCQGGNCINTFGSFQCECPQGYYL-SEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCIC 1712          

HSP 2 Score: 239.965 bits (611), Expect = 2.876e-62
Identity = 247/758 (32.59%), Postives = 346/758 (45.65%), Query Frame = 0
Query:  445 GECEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGT--ACVDINECLLNNGHGPCQ--DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECET--QDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEG--TYECKC-------------------DSGYIFHN-------------STCLDINECIRNP--CGHGECINESPGYSCSCHSGY-VDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE-FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS------ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKK---------DERGNCF---LKDECRLSR----------------RPNGGCQQLCINIPGGLK----CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            G+  D+DEC + P +C + +C N+ G++ C+C  GF+       C DI+EC  +NG   CQ   +C N  G Y+CEC    G +LS   N  C+    C      CSH  C+       C+C +G++  +D   C+D++EC      C N  C N  GS  C C  G+E    +DC DI+EC +    +  +  C N  GS  C C  G++L  D   C D +EC    G C    C NLEG+F+C C PG+ + ++N  C D NEC      C ++G C NTPG F C C PGF L ++   C D  +    T   +G C+  +   T + KC                   D    F +              T  D+NEC+ +P  C +G+CIN    + C C  GY +D   V C D DEC   NPCG  G C N  GSF+C C  G+E      C DINE +     C     C+N  GS+EC C  G+   + D  +C D DEC      H        CKN +G F C+C  G A        C D NEC    G C    CVNI+GS+ C C EG++          + +G CF   L+  C+++                 R  G   +LC  +PG  +    C   PGY  D +D       +EC +    C +  C+N +G   C C +G+  D      CV    CS +   C+ ICK+T+    ++C CP G+ L+ D +TCK +
Sbjct: 1797 GKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDEC--SNGDNLCQRNADCINSPGSYRCECAA--GFKLSP--NGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERH--PCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSEN--CIDINECDEDPNIC-LFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFR--CMNTFGSYECTCPVGYAL-REDQKMCKDLDECAEG--LHDCESRGMMCKNLIGTFMCICPPGMARRPD-GEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCP-LPGTAQYKKICPHGPGYATDGRD------IDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISG-TACVDLDECSQSPKPCNFICKNTKG--SYQCSCPRGYVLQEDGKTCKDL 2526          

HSP 3 Score: 235.343 bits (599), Expect = 9.411e-61
Identity = 264/832 (31.73%), Postives = 364/832 (43.75%), Query Frame = 0
Query:  398 TLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLS-------DKDNHTC---ISDEACQVNNGGCS--HECIHSYNQIF----------CLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINE----CETQDLICDHNCINTEGSAHCTCKAGFDLMDE-TEC-----------------------------FDKD--ECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNV--CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALS------------EILPNTCE----------------------------DINECALNNGDCS--QVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            T++  D +  + DPD+     CE++    +G +  C C+ G+  +  G  C D+DEC+ +  LCD+ +C N PG+Y C C  G  F ++   C D+NEC  N    PC +  C+N  G + CEC   PG++LS       D    TC   I D  C+VN  G +   EC  +    +            CP G+   +   TC D+NEC      C N +C+N  GS +C+C  G      G  C DI       +  +  C H          C C  G     E  EC                             F KD  EC+   G C    C N  G+F+C C  GF L+ +   CTD +EC I    CG  G C+NTPGSF CEC  G+E   +M  +CMDI+EC  N  LC  G+C N EG+++C C  G+    S   C+DINEC    N C +G+C+N    Y CSC+ GY    +   C D DEC+  N  G   +C N  GS++C C+ GY        C DI+E     D C   G C N  G + C+C+ GF+    D   CID +EC  +P  C   EC+NT G F C C+ G+++             EI  + C+                            D++ECA     CS    CVN  GS+ C C EG+  D    C   DEC  +   N      C+N+PG  +CEC  G+   S D R C D +EC+  N      C N  G   C C  G++ D +    C     C+      + +C +T     + C CP  F+L      C
Sbjct:  756 TVDGRDINECALDPDICANGICENL----RG-SYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESN----PCVNGACRNNLGSFHCECS--PGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGV-TCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNG-GCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASM-DMKTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGF-TCSDVDEC--AENTNLCENGQCLNVPGAYRCECEMGFTPAS-DSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELD-RTGGNCTDIDECADPINCVNGLCVNTPG--RYECNCPPDFQLNPTGVGC 1564          

HSP 4 Score: 229.95 bits (585), Expect = 3.831e-59
Identity = 245/748 (32.75%), Postives = 326/748 (43.58%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEA-CQVN--NGGCSHECIHSYNQIFC---------------------------LCPDGY-ELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYG-DCINTPGSFYCECHPGFELMED--SCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLD------INECIRNPCGHGE-----------CINESPGYSCSCH----SGYVDVDNVC----------RDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS---ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF 1095
            C C++G+ L  DG+ C D +ECV  P  C    C N  G++ C C  G+  +   C+DINEC  +     C    C N  GG+QC C   PG  LSD       + ++ C  N  NG CS     +  +  C                           LCP G+  +     T  D+NEC+     C N +C+N  GS  C+C  GY     G  C D +EC   +   +  C N  GS  CTC  GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C D +EC  G+ +C   G  C N  G+F C C PG     D   C+D NEC T   +C +G C N+ G+Y C+C+ G+   +S   CLD        E ++  C               C +   G+   C      G      +C          RD DEC         G+C N  GSF C C  GY  +     C D++E S    PC  +  C N  GS++C C +G++  Q D   C D DEC +    H+    C NTLGGF C C  GF         C D NEC      C    +C N  GS  C C  G+  D  G NC   DEC  + R    CQ  C NI GG +C C  GY+   Q  + CVD+NEC+ N G C  A C N LG + C+C  GF  D+ +   C     CS +   CS+ C +TE G  + C CP G+
Sbjct: 1992 CLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSENCIDINEC--DEDPNICLFGSCTNTPGGFQCIC--PPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPC--NFICKNTKGSYQCSCPRGYVL-QEDGKTCKDLDECQTKQ--HNCQFLCVNTLGGFTCKCPPGFTQHHT---ACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGNHR----CQHGCQNILGGYRCGCPQGYVQHYQWNQ-CVDENECS-NPGACGSASCYNTLGSYKCACPSGFSFDQFS-SACHDVNECSSSKNPCSYGCSNTEGG--YLCGCPPGY 2718          

HSP 5 Score: 214.542 bits (545), Expect = 1.744e-54
Identity = 187/585 (31.97%), Postives = 278/585 (47.52%), Query Frame = 0
Query:  448 EDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDE-TECFD--------------------------KDECEMDNG-GCEQVCN--NLEGTFQ----CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            EDV+EC++ P +C +  C N  G++ C+C +G+     G  CVD +EC + N   PC +  C NV G ++C C  G  PG  ++ +D + C  +         C+  C++++    C CP GY L ED K C D++EC  G   C ++   C N+ G+  C C  G     +G+ C D NEC T+  IC++  C+N  GS  C C  GF      TEC D                          K EC  D G G    C    L GT Q    C   PG+  +  ++     +EC +  + C   G C+NT GSF C C  G+  ++   +C+D++EC+ S    +  C N +G+Y+C C  GY+      TC D++EC  +       C+N   G++C C  G+      C D +EC    + CG  G C N PGSF C+C  G+        C D++E          HG C N  G + C C QG++      N C+D +EC +   C  + C NTLG ++C C +GF+  +   + C D+NEC+ +   CS  C N  G + C C  GY +  +G+C 
Sbjct: 2163 EDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGN---PCGNGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLL------CAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDI-----DECKVMPSLC-TNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPCNFICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGNHRC--QHG-CQNILGGYRCGCPQGYVQ-HYQWNQCVDENECSNPGACGSASCYNTLGSYKCACPSGFSFDQ-FSSACHDVNECSSSKNPCSYGCSNTEGGYLCGCPPGYFRVGQGHCV 2727          

HSP 6 Score: 209.92 bits (533), Expect = 4.896e-53
Identity = 249/841 (29.61%), Postives = 356/841 (42.33%), Query Frame = 0
Query:  448 EDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTA-CVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFD---KDEC--EMDNGGC-----------EQVCNNLEGTFQCGCKP---------------GFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE--LMEDSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSC-------HSGYVDVDNVCRDYDECLHDNPCGVG-------GKCNNKPGS----------FDCDCAPGY-EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDF-----------DECLS---------------SPCFHSEC----KNTLGGFECLCETGFALS---EILPNT--CEDINECALNNGDCS-QVCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGY---------IVD----SQDPRL-----------------------------CVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFK--PDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI-----------GGICSSAPRPSNGYYRC 1124
            + +D C     LC +  C     +Y C+C +G+       C+D++EC  N    PC + +C N  G Y C+C    G Q +      CI  + C  N   C +  C+++     C+C  G+EL  D K CVD +EC T ++ CLN  C+N  GS  C C  G+     G  C+D++EC+T  +  + +CIN EGS  C C  G  + +D   C D   +  C  E+  G C           E  C N +  F   C+P               G  +  D     D NEC +    C   G C N  GS+ C C+ G+E      +C+DI+EC  N  LC +G C N  G+Y C C  GY+F     TC D+NEC  NPC +G C N    + C C        +G + +D++       + DN C V         +C    G+           D  C  G+   K   C D+NE  +    C P+G CVN+ GSF C C +G   D     +C+D            DEC+                   + +EC    K     +E LC  G   +   +IL      +DINEC    G C+   C N +GS  CRC  G+  D E  NC   DECR+S    G    +C+N PG  +CEC  GY          +D     ++P L                             CVD NEC++++  C++  C+N +G + CSC+ G++  PD +    C     C + NGGC   C ++E    + C C  G+ L  D R+C  I           GG C++ P    G YRC
Sbjct:  486 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSN----PCSNGDCVNTPGSYYCKCHA--GFQRT-PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNM-CLNGMCINEDGSFKCVCKPGFILAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDG---RDINECALDPDICA-NGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESNPCVNGACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVC-PNGRCVNSKGSFHCECPEGLTLD-GTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCG--SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQG---CTDIDECMIMNGGCDTQCTNSEG--SYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIP----GEYRC 1301          

HSP 7 Score: 195.282 bits (495), Expect = 1.470e-48
Identity = 238/768 (30.99%), Postives = 325/768 (42.32%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVD--INECLL-----NNGHGPCQDE----------CKNVDGGYQCECGGLPGTQLSD-----------KDNHTCISDE---ACQVNNGGC-SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGYE----GDDCSDINE-----------CETQ--------DLICDHNC----------INTEGSAH----CTCKAGFDLMDET-ECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-SCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFL-------KDECRLSRRPNGGCQQLCINIPGGLK------CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSV----NNGGCSHICKSTESGLHHRCMCPSGFK 1096
            C C DG+ L+   G C D+DEC D     + +C N PG Y C+C   F     G  CVD  +  C L      +G   C  E          C ++   +   C   P    ++           + N   I  E    CQ   G C    CI+++    C CP GY L E+ + C DI+EC      C    C N  G+  C C   Y     G +C D+ +           CE +           C +N             T G+A     C    GF     T +  D DEC+   G C   VC N  G+F+C C  GF  N   L C D +EC+ G   C    DCIN+PGS+ CEC  GF+L  + +C+D NEC     +C  G C +L+G+Y+C C++G+      + C+D++EC R+PCG+G C N    Y+C C+ G+ +  +N C D DEC       C   G+C N+ GSF C C  GYE       C D NE       C P G C N +GSF C+C  G+   +  S  CID +EC   P  C    C NT GGF+C+C  GF LS+               NG   + C +   S    C+  +   E G C +       K +C  S+ P  G    C   P   +      C    G +    D R   D NEC  + G C +  CIN  G   C C +G+  D     +CV    CS+     NG C+++  S E      C C  GF+
Sbjct: 1508 CICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVC-RNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSP-GTCQNLEGSFRCICPPGY---EVRSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSD---------------NG---RRCFDTRQSF---CFTNF---ENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTR--EDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTG-VRCVDTDECSIGNPCGNGTCTNVIGSFE------CTCNEGFE 2237          

HSP 8 Score: 147.132 bits (370), Expect = 6.123e-34
Identity = 194/720 (26.94%), Postives = 286/720 (39.72%), Query Frame = 0
Query:  560 CPDGYELDEDWKTCVDINEC--VTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICD-HNCINTEGSAHCTCKAGF-DLMDETECFDKDE----CEMDNGGCEQVCNNLEGTFQCGCKPG--FHLNTDNLTCTDENE------CTIGIANCGIYGDCINTPGS------------------------------------FYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF-HNSTCLDINECIRNPCGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNC-------FLKDECRLSRRPNGGCQQLCINIPG-------GLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKC 1203
            C  G+  +     C D++EC  + G  Q  N C+N  GS  C+C +G++  +    C DI+EC     +C+  +C NT GS  C C  GF    D + C D+        + NG C Q         QC C+PG  + + T    C           C  G+   GI G  ++ PG                                            G  ++  + +DI +  ++ LC +G C     +Y C+C+ GY    N  C+D++EC  NPC +G+C+N    Y C CH+G+        C D DEC+ +      G+C N  GSF C C  G+E      + ++           +G C+N DGSF+CVC  GFI   N    C D DEC +   C +  C N  G F C C  G A+                  G   +VCV+      C     Y + ++G C         K EC  +  P+ G  + C   P        GL C    G  VD +      D NEC ++   C +  C N  G + C+C+ G++PD      C+    C VN   C + +C++T     + C CP G+  +T+  TC+ +   C S P   NG  R N          G+K           TG I    +    W   +D+ CEV        ++   +  E C T  +  GS C
Sbjct:  261 CRRGFIPNIRTGACQDVDECQAIPGLCQGGN-CINTVGSFECRCPAGHKQSETTQKCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGFVTSTDGSRCIDQRAGTCFSGLVNGRCAQELPGRMAKAQCCCEPGRCWSIGTIPEACPVRGSEEYRRLCLDGLPMGGIPGSSVSRPGGTGSTGNGYGPGGTGFLPIPGDNGFSPGVGGAGVGAGGQGPIITGLTILNQT-IDICK-HHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCVCKPGFILAPN-GRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAV------------------GVDGRVCVDTHMRSTC-----YGEIKKGVCVRPFPGAVTKSECCCA-NPDYGFGEPCQPCPAKNSAEFHGL-CSSGIGITVDGR------DINECALDPDICANGICENLRGSYRCNCNSGYEPDASG-RNCIDIDECLVNRLLCDNGLCRNTPG--SYSCTCPPGYVFRTETETCEDV-NECESNP-CVNGACRNNLGSFHCECSPGSK--------LSSTGLICIDSLKGTCWLNIQDNRCEVN-------INGATLKSECCATLGAAWGSPC 925          

HSP 9 Score: 117.087 bits (292), Expect = 9.294e-25
Identity = 100/327 (30.58%), Postives = 134/327 (40.98%), Query Frame = 0
Query:  342 RRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTL-----FCSERRWIGK----RPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECG---GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF 651
            R + H+     LPG    + +     GYA D    D        C+  + +      R  C    T +I+  +    D   Q  K C  IC   KG +  C C  G+ L +DG+ C+D+DEC      C  +C N  G + C C  GFT   TAC+D NEC         +  C+N  G + CEC     L  + L+ +D   C  +  CQ       H C +      C CP GY     W  CVD NEC          C N  GS  C C SG+  D     C D+NEC +    C + C NTEG   C C  G+  + +  C 
Sbjct: 2409 RGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPCNFICKNTKG-SYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGNHRCQ-------HGCQNILGGYRCGCPQGYVQHYQWNQCVDENECSNPGACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYGCSNTEGGYLCGCPPGYFRVGQGHCV 2727          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|238054385|sp|P35556.3|FBN2_HUMAN (RecName: Full=Fibrillin-2; Contains: RecName: Full=Fibrillin-2 C-terminal peptide; Flags: Precursor)

HSP 1 Score: 244.588 bits (623), Expect = 1.104e-63
Identity = 223/648 (34.41%), Postives = 310/648 (47.84%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS---QGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDH-NCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCE-QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGS--GSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCG-PHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL-CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSC 1047
            C C+ GF L+ ++  C D+DEC   P+LC   IC N PG++ C+C  G+ S       C+DI+EC    LL  G       C N +G +QC+C    G +LS      C+    C +++  C + +C++      C C  GY+   D + C DI+EC+  +  C  +C N  GS  C C  GY    +G  C+DI+ECE    ICD   C N  G   C C  GF   MD   C D +EC++++  C    C N +G+F C C+ G+ +      CTD +EC IG  NC ++  C+N PGSF C C  G+      C+D++EC+N T   S    C N  G+Y C C  G+     TC D++EC  N   C +G+C+N    Y C C  G+    +   C+D DEC   N C V G CNN PG F C C  GYE     G C DI+E +   DP    +G CVN  G +EC C   F  +      C+D        C+        G   C  E G  +S    + C     C+L    G+  + C  +  + Y   C   EG++ +      L+D       P G CQ   CIN  G  +CEC  GY + S+D R+C D +EC  + G C    C N LG +TC C
Sbjct: 1098 CRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRG-----GTCVNTEGSFQCDC--PLGHELS-PSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNIC-VFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA---DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVG-CVDN---RVGNCYLKFGPRGDGSLSCNTEIGVGVSR--SSCC-----CSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPI-TIILEDIDECQELP-GLCQGGNCINTFGSFQCECPQGYYL-SEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCIC 1719          

HSP 2 Score: 242.662 bits (618), Expect = 4.718e-63
Identity = 252/758 (33.25%), Postives = 349/758 (46.04%), Query Frame = 0
Query:  445 GECEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGT--ACVDINECLLNNGHGPCQ--DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHE-CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECET--QDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCE-QVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEG--TYECKC-------------------DSGYIFHN-------------STCLDINECIRNP--CGHGECINESPGYSCSCHSGY-VDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE-FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS------ECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKK---------DERGNCF---LKDECRLSR----------------RPNGGCQQLCINIPGGLK----CECNPGYIVDSQDPRLC-VDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            G+  D+DEC + P +C + +C N+ G++ C+C  GF+       C DI+EC  +NG   CQ   +C N  G Y+CEC    G +LS   N  C+    C      CSH  C+       C+C +G++  +D   C+D++EC      C N  C N  GS  C C  G+E    +DC DI+EC +    +  +  C N  GS  C C  G++L  D   C D +EC    G C    C NLEG+F+C C PG+ + ++N  C D NEC      C ++G C NTPG F C C PGF L ++   C D  +    T   +G C+  +   T + KC                   D    F +              T  D+NEC+ +P  C +G+CIN    + C C  GY +D   V C D DEC   NPCG  G C N  GSF+C+C  G+E      C DINE +     C     C+N  GS+EC C  G+   + D  +C D DEC      H        CKN +G F C+C  G A        C D NEC    G C    CVNI+GS+ C C EG++          + +G CF   L+  C+++                 R  G   +LC  +PG  +    C   PGY  D +D   C V  N CT  NG     CIN +G   C C +G+  D      C+    CS +   C++ICK+TE    ++C CP G+ L+ D +TCK +
Sbjct: 1804 GKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDEC--SNGDNLCQRNADCINSPGSYRCECAA--GFKLSP--NGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERH--PCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSEN--CIDINECDEDPNIC-LFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR--CMNTFGSYECTCPIGYAL-REDQKMCKDLDECAEG--LHDCESRGMMCKNLIGTFMCICPPGMARRPD-GEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCP-LPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCT--NG----QCINTMGSFRCFCKVGYTTDISG-TSCIDLDECSQSPKPCNYICKNTEG--SYQCSCPRGYVLQEDGKTCKDL 2533          

HSP 3 Score: 232.261 bits (591), Expect = 8.404e-60
Identity = 264/834 (31.65%), Postives = 369/834 (44.24%), Query Frame = 0
Query:  398 TLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLS-------DKDNHTC---ISDEACQVNNGGCS--HECIHSYNQIF----------CLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDIN--ECETQ--DLICDH---------NCINTEGSAHCT----------------CKAGFDLMDETECF-------DKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNV--CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALS------------EILPNTCE----------------------------DINECALNNGDCS--QVCVNILGSHYCRCYEGYKKDERGNCFLKDEC--RLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            T++  D +  + DPD+     CE++    +G +  C C+ G+  +  G  C D+DEC+ +  LCD+ +C N PG+Y C C  G  F ++   C DINEC  N    PC +  C+N  G + CEC   PG++LS       D    TC   I D  C+VN  G +   EC  +    +            CP G    +   TC D+NEC      C N +C+N  GS +C+C  G      G  C DI   +C  +  +  C H          C    G+A  T                C  G    +  +         D +EC+   G C    C N  G+F+C C  GF L+ +   CTD +EC I    CG  G C+NTPGSF CEC  G+E   +M  +CMDI+EC  N  LC  G+C N EG+++C C  G+    S   C+DINEC    N C +G+C+N    Y CSC+ GY    +   C D DEC+  N  G   +C N  GS++C C+ GY        C DI+E     D C   G C N  G + C+C+ GF+    D   CID +EC   S+ C   EC+NT G F C C+ G+++             EI  + C+                            D++EC+     CS    CVN  GS+ C C EG+  D    C   DEC   ++   NG     C+N+PG  +CEC  G+   S D R C D +EC+  N      C N  G   C C  G++ D +    C     C+      + +C +T     + C CP  F+L      C
Sbjct:  763 TVDGRDINECALDPDICANGICENL----RG-SYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESN----PCVNGACRNNLGSFNCECS--PGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGV-TCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNG-GCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASM-DMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGF-TCSDVDECAENINLCENG----QCLNVPGAYRCECEMGFTPAS-DSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELD-RTGGNCTDIDECADPINCVNGLCVNTPG--RYECNCPPDFQLNPTGVGC 1571          

HSP 4 Score: 227.254 bits (578), Expect = 2.414e-58
Identity = 243/752 (32.31%), Postives = 336/752 (44.68%), Query Frame = 0
Query:  433 CECHDGFFLNDDGE-CEDVDECVDDPELCD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEA-CQVN--NGGCSHECIHSYNQIFC---------------------------LCPDGY-ELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGD-CINTPGSFYCECHPGFELMEDS--CMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCN--NKPGSFD----CDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYF 1133
            C C++G+ L  DG+ C D +ECV  P  C    C N  G++ C C  G+  +   C+DINEC  +     C    C N  GG+QC C   PG  LSD       + ++ C  N  NG CS     +  +  C                           LCP G+  +     T  D+NEC+     C N +C+N  GS  C+C  GY     G  C D +EC   +   +  C N  GS  C C  GF+      C D +EC  +   C   C N  G+++C C  G+ L  D   C D +EC  G+ +C   G  C N  G+F C C PG     D   C+D NEC T   +C +G C N+ G+Y C+C+ G+   +S      EC+ N    G C  E     C   S   ++        EC  D   G G +C     PG+      C   PGY        DI+E  +  + C  +G C+N  GSF C C  G+  D + ++ CID DEC  SP  C +  CKNT G ++C C  G+ L E    TC+D++EC     +C  +CVN LG   C+C  G+ +     C   +EC  S+    G + +C N PG   CEC  G+ +D+     C D +EC  N+  CQH C N LGG+ C C  G+        +CV    CS  N   S  C +T     ++C CPSGF     +  C  +   CSS+  P N  Y C+  +  GY 
Sbjct: 1999 CLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSENCIDINEC--DEDPNICLFGSCTNTPGGFQCLC--PPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSG----TECLDNR--QGLCFAEVLQTICQMASSSRNL----VTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDG---RDIDECKVMPNLC-TNGQCINTMGSFRCFCKVGYTTDISGTS-CIDLDECSQSPKPCNYI-CKNTEGSYQCSCPRGYVLQED-GKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTA-CIDNNECG-SQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLN-CEDVDECDGNHR-CQHGCQNILGGYRCGCPQGYI-QHYQWNQCVDENECSNPNACGSASCYNTLG--SYKCACPSGFSFDQFSSACHDV-NECSSSKNPCN--YGCSNTE-GGYL 2718          

HSP 5 Score: 216.083 bits (549), Expect = 6.648e-55
Identity = 193/585 (32.99%), Postives = 279/585 (47.69%), Query Frame = 0
Query:  448 EDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQD-ECKNVDGGYQCEC--GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK---CMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGFDLMDE-TECFD--------------------------KDECEMDNG-GCEQVCN--NLEGTFQ----CGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF--ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCF 975
            EDV+EC++ P +C +  C N  G++ C+C +G+     G  CVD +EC + N   PC +  C NV G ++C C  G  PG  ++ +D + C  +         C+  C++++    C CP GY L ED K C D++EC  G   C ++   C N+ G+  C C  G     +G+ C D NEC T+  IC++  C+N  GS  C C  GF      TEC D                          K EC  D G G    C    L GT Q    C   PG+   TD     D +EC + + N    G CINT GSF C C  G+  ++   SC+D++EC+ S    +  C N EG+Y+C C  GY+      TC D++EC  +       C+N   G++C C  G+      C D +EC    + CG  G C N PGSF C+C  G+        C D++E          HG C N  G + C C QG+I      N C+D +EC + + C  + C NTLG ++C C +GF+  +   + C D+NEC+ +   C+  C N  G + C C  GY +  +G+C 
Sbjct: 2170 EDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGN---PCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLL------CAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGY--TTDG---RDIDECKV-MPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRC--QHG-CQNILGGYRCGCPQGYIQ-HYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQ-FSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCV 2734          

HSP 6 Score: 195.667 bits (496), Expect = 1.094e-48
Identity = 244/813 (30.01%), Postives = 333/813 (40.96%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVD--INECLL-----NNGHGPCQDE----------CKNVDGGYQCECGGLPGTQLSD-----------KDNHTCISDE---ACQVNNGGC-SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQC-LNKCMNVPGSAYCKCDSGYE----GDDCSDINE-----------CETQ--------DLICDHNCIN----------TEGSAH----CTCKAGFDLMDET-ECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-SCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFL-------KDECRLSRRPNGGCQQLCINIPGGLK------CECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSV----NNGGCSHICKSTESGLH----------------------------------HRCMCPSGFKLKTDARTCKPI 1107
            C C DG+ L+   G C D+DEC D     + +C N PG Y C+C   F     G  CVD  +  C L      +G   C  E          C ++   +   C   P    ++           + N   I  E    CQ   G C    CI+++    C CP GY L ED + C DI+EC      C    C N  G+  C C   Y     G +C D+ +           CE +           C +N             T G+A     C    GF     T +  D DEC+   G C   VC N  G+F+C C  GF  N   L C D +EC+ G   C    DCIN+PGS+ CEC  GF+L  + +C+D NEC     +C  G C +L+G+Y+C C +G+      + C+D++EC R+PCG+G C N    Y+C C+ G+ +  +N C D DEC       C   G+C N+ GSF C C  GYE       C D NE       C P G C N +GSF C+C  G+   +  S  CID +EC   P  C    C NT GGF+CLC  GF LS+               NG   + C +   S    C+  +   E G C +       K +C  S+ P  G    C   P   +      C    G +    D R   D NEC  + G C +  CIN  G   C C +G+  D     +CV    CS+     NG C+++  S E   +                                  + C CP G+ L+ D + CK +
Sbjct: 1515 CICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVC-RNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSP-GTCQNLEGSFRCICPPGY---EVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSD---------------NG---RRCFDTRQSF---CFTNF---ENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTR--EDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTG-VRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDL 2295          

HSP 7 Score: 163.31 bits (412), Expect = 7.505e-39
Identity = 161/507 (31.76%), Postives = 223/507 (43.98%), Query Frame = 0
Query:  586 CLN-KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYI--FHNSTCLDINECIRNPC----GHGECINESPG------------------------------YSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE--FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEI-------LPNTC-----EDINECALNNGDCSQVCVNILGSHY----------CRCYEGYKKDERGNCFLKDECRL--SRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVD 1021
            CLN +C+    S  C+C+ GY+ D   DC D++EC T +   + +C+NT GS +C C AGF     +  C D DEC  +   C+   C N +G+FQC C  GF L TD   C D +ECT    N  + G CIN  GSF C C PGF L  +   C D++EC    +C +G C N EG++ C C  G         C+D +  +R+ C      G C+   PG                              +   C SG  + VD   RD +EC  D      G C N  GS+ C+C  GYE       C DI+E  + +  C  +G C N  GS+ C C  G++  + ++  C D +EC S+PC +  C+N LG F C C  G  LS         L  TC     +   E  +N       C   LG+ +            C  G  + +   C   +EC +     PNG     C+N  G   CEC  G  +D    R+C+D
Sbjct:  505 CLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDEC-TSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECT--TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTH--MRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG--RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTCPPGYVF-RTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNG----RCVNSKGSFHCECPEGLTLDGTG-RVCLD 997          

HSP 8 Score: 158.688 bits (400), Expect = 2.192e-37
Identity = 209/699 (29.90%), Postives = 286/699 (40.92%), Query Frame = 0
Query:  448 EDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQGTA-CVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTP----GSFYCECHPGFELMEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECIRNP--CGHGECINESPGYSCSCHSGYV--DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERG---------NCFLK---DECRLSRRPNGGCQQLCINIPGGLKCEC----NPGYI-VDSQDPR---------------LCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC-SHICKSTESGLHHRCM 1090
            + +D C     LC +  C     +Y C+C +G+       C+D++EC  N    PC + +C N  G Y C+C    G Q +      CI  + C  N   C +  C+++     C+C  G+EL  D K CVD +EC T ++ CLN  C+N  GS  C C  G+     G  C+D++EC+T  +  + +CIN+EGS  C C  G  + MD   C D                ++  T   G K G  +       T ++EC     + G    C   P      F+  C  G  +  D   DINEC  +  +C +G C NL G+Y C C+SGY    S   C+DI+EC+ N   C +G C N    YSC+C  GYV       C D +EC   NPC V G C N  GSF+C+C+PG +  +     I+            G C  N       C          S  C        SPC   E        +  C  G  L+ I   TCED+NEC +  G C +  CVN  GS +C C EG   D  G          C+LK   DEC             C  +      EC     PG    ++  PR                  D NEC    G C +  C N +G   C C+ GF  D +    C     C ++   C S IC +T       C 
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSN----PCTNGDCVNTPGSYYCKCHA--GFQRT-PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNM-CLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDT---------------HMRSTCYGGIKKGVCVRPFPGAVT-KSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG-RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINEC-ESNPC-VNGACRNNLGSFNCECSPGSKLSSTGLICIDSL---------KGTCWLNIQDSR--CEVNINGATLKSECCATLGAAWGSPCERCE-------LDTACPRG--LARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEE-RNCTDIDECRISPDLCGSGICVNTPGSFECECF 1143          

HSP 9 Score: 119.783 bits (299), Expect = 1.211e-25
Identity = 146/483 (30.23%), Postives = 204/483 (42.24%), Query Frame = 0
Query:  762 SGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNT--CEDINECALNNGDCSQVCVNILGSHYCRCYEG-------------------YKKDERGNC-------FLKDECRLSRRPNGGCQQLCINIPG-------GLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKC 1203
            +G    N T +DI +   N C +G CI     Y C C+ GY  D +  C D DEC   NPC   G C N PGS+ C C  G++       C DI+E       C  +G CVN DGSF+C+C+ GF    +  N C+D DEC ++  C +  C N  G F+C+C+ GF L+   PN   C D++EC       +  C+N  GS  C C  G                   Y   ++G C         K EC     P+ G  + C   P        GL C    G  VD +      D NEC ++   C +  C N  G + C+C+ G++PD      C+    C VN   C + +C++T     + C CP G+  +T+  TC+ I   C S P   NG  R N    +     G+K           TG I    +    W   +D  CEV        ++   +  E C T  +  GS C
Sbjct:  486 TGLTILNQT-IDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT-SNPC-TNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNTDGSFQCICNAGFELTTDGKN-CVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLA---PNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSEC-CCANPDYGFGEPCQPCPAKNSAEFHGL-CSSGVGITVDGR------DINECALDPDICANGICENLRGSYRCNCNSGYEPDASG-RNCIDIDECLVNRLLCDNGLCRNTPG--SYSCTCPPGYVFRTETETCEDI-NECESNP-CVNGACRNNLGSFNCECSPGSK--------LSSTGLICIDSLKGTCWLNIQDSRCEVN-------INGATLKSECCATLGAAWGSPC 932          

HSP 10 Score: 118.242 bits (295), Expect = 4.143e-25
Identity = 101/327 (30.89%), Postives = 136/327 (41.59%), Query Frame = 0
Query:  342 RRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTL-----FCSERRWIGK----RPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECG---GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF 651
            R + H+     LPG    + +     GY  D    D        C+  + I      R  C    T +I+  S    D   Q  K C +IC   +G +  C C  G+ L +DG+ C+D+DEC      C  +C N  G + C C  GFT   TAC+D NEC         +  C+N  G + CEC     L  T L+ +D   C  +  CQ       H C +      C CP GY     W  CVD NEC   +      C N  GS  C C SG+  D     C D+NEC +    C++ C NTEG   C C  G+  + +  C 
Sbjct: 2416 RGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEG-SYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQ-------HGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCV 2734          

HSP 11 Score: 58.5362 bits (140), Expect = 5.039e-7
Identity = 50/138 (36.23%), Postives = 68/138 (49.28%), Query Frame = 0
Query:  879 CHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRL--SRRPNGGCQQLCINIPG---GLKCECNPG 1008
            C +GFI +   +  C D DEC + P  C    C NT+G FEC C  G   SE     CEDI+EC++  G C +  C N +GS++C C  GY     G+  +     +  S   NG C Q    +PG    ++C C PG
Sbjct:  261 CRRGFIPNIR-TGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETT-QKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGLVNGRCAQ---ELPGRMTKMQCCCEPG 393          
BLAST of EMLSAG00000000097 vs. SwissProt
Match: gi|296439311|sp|Q14767.3|LTBP2_HUMAN (RecName: Full=Latent-transforming growth factor beta-binding protein 2; Short=LTBP-2; Flags: Precursor)

HSP 1 Score: 240.35 bits (612), Expect = 1.462e-62
Identity = 185/524 (35.31%), Postives = 257/524 (49.05%), Query Frame = 0
Query:  549 CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY------EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQC-GCKPGFHLNTDNLTCTDENEC-TIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYEC-KCDSGYIFH--NSTCLDINEC-IRNPCGHGECINESPGYSCS-CHSGY--VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGD---CSQVCVNILGSHYC--RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSC 1047
            C++  +   C+C  GY+L      C D NEC+    +   +C+N  GS  C C  GY         +C DINECE   +     C NTEGS HC C  G+ ++ +  C D +EC       +  C N  G++ C  C+ G+   +   +C D NEC T G+     +G C N  GSF C C  G+E+  D   C D++EC +   C +G C N EG++ C  C++GY  +   + C D++EC     C  G C N +  +SC  C  GY    + + C D DEC       +GG+C N  GS+ C C  G++  NG  C D+NE   E+  C PHG+C+N+ GSF C+C  GF+  +  ++ C D DEC ++ PC    C NT G F CLCETGF  S      C DI+EC  + GD    +  C N  GS+ C   C  G+     G+C   DEC  +     G    C N  G  +C C+ G+ + S     CVD NEC +    C  A C N  G   C C
Sbjct:  861 CVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKGRCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSG--SCVDVNECLTPGVC---AHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEH-CAPHGECLNSHGSFFCLCAPGFVSAEGGTS-CQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPES-GECVDIDECE-DYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDEC--ANDTMCGSHGFCDNTDGSFRCLCDQGFEI-SPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLC 1372          

HSP 2 Score: 232.646 bits (592), Expect = 4.202e-60
Identity = 191/526 (36.31%), Postives = 253/526 (48.10%), Query Frame = 0
Query:  464 CTNKPGTYMCDCRLGFTSQGTA--CVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKD-NHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYC-KCDSGYEGD--DCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQC-GCKPGFHLNTDNLTCTDENECTI-GIANCGIYGDCINTPGSFYC-ECHPGFE--LMEDSCMDINECTN-STLCGSGSCNNLEGTYECKCDSGYIFHNST-CLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYE--FKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECV--CHQGFIHDQNDSNICIDFDECLSSPC--FHSECKNTLGGFECLCETGFALSEILPNT--CEDINECALNNGDC-SQVCVNILGSHYCRC 962
            C N P  Y C C  G+    +   C D NECL +   G  +  C N  G Y C C   PG  L+       C     C+        +C ++     C C  GY +      C DINEC         +C+N PGS  C  C+ GY G    C D+NEC T  +     C N EGS  C+C+ G+++  DE  C D DEC         +C N EG+F C  C+ G+ +N D   C D +EC   G+   G+   C NT GSF C +C  G+    + DSC D++EC +  + C  G C N  G+Y+C C  G+   N T C D+NEC+   +   HGEC+N    + C C  G+V  +    C+D DEC   +PC VGG C N  GSF+C C  G++   ++G C DI+E     DP      C N+ GS+ CV  C  GF    N    CID DEC +      H  C NT G F CLC+ GF   EI P+   C D+NEC L    C + +C N+ GS  C C
Sbjct:  861 CVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKG--KGRCINRVGSYSCFC--YPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGYIMVRKGH-CQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVCPSGV---CTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPC-VGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGD--CIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGF---EISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLC 1372          

HSP 3 Score: 215.312 bits (547), Expect = 8.835e-55
Identity = 182/525 (34.67%), Postives = 254/525 (48.38%), Query Frame = 0
Query:  433 CECHDGFFLN-DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTA----CVDINECLLNNGHGPCQ-DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-------ECIHSYNQIFCL-CPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCT-CKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCG-CKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS-CMDINECTNSTLCGS-GSCNNLEGTYECKCDSGYIFH--NSTCLDINECI-RNPCGHGECINESPGYSCSCHSGYVDV--DNVCRDYDEC--LHDNPCGVGGKCNNKPGSFDC--DCAPGYEFK-NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCET 922
            C C  G+ L+     C D +EC+ DP      C N+ G+Y C C  G+T   +     C DINEC      G C   +C N +G Y CEC             +  +    CQ  N  C H        C++S     CL C +GY       +CVD+NEC+T  +    KC N+ GS  C C+ GYE       C D++EC ++       C+NTEGS  C+ C+ G+ +  D T C D DEC         VC N  G+F C  C  G+  +    +C D +EC    ++C + G+C NT GS+ C C  GF+L   + C D+NEC     C   G C N  G++ C C  G++     ++C D++EC   +PC  G C+N    ++C C +G+        C D DEC    D  CG   KC N PGS+ C   C PG+    NG C DI+E + +   CG HG C N DGSF C+C QGF    +  + C+D +EC  + + C  + C+N  G F CLC +
Sbjct:  870 CVCSPGYQLHPSQAYCTDDNECLRDPCKGKGRCINRVGSYSCFCYPGYTLATSGATQECQDINEC---EQPGVCSGGQCTNTEGSYHCEC----------DQGYIMVRKGHCQDIN-ECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSG--SCVDVNECLTPGVCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSC-LGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDPVCGT-WKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTM-CGSHGFCDNTDGSFRCLCDQGFEISPSGWD-CVDVNECELMLAVCGAALCENVEGSFLCLCAS 1374          

HSP 4 Score: 204.142 bits (518), Expect = 2.050e-51
Identity = 215/683 (31.48%), Postives = 297/683 (43.48%), Query Frame = 0
Query:  432 TCECHDGFFLNDDG---ECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTS-QGTACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYC-KCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCT-CKAGF---DLMDETECFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY--IFHNSTCLDINEC--IRNP-CGHGECINESPGYSC--SCHSGYVDVDNV-CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFD---------------------ECLSSPCFHSECKNTLG----GFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHY---CRCYEGYKKDERGNCFLK------DECRL---SRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSC 1047
            +C C+ G+ L   G   EC+D++EC + P +C    CTN  G+Y C+C  G+   +   C DINEC      G C D  C N  G Y C    L   +     + +C+    C +  G C+H +C +      C C  GYE+  D K C D++EC +        C+N  GS  C  C++GY    +G  C D++EC    +     C NT GS  C  C  G+    L D   C D DECE     C    C N  G++QC C  GF L  +   C D NEC +G  +C  +G+C+N+ GSF+C C PGF   E   SC D++EC  +  C  G C N EG++ C C++G+     +  C+DI+EC    +P CG  +C N    Y C   C  G+    N  C D DEC +D  CG  G C+N  GSF C C  G+E       C D+NE  L    CG    C N +GSF C+C             C                         +C S    H+ C + LG      EC C  G +                   GD   +C +   + +   C   +GY   E    F +      DEC +      PNG     C+N   G  C CNPG+  D+   + C D +EC   +  C++  C+N  G   C C
Sbjct:  910 SCFCYPGYTLATSGATQECQDINEC-EQPGVCSGGQCTNTEGSYHCECDQGYIMVRKGHCQDINEC---RHPGTCPDGRCVNSPGSYTC----LACEEGYRGQSGSCVDVNEC-LTPGVCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGD--SCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQL-ANGTVCEDVNEC-MGEEHCAPHGECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCG-AALCENVEGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASW------------------GDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNG----RCLNTVPGYVCLCNPGFHYDASH-KKCEDHDEC--QDLACENGECVNTEGSFHCFC 1553          

HSP 5 Score: 176.792 bits (447), Expect = 5.213e-43
Identity = 160/468 (34.19%), Postives = 208/468 (44.44%), Query Frame = 0
Query:  695 NECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS----TCLDINECIR-NPCGHGECINESPGYSCSCHSGYVDV-DNVCRDYDECLHDNPCGVGGKCNNKPGSFDC-DCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFEC-LCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCR-CYEGYKKDERGN-CFLKDECRLSRRPNGGC-QQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGF 1147
            + C  G  N    G C+N P  + C C PG++L   +  C D NEC      G G C N  G+Y C C  GY    S     C DINEC +   C  G+C N    Y C C  GY+ V    C+D +EC H   C   G+C N PGS+ C  C  GY  ++G C D+NE  L    C  HG C N +GSF C C QG+    +D   C D DEC S + C    C NT G F C  CE G+ ++E     CED++ECA      S VC N  GS  C+ C  GY+    G+ C   DEC     P   C    C N  G  +C C  G+ + +    +C D NEC        H  C+N  G   C C  GF   E     C     C+  +      C +TE   +  C+C +GF+   ++  C  I   C     P  G ++C     S       +C L C+ GF
Sbjct:  846 DRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKGRCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTC-PDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNE-CLTPGVCA-HGKCTNLEGSFRCSCEQGY-EVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDG-TACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDEC---EDPQSSCLGGECKNTVGSYQCLCPQGFQLANGT--VCEDVNECMGEEHCAPHGECLNSHGSFFCLCAPGFVSAEGG-TSCQDVDECATTDPCVGGHCVNTEGSFN--CLCETGFQPSPESGECVDI-DECEDYGDPVCGTWKCENSPGS------YRCVLGCQPGF 1293          

HSP 6 Score: 169.088 bits (427), Expect = 1.129e-40
Identity = 160/529 (30.25%), Postives = 235/529 (44.42%), Query Frame = 0
Query:  422 ICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELC-DHICTNKPGTYMC-DCRLGF--TSQGTACVDINECLLNNGHGPC-QDECKNVDGGYQCECGGLPGTQLSD----KDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECET-QDLICD-HNCINTEGSAHCT--CKAGFDLMDETECFDKDECEMDNG-GCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE---LMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFAL 926
            +C   +G      C +G+++N+DG  CED+DEC   P +C   +CTN  G++ C DC  G+  +  G +C D++EC   +    C   ECKN  G YQC C    G QL++    +D + C+ +E C  +      EC++S+   FCLC  G+   E   +C D++EC T D      C+N  GS  C C++G+    E  +C DI+ECE   D +C    C N+ GS  C   C+ GF +    +C D DEC  D   G    C+N +G+F+C C  GF ++     C D NEC + +A CG    C N  GSF C C    E     E  C         ++  + + ++        C SG   H   S+ L  N          EC        C+  + + D  ++C   D       C  G       G+        + F      D +E  +      P+G C+N    + C+C+ GF +D +    C D DEC    C + EC NT G F C C     L
Sbjct: 1065 LCLNTEGSFACSACENGYWVNEDGTACEDLDECAF-PGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDEC--EDPQSSCLGGECKNTVGSYQCLC--PQGFQLANGTVCEDVNECMGEEHCAPHG-----ECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGA-ALCENVEGSFLCLCASDLEEYDAQEGHCRPRGA-GGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNT------TQAECC-------CTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGA--------WTFGQTMYTDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKK-CEDHDECQDLACENGECVNTEGSFHCFCSPPLTL 1559          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: EFX89291.1 (hypothetical protein DAPPUDRAFT_303147 [Daphnia pulex])

HSP 1 Score: 571.237 bits (1471), Expect = 1.527e-175
Identity = 389/1080 (36.02%), Postives = 524/1080 (48.52%), Query Frame = 0
Query:  435 CHDGFFLND------DGE-CEDVDECVDDPEL-CDHICTNKPGTYMCDCRLGF--TSQGTACV------------------------DINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN---NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCINTEGSAH-------CTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS-TCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFI------------HDQNDSNIC----------IDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKK------------------------------------KVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITL 1404
            C +GF L D      DG  C DVDEC  + +  C H+C N  G+  CDC  G+  T+ G  C                         DI+EC   N  G C  +C N DG   C C    G  L   D+ TC+  + C      N GCSH C++      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+EC + D    H+C  T GS H       C C  GF  +  T C D DEC  +   C   C NL+G+++C C  GF     N TC D NEC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC     C    C N  G +EC C  G+  +N   C+DI+EC+ +PC  G CIN    YSCSC  GY   DN  C D DECL  +PC V  +C N PGSF C C  GYEF +  C DI+E   +K PCG +  C+NN+GSF C C  G+              ++ D  +C           D DEC  +PC +  C N  G ++C+C+ G+ L +     CEDI+EC   N  C   C N+ GS+ C C +GYK  E   C   DEC +S +P   C+  CIN+PG  +C+CN GY  +  +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+ D RTC  +   C     P +G   C +                                     K    +  G+ C ++C KG+   G  T  C  +G W G E   C  ++CP L    NG ++P TC T  +  G +C   C  G+++ G     C    +W R    P +C    +  P I CP +M   LP      YV   +P++N++W RYVDSDP+WA  L GE+  G +V+TFR RSPV+   +A C   I + D   P + NCP S   +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI +
Sbjct:  189 CPEGFQLADRLAEAEDGSACLDVDECATEDQFGCSHLCVNTQGSAHCDCPNGWKMTNDGKTCRGNQFCKSSSQEFSIFKKMVGLDFPDIDECSTGNNFG-CSHQCVNTDGSAHCSCPS--GYSLDASDHKTCVDVDECSDQTQPNFGCSHHCVNLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPGGYRLSETDAKSCLDIDECASLDEETQHSCRATGGSCHNTLGSYQCICPEGFRSIG-TACTDIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NVNGTCADINECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECAIGNPCDD-ICRNTVGAFECLCAQGFQLNNDDQCVDIDECLNDPC-EGICINTQGSYSCSCELGYQLGDNGTCSDVDECLS-SPCPV--ECINSPGSFTCLCPFGYEFNDNVCKDIDE--CQKQPCGTNAKCINNEGSFACQCEPGYALRGRDCEELVVYTEEEDRQLCEYQKGVDLKKPDVDECKENPC-NGACINFPGSYQCICDPGYELRD---GRCEDIDECL--NYKCGGRCTNLPGSYRCDCEKGYKL-EGERCVDVDEC-VSLKP---CKGSCINLPGSYRCDCNAGYQTEGNE---CIDIDECSHRNGGCSHICVNTVGSFRCACNPGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLEADGRTCIELPPRCPRMKVPDHGDMECTQNLNQTQHRSREQEDEALIAENGRGDLGASGRSANRSHKSRALYNTGSTCVIRCNKGYKLVGDSTISCGRSGLWIG-EPATCIPLSCPKLLAPDNGALTPNTCSTGKTFAGQQCQVRCRAGFRLIGGGTYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQNRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNVITFRVRSPVS-DLTAACNFTIEIFDKEIPRMTNCPSSLTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQSGYHEITYVAQDGAGNQAKCQFTIHV 1231          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: XP_016768134.1 (PREDICTED: fibrillin-2 isoform X2 [Apis mellifera])

HSP 1 Score: 452.21 bits (1162), Expect = 1.451e-129
Identity = 369/1146 (32.20%), Postives = 516/1146 (45.03%), Query Frame = 0
Query:  413 VQEKKRCEHICY-LDKGVTPTCECHDGF-FLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL-DEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY---EGDD--CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL--MDETECFDKDECEMDNG-GCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSF-YCECHPGFELMED--SCMDINEC----TNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINECI--RNPCGHGECINESPGYSCSCHSG-YVDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGH----------------------------------------TCSCHLGFKPDE-KNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP-----SNGYYRCNKKKVSGYFVKGTKCK------------------------LKCRKGFMP-----------------TGHITRKCINNG-----TWTGDEDHACEVMNCPPL--------PPLHNGNISP-ETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEW--------KRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENP 1415
            +++   C H+C  ++ GV   C C D +  L DDG+ C ++DEC+ D   C H+C  + GT  C C  G         C + N+C  +NG   C   C   DG   C C   P   +  ++   C+ +  C   NGGCSH+C +   + FCLCPD   L D+D   CV  N+C   +  C + C    GS  C+C SG+   EGD+  C D++EC      C H C NTEG   C C  GF +  ++   C D DECE   G GC   C NL G+F C C  G+ L  DN TC   + C     NC  +   +   G   +C C  GF L +D  +C DI+EC     +  L  S  C N EG Y C+C SGYI    +   C+D+NEC+  R+ C H +C+N    Y C+C+ G Y+  D + C D DECL  N  G   +C N  G   C C  GYE       C D++E   +   C    +CVN  GS+ C C  G     NDS  C+D DEC   +  C H+ C N +GG  C C  G  L E    TC D++EC+ +NG CS VCVN +GS+ CRC     +   +   C   +EC +    NG C   CIN+ G  +CEC  G+ +   D R C D NEC  +NGGC H C+N+LGG+                                         C C  GF+ DE ++P +C     C+ +  GC  +C +T      +C C  GF+++    TC  I    +   +      S G YRC      G+ ++G  C                           CR G++P                  G     C+N       T  GD   A +   C           PPLH     P  +      P G++C   C  G+++ G     C    +W        +   V   + +    RP + CP DM   LP    ++ V  P+P++N+NW RYVD+ P WA  L+ ++  G  VVTF A SPV+   ++TC+++I V+D   P V  CP SF   LSPG+  + I W EP F DN+ ++ V  +  PG     G H + Y ASD  GN   C F+I ++  + +    P
Sbjct: 1491 IEDNGGCSHLCANIEGGVE--CACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNG--GCSHYCSYEDGRVACSC---PTDLVLSENGTVCVEENGCSSGNGGCSHDCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDECSELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECLNDRHNCSH-DCLNLLGSYVCTCYQGHYLHSDKSTCLDIDECLERNG-GCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADC--LHECVNTLGSWTCTCPDGHAL-ANDSKTCVDVDECKVDNGGCSHA-CLNVVGGVRCNCPIGLRLDED-GKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEME---NGECSDNCINVRGSYRCECPAGFRL-KNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQHGCDQLCVNTVGSF--QCSCKQGFEMQN--STCVDIDECATMDCKGYECINSYGSYRCECDI--GHRLEGDHCVDINECAWNNGGCEHDCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQWNGKEPTCIQASIVTDSRYHSDMPRPFVRCPRDMDVELPARQNTIRVSFPQPKSNMNWWRYVDASPSWAKQLQADLPAGTTVVTFTAWSPVS-NYTSTCRIVIRVRDTENPKVSTCPTSFEVRLSPGERNRLIFWQEPTFTDNVGVERVYKTREPGQLMYPGIHNVRYIASDAAGNRAECHFSIHVRESEHRRDSEP 2611          

HSP 2 Score: 348.977 bits (894), Expect = 2.097e-96
Identity = 292/916 (31.88%), Postives = 396/916 (43.23%), Query Frame = 0
Query:  316 EVDLLRLDASCIIQ-----FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYC----------------------------------------KCDSGY---EGDDCSDINECETQDLI--CDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-------------------IYGD------------------CINTPGSFYCECHPGFELMED---SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGG-----KCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYC------------------RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            E  + RLD SCI++     FT+A P+ +A   +Y  R  +   P   Y   +Y+C EGY F+ S  D            R  C   + L                            G  P C            + ED+DEC +    C  IC N PG++ C+C  G+   + G +C+D+NECL+NNGHGPCQ  C N++G Y+C C  +PG +L+  DNHTC   + C  NNGGCSH C+++    FCLCPDG+ L  DWKTC D+NEC      C N   C N  GS  C                                        KC+ G+   +  +C DI+EC  +  +  C H C+N  G  +CTC  GF L  D   C D DECE  +  C   CNN EG+F+C C  GF L  DNLTC     C      C                    ++ D                  C+N  G F C C  GF+ +E    +C D++EC N+       C N++G Y C C SG+  +  N TC D++EC+   + C    C+N    Y+CSC  GY         + +C+  N C  GG     +C+N+ G F C C PGY   N    C D NE       C    +CVN  GS+ C C  G    + D  +C+  D C  + C H+ C+     FEC C  GF L E    TC+D +EC  N  DCS  C N LGS+ C                   C EG ++D+ G C   DEC L R  N  C  +C+N     +C C  G+ + S D   CV  + C   N  C H C++      C C  G++    +   C     C   +  CS  C +T+    + C CP GF L  D R+C  +
Sbjct:  152 ETIMSRLDLSCIMKARRKGFTKAPPVENAYPAKYARR-KSVLPPYNRYLVAVYECTEGYVFEDSTTD------------RLFCSDGAWL----------------------------GTIPRCV-----------KVEDIDECAESTAGCAQICHNDPGSFHCECHSGYQLGTDGKSCLDVNECLVNNGHGPCQGGCINLEGSYECNCSDIPGHKLA-ADNHTCEDIDECSTNNGGCSHVCLNTPGSAFCLCPDGFYLTNDWKTCQDVNECENASKVCTNNTDCENTVGSFKCVSKPQKMTKVLQDEDYDAEDDEDDDDYDEEEGITEIPEFGKCEDGFRKSKNGECIDIDECSDEGELPSCQHGCVNEPGGYYCTCHLGFKLGEDGVSCHDIDECEDGSRPCSHGCNNTEGSFECTCPTGFTLKEDNLTCARARSCETLSTPCSHECRESEDGPICVCPLGYRVHEDEVSCVDTDECAVNPCSHSCVNFEGGFACTCPQGFQTLEHDKYNCTDVDECANNVHDCEHECVNVQGGYTCNCRSGFALNDDNRTCSDVDECLDGVHRCEQ-ICVNSIGNYTCSCREGYRISK---EGFLDCVDINECDEGGHGCSHECSNEEGGFKCGCPPGYLLGNDSRICQDANECLEGTHQCSH--ECVNLQGSYACTCPLGMTVSE-DKRLCVPLDPCRFANCSHT-CERRRDTFECGCPDGFVLHED-GKTCQDFDECLENEHDCSHECANTLGSYECLCPDGLTLLQDGLTCEDPSCPEGLRQDDEGGCRDIDEC-LER--NHECSHICVNEHATYRCSCLSGWTL-SDDGVTCVLSDPCA--NSSCSHICLSYASTPVCDCPPGYEL-AADAATCEDVDECRDGSANCSFSCTNTDGS--YACDCPQGFILGEDGRSCVDV 996          

HSP 3 Score: 327.791 bits (839), Expect = 1.047e-89
Identity = 273/771 (35.41%), Postives = 356/771 (46.17%), Query Frame = 0
Query:  408 SCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDD-GECEDVDECVDDPELCDHICTNKPGTYMCDC--RLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN-NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI-QCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-------------------------------------------SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYV---DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNG-GCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESG---LHHRCMCPSGFKLKTDARTCKPI 1107
            +C P     + C H  Y   G    C C +GF L DD   C DVDEC + P  C + C N  G+Y C+C   L      T C DI+EC+ NN +G C  +C N  G + C C   P      +D  TC   + C VN NGGCSH+C ++     C+CP GYEL ED KTC D++EC   D   C + C N  GS +C C  GYE    G  C+D++EC   D  C H C NTEGS +C C  G++L+++ + C D DEC   D  GC   C NL+G + C C  G+ +  DN TCT    C     NC     C+N  G + CEC  G+EL  D                                           SC+D NEC       S SC N +G+YEC C +GY      +TC D+NECI +   C H  C N   G  C+C   Y    D    C + DECL DN  G    C+ + G+  C C PG      N  C + N+   +   C  +  C   DG   C C    +  +N + +C++ + C S    C H +C+   G   CLC     L++     C   N+C ++NG CS +C    GS  C C  G+K  E  N  C   DEC         C   C N  GG +C CN G+ V   +P  C D +EC    G GC HAC N +G   C+C  G+  +  N + C     C  NNG CSH C   E G   +H  C CP GF+LK D RTC+ I
Sbjct: 1074 NCFPPSAVHRNCSHA-YERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDECVENN-NGGCSHDCANTQGSFHCVC---PRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDNGCSHECANTEGSFYCICPRGYELIEDGKTCADVDECTRKDVHGCSHRCENLDGGYVCSCPDGWIVGRDNRTCT--MACEAAPHNCSHT--CVNVRGGYECECPAGWELSSDGRTCEEVDFCAGGHGCSHECARVAGGGFQCRCPAGYVLSEDNRSCLDRNECEEGNGGCSHSCVNTDGSYECGCPNGYRLAADRNTCEDVNECIEDNGGCSH-LCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNG-GCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNGGCSHY--CSYEDGRVACSCPTDLVLSENGT-VCVEENGCSSGNGGCSH-DCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDEC---SELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDN-KTCRLVDGCKRNNGNCSHHCHHVEEGGEVVH--CSCPLGFRLKQDQRTCEDI 1823          

HSP 4 Score: 313.153 bits (801), Expect = 3.792e-85
Identity = 258/738 (34.96%), Postives = 351/738 (47.56%), Query Frame = 0
Query:  432 TCE---CHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM---------------------------------------DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNP---CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECL-HDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHY-CRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105
            TCE   C +G   +D+G C D+DEC++    C HIC N+  TY C C  G+T    G  CV  + C     +  C   C +      C+C   PG +L+  D  TC   + C+  +  CS  C ++     C CP G+ L ED ++CVD++EC   D  C  +C+N+ G+  C C  GY        C D++EC T    C H C NT G  +CTC  G+ L                                        DE  C D DEC      C   C N +G+++C C PG  L  D  TC D +EC +   N G   DC NT GSF+C C  G+EL+ED  +C D++EC  +   G S  C N +G++ C C  GY  I    TC D++EC  N    C H +C N    + C C  GY  +++   C D DEC+ +DN  G   +C N  GSF C C  GYE       C D++E +  KD  G    C N DG + C C  G+I  + D+  C    E     C H+ C N  GG+EC C  G+ LS     TCE+++ CA  +G CS  C  + G  + CRC  GY   +D R +C  ++EC      NGGC   C+N  G  +C C  GY + + D   C D NEC  +NGGC H C N  GG  C+C   +K  E + + CV+   C ++NGGC+H+C      +   C CP G  L  D  TC 
Sbjct:  854 TCEDPSCPEGLRQDDEGGCRDIDECLERNHECSHICVNEHATYRCSCLSGWTLSDDGVTCVLSDPC----ANSSCSHICLSYASTPVCDC--PPGYELA-ADAATCEDVDECRDGSANCSFSCTNTDGSYACDCPQGFILGEDGRSCVDVDECARRDHDCPRECVNLEGTYECVCPIGYAFSKTELACVDVDECGTGQHACSHACTNTPGGYNCTCPIGWRLREDSRNCFPPSAVHRNCSHAYERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDEC-VENNNGGCSHDCANTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSH-DCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDN--GCSHECANTEGSFYCICPRGYELIEDGKTCADVDECT-RKDVHGCSHRCENLDGGYVCSCPDGWIVGR-DNRTCTMACEAAPHNCSHT-CVNVRGGYECECPAGWELSSD-GRTCEEVDFCAGGHG-CSHECARVAGGGFQCRCPAGYVLSEDNR-SCLDRNEC---EEGNGGCSHSCVNTDGSYECGCPNGYRL-AADRNTCEDVNECIEDNGGCSHLCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTV--SCFCPPGMILADDNATCA 1568          

HSP 5 Score: 290.041 bits (741), Expect = 5.279e-78
Identity = 245/711 (34.46%), Postives = 334/711 (46.98%), Query Frame = 0
Query:  365 CDEGYAFDPSKP----DTLFCSERRWIGKRPLCV-----------AKSTLEIADPSRPSCDPDVQEKKRCEHICYL--DKGVTPTCECHDGFFLNDDGE-CEDVDECVD---DPEL-CDHICTNKPGTYMCDCRLGFT---SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGC-KPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN-STCLDINECIRNPCG-HGECINESPGYSCSCHSGYVDVDN----VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNG------GCQQLCINIPGGLKC--ECNPGYIVDSQDPRLCVDKNE 1024
            C+EG+   P +P    D   C + R  G    C                LE  + +    D   +    C H C+   + G    C C  GF L  D   CED+DEC +   D +L C HIC N  G Y C+C  G+         C+D+NECL N+ H  C  +C N+ G Y C C    G  L   D  TC+  + C   NGGCSH+C ++    FC CP GYEL +D KTC+D++EC T    CL++C+N  GS  C C  G+    +   C D++EC+  +  C H C+N  G   C C  G  L  D   C D DEC  DNGGC  VC N  G++ C C   G HL+TD  TC D NEC +    C    +CIN  GS+ CEC  GF L  D  +C D+NEC +     S  C N  G Y C C  G+   N S C  ++ C  +  G    C   +   +C C  G+   +N     CRD DEC      G    C N  GSF C C  G+E +N  C DI+E +     C  + +C+N+ GS+ C C  G    + + + C+D +EC   +  C H +C NT+G + C C  G+       N C+DINEC  +NG C+  CVN  GS+YC C        DER     +  CR    P        G     ++ P G +C  +C  G+ ++    R C+  ++
Sbjct: 1720 CNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECL-NDRHN-CSHDCLNLLGSYVCTC--YQGHYLH-SDKSTCLDIDECLERNGGCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADCLHECVNTLGSWTCTCPDGHALANDSKTCVDVDECKVDNGGCSHACLNVVGGVRCNCPIGLRLDEDGKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEMENGECS--DNCINVRGSYRCECPAGFRLKNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQH-GCDQLCVNTVGSFQCSCKQGFEMQNSTCVDIDECATMD--CKGY-ECINSYGSYRCECDIGH---RLEGDHCVDINECAWNNGGCEH-DCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQ 2415          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: XP_016768135.1 (PREDICTED: fibrillin-2 isoform X3 [Apis mellifera])

HSP 1 Score: 451.825 bits (1161), Expect = 1.799e-129
Identity = 369/1146 (32.20%), Postives = 516/1146 (45.03%), Query Frame = 0
Query:  413 VQEKKRCEHICY-LDKGVTPTCECHDGF-FLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL-DEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY---EGDD--CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL--MDETECFDKDECEMDNG-GCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSF-YCECHPGFELMED--SCMDINEC----TNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINECI--RNPCGHGECINESPGYSCSCHSG-YVDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGH----------------------------------------TCSCHLGFKPDE-KNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP-----SNGYYRCNKKKVSGYFVKGTKCK------------------------LKCRKGFMP-----------------TGHITRKCINNG-----TWTGDEDHACEVMNCPPL--------PPLHNGNISP-ETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEW--------KRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENP 1415
            +++   C H+C  ++ GV   C C D +  L DDG+ C ++DEC+ D   C H+C  + GT  C C  G         C + N+C  +NG   C   C   DG   C C   P   +  ++   C+ +  C   NGGCSH+C +   + FCLCPD   L D+D   CV  N+C   +  C + C    GS  C+C SG+   EGD+  C D++EC      C H C NTEG   C C  GF +  ++   C D DECE   G GC   C NL G+F C C  G+ L  DN TC   + C     NC  +   +   G   +C C  GF L +D  +C DI+EC     +  L  S  C N EG Y C+C SGYI    +   C+D+NEC+  R+ C H +C+N    Y C+C+ G Y+  D + C D DECL  N  G   +C N  G   C C  GYE       C D++E   +   C    +CVN  GS+ C C  G     NDS  C+D DEC   +  C H+ C N +GG  C C  G  L E    TC D++EC+ +NG CS VCVN +GS+ CRC     +   +   C   +EC +    NG C   CIN+ G  +CEC  G+ +   D R C D NEC  +NGGC H C+N+LGG+                                         C C  GF+ DE ++P +C     C+ +  GC  +C +T      +C C  GF+++    TC  I    +   +      S G YRC      G+ ++G  C                           CR G++P                  G     C+N       T  GD   A +   C           PPLH     P  +      P G++C   C  G+++ G     C    +W        +   V   + +    RP + CP DM   LP    ++ V  P+P++N+NW RYVD+ P WA  L+ ++  G  VVTF A SPV+   ++TC+++I V+D   P V  CP SF   LSPG+  + I W EP F DN+ ++ V  +  PG     G H + Y ASD  GN   C F+I ++  + +    P
Sbjct: 1535 IEDNGGCSHLCANIEGGVE--CACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNG--GCSHYCSYEDGRVACSC---PTDLVLSENGTVCVEENGCSSGNGGCSHDCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDECSELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECLNDRHNCSH-DCLNLLGSYVCTCYQGHYLHSDKSTCLDIDECLERNG-GCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADC--LHECVNTLGSWTCTCPDGHAL-ANDSKTCVDVDECKVDNGGCSHA-CLNVVGGVRCNCPIGLRLDED-GKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEME---NGECSDNCINVRGSYRCECPAGFRL-KNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQHGCDQLCVNTVGSF--QCSCKQGFEMQN--STCVDIDECATMDCKGYECINSYGSYRCECDI--GHRLEGDHCVDINECAWNNGGCEHDCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQWNGKEPTCIQASIVTDSRYHSDMPRPFVRCPRDMDVELPARQNTIRVSFPQPKSNMNWWRYVDASPSWAKQLQADLPAGTTVVTFTAWSPVS-NYTSTCRIVIRVRDTENPKVSTCPTSFEVRLSPGERNRLIFWQEPTFTDNVGVERVYKTREPGQLMYPGIHNVRYIASDAAGNRAECHFSIHVRESEHRRDSEP 2655          

HSP 2 Score: 396.741 bits (1018), Expect = 1.421e-111
Identity = 307/916 (33.52%), Postives = 418/916 (45.63%), Query Frame = 0
Query:  316 EVDLLRLDASCIIQ-----FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYC----------------------------------------KCDSGY---EGDDCSDINECETQDLI--CDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-------------------IYGD------------------CINTPGSFYCECHPGFELMED---SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGG-----KCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYC------------------RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            E  + RLD SCI++     FT+A P+ +A   +Y  R  +   P   Y   +Y+C EGY F+ S  D LFCS+  W+G  P CV      + +  R +     Q++  CEH+C  D      C C DGF +     C D+DEC +    C  IC N PG++ C+C  G+   + G +C+D+NECL+NNGHGPCQ  C N++G Y+C C  +PG +L+  DNHTC   + C  NNGGCSH C+++    FCLCPDG+ L  DWKTC D+NEC      C N   C N  GS  C                                        KC+ G+   +  +C DI+EC  +  +  C H C+N  G  +CTC  GF L  D   C D DECE  +  C   CNN EG+F+C C  GF L  DNLTC     C      C                    ++ D                  C+N  G F C C  GF+ +E    +C D++EC N+       C N++G Y C C SG+  +  N TC D++EC+   + C    C+N    Y+CSC  GY         + +C+  N C  GG     +C+N+ G F C C PGY   N    C D NE       C    +CVN  GS+ C C  G    + D  +C+  D C  + C H+ C+     FEC C  GF L E    TC+D +EC  N  DCS  C N LGS+ C                   C EG ++D+ G C   DEC L R  N  C  +C+N     +C C  G+ + S D   CV  + C   N  C H C++      C C  G++    +   C     C   +  CS  C +T+    + C CP GF L  D R+C  +
Sbjct:  152 ETIMSRLDLSCIMKARRKGFTKAPPVENAYPAKYARR-KSVLPPYNRYLVAVYECTEGYVFEDSTTDRLFCSDGAWLGTIPRCVKVEEATLNNVKRCN-----QDRGGCEHVCE-DTQTGVNCSCFDGFRVKGS-SCIDIDECAESTAGCAQICHNDPGSFHCECHSGYQLGTDGKSCLDVNECLVNNGHGPCQGGCINLEGSYECNCSDIPGHKLA-ADNHTCEDIDECSTNNGGCSHVCLNTPGSAFCLCPDGFYLTNDWKTCQDVNECENASKVCTNNTDCENTVGSFKCVSKPQKMTKVLQDEDYDAEDDEDDDDYDEEEGITEIPEFGKCEDGFRKSKNGECIDIDECSDEGELPSCQHGCVNEPGGYYCTCHLGFKLGEDGVSCHDIDECEDGSRPCSHGCNNTEGSFECTCPTGFTLKEDNLTCARARSCETLSTPCSHECRESEDGPICVCPLGYRVHEDEVSCVDTDECAVNPCSHSCVNFEGGFACTCPQGFQTLEHDKYNCTDVDECANNVHDCEHECVNVQGGYTCNCRSGFALNDDNRTCSDVDECLDGVHRCEQ-ICVNSIGNYTCSCREGYRISK---EGFLDCVDINECDEGGHGCSHECSNEEGGFKCGCPPGYLLGNDSRICQDANECLEGTHQCSH--ECVNLQGSYACTCPLGMTVSE-DKRLCVPLDPCRFANCSHT-CERRRDTFECGCPDGFVLHED-GKTCQDFDECLENEHDCSHECANTLGSYECLCPDGLTLLQDGLTCEDPSCPEGLRQDDEGGCRDIDEC-LER--NHECSHICVNEHATYRCSCLSGWTL-SDDGVTCVLSDPCA--NSSCSHICLSYASTPVCDCPPGYEL-AADAATCEDVDECRDGSANCSFSCTNTDGS--YACDCPQGFILGEDGRSCVDV 1040          

HSP 3 Score: 327.02 bits (837), Expect = 1.837e-89
Identity = 272/769 (35.37%), Postives = 354/769 (46.03%), Query Frame = 0
Query:  408 SCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDD-GECEDVDECVDDPELCDHICTNKPGTYMCDC--RLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN-NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI-QCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-------------------------------------------SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYV---DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNG-GCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLH-HRCMCPSGFKLKTDARTCKPI 1107
            +C P     + C H  Y   G    C C +GF L DD   C DVDEC + P  C + C N  G+Y C+C   L      T C DI+EC+ NN +G C  +C N  G + C C   P      +D  TC   + C VN NGGCSH+C ++     C+CP GYEL ED KTC D++EC   D   C + C N  GS +C C  GYE    G  C+D++EC   D  C H C NTEGS +C C  G++L+++ + C D DEC   D  GC   C NL+G + C C  G+ +  DN TCT    C     NC     C+N  G + CEC  G+EL  D                                           SC+D NEC       S SC N +G+YEC C +GY      +TC D+NECI +   C H  C N   G  C+C   Y    D    C + DECL DN  G    C+ + G+  C C PG      N  C + N+   +   C  +  C   DG   C C    +  +N + +C++ + C S    C H +C+   G   CLC     L++     C   N+C ++NG CS +C    GS  C C  G+K  E  N  C   DEC         C   C N  GG +C CN G+ V   +P  C D +EC    G GC HAC N +G   C+C  G+  +  N + C     C  NNG CSH C   E G     C CP GF+LK D RTC+ I
Sbjct: 1118 NCFPPSAVHRNCSHA-YERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDECVENN-NGGCSHDCANTQGSFHCVC---PRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDNGCSHECANTEGSFYCICPRGYELIEDGKTCADVDECTRKDVHGCSHRCENLDGGYVCSCPDGWIVGRDNRTCT--MACEAAPHNCSHT--CVNVRGGYECECPAGWELSSDGRTCEEVDFCAGGHGCSHECARVAGGGFQCRCPAGYVLSEDNRSCLDRNECEEGNGGCSHSCVNTDGSYECGCPNGYRLAADRNTCEDVNECIEDNGGCSH-LCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNG-GCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNGGCSHY--CSYEDGRVACSCPTDLVLSENGT-VCVEENGCSSGNGGCSH-DCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDEC---SELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDN-KTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDI 1867          

HSP 4 Score: 312.383 bits (799), Expect = 5.984e-85
Identity = 258/738 (34.96%), Postives = 351/738 (47.56%), Query Frame = 0
Query:  432 TCE---CHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM---------------------------------------DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNP---CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECL-HDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHY-CRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105
            TCE   C +G   +D+G C D+DEC++    C HIC N+  TY C C  G+T    G  CV  + C     +  C   C +      C+C   PG +L+  D  TC   + C+  +  CS  C ++     C CP G+ L ED ++CVD++EC   D  C  +C+N+ G+  C C  GY        C D++EC T    C H C NT G  +CTC  G+ L                                        DE  C D DEC      C   C N +G+++C C PG  L  D  TC D +EC +   N G   DC NT GSF+C C  G+EL+ED  +C D++EC  +   G S  C N +G++ C C  GY  I    TC D++EC  N    C H +C N    + C C  GY  +++   C D DEC+ +DN  G   +C N  GSF C C  GYE       C D++E +  KD  G    C N DG + C C  G+I  + D+  C    E     C H+ C N  GG+EC C  G+ LS     TCE+++ CA  +G CS  C  + G  + CRC  GY   +D R +C  ++EC      NGGC   C+N  G  +C C  GY + + D   C D NEC  +NGGC H C N  GG  C+C   +K  E + + CV+   C ++NGGC+H+C      +   C CP G  L  D  TC 
Sbjct:  898 TCEDPSCPEGLRQDDEGGCRDIDECLERNHECSHICVNEHATYRCSCLSGWTLSDDGVTCVLSDPC----ANSSCSHICLSYASTPVCDC--PPGYELA-ADAATCEDVDECRDGSANCSFSCTNTDGSYACDCPQGFILGEDGRSCVDVDECARRDHDCPRECVNLEGTYECVCPIGYAFSKTELACVDVDECGTGQHACSHACTNTPGGYNCTCPIGWRLREDSRNCFPPSAVHRNCSHAYERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDEC-VENNNGGCSHDCANTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSH-DCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDN--GCSHECANTEGSFYCICPRGYELIEDGKTCADVDECT-RKDVHGCSHRCENLDGGYVCSCPDGWIVGR-DNRTCTMACEAAPHNCSHT-CVNVRGGYECECPAGWELSSD-GRTCEEVDFCAGGHG-CSHECARVAGGGFQCRCPAGYVLSEDNR-SCLDRNEC---EEGNGGCSHSCVNTDGSYECGCPNGYRL-AADRNTCEDVNECIEDNGGCSHLCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTV--SCFCPPGMILADDNATCA 1612          

HSP 5 Score: 289.656 bits (740), Expect = 8.024e-78
Identity = 244/711 (34.32%), Postives = 332/711 (46.69%), Query Frame = 0
Query:  365 CDEGYAFDPSKP----DTLFCSERRWIGKRPLCV-----------AKSTLEIADPSRPSCDPDVQEKKRCEHICYL--DKGVTPTCECHDGFFLNDDGE-CEDVDECVD---DPEL-CDHICTNKPGTYMCDCRLGFT---SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGC-KPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN-STCLDINECIRNPCG-HGECINESPGYSCSCHSGYVDVDN----VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNG------GCQQLCINIPGGLKC--ECNPGYIVDSQDPRLCVDKNE 1024
            C+EG+   P +P    D   C + R  G    C                LE  + +    D   +    C H C+   + G    C C  GF L  D   CED+DEC +   D +L C HIC N  G Y C+C  G+         C+D+NECL  N    C  +C N+ G Y C C    G  L   D  TC+  + C   NGGCSH+C ++    FC CP GYEL +D KTC+D++EC T    CL++C+N  GS  C C  G+    +   C D++EC+  +  C H C+N  G   C C  G  L  D   C D DEC  DNGGC  VC N  G++ C C   G HL+TD  TC D NEC +    C    +CIN  GS+ CEC  GF L  D  +C D+NEC +     S  C N  G Y C C  G+   N S C  ++ C  +  G    C   +   +C C  G+   +N     CRD DEC      G    C N  GSF C C  G+E +N  C DI+E +     C  + +C+N+ GS+ C C  G    + + + C+D +EC   +  C H +C NT+G + C C  G+       N C+DINEC  +NG C+  CVN  GS+YC C        DER     +  CR    P        G     ++ P G +C  +C  G+ ++    R C+  ++
Sbjct: 1764 CNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECL--NDRHNCSHDCLNLLGSYVCTC--YQGHYLH-SDKSTCLDIDECLERNGGCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADCLHECVNTLGSWTCTCPDGHALANDSKTCVDVDECKVDNGGCSHACLNVVGGVRCNCPIGLRLDEDGKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEMENGECS--DNCINVRGSYRCECPAGFRLKNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQH-GCDQLCVNTVGSFQCSCKQGFEMQNSTCVDIDECATMD--CKGY-ECINSYGSYRCECDIGH---RLEGDHCVDINECAWNNGGCEH-DCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQ 2459          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: XP_006561358.1 (PREDICTED: fibrillin-2 isoform X1 [Apis mellifera])

HSP 1 Score: 451.825 bits (1161), Expect = 1.924e-129
Identity = 369/1146 (32.20%), Postives = 516/1146 (45.03%), Query Frame = 0
Query:  413 VQEKKRCEHICY-LDKGVTPTCECHDGF-FLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL-DEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY---EGDD--CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL--MDETECFDKDECEMDNG-GCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSF-YCECHPGFELMED--SCMDINEC----TNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINECI--RNPCGHGECINESPGYSCSCHSG-YVDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGH----------------------------------------TCSCHLGFKPDE-KNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP-----SNGYYRCNKKKVSGYFVKGTKCK------------------------LKCRKGFMP-----------------TGHITRKCINNG-----TWTGDEDHACEVMNCPPL--------PPLHNGNISP-ETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEW--------KRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENP 1415
            +++   C H+C  ++ GV   C C D +  L DDG+ C ++DEC+ D   C H+C  + GT  C C  G         C + N+C  +NG   C   C   DG   C C   P   +  ++   C+ +  C   NGGCSH+C +   + FCLCPD   L D+D   CV  N+C   +  C + C    GS  C+C SG+   EGD+  C D++EC      C H C NTEG   C C  GF +  ++   C D DECE   G GC   C NL G+F C C  G+ L  DN TC   + C     NC  +   +   G   +C C  GF L +D  +C DI+EC     +  L  S  C N EG Y C+C SGYI    +   C+D+NEC+  R+ C H +C+N    Y C+C+ G Y+  D + C D DECL  N  G   +C N  G   C C  GYE       C D++E   +   C    +CVN  GS+ C C  G     NDS  C+D DEC   +  C H+ C N +GG  C C  G  L E    TC D++EC+ +NG CS VCVN +GS+ CRC     +   +   C   +EC +    NG C   CIN+ G  +CEC  G+ +   D R C D NEC  +NGGC H C+N+LGG+                                         C C  GF+ DE ++P +C     C+ +  GC  +C +T      +C C  GF+++    TC  I    +   +      S G YRC      G+ ++G  C                           CR G++P                  G     C+N       T  GD   A +   C           PPLH     P  +      P G++C   C  G+++ G     C    +W        +   V   + +    RP + CP DM   LP    ++ V  P+P++N+NW RYVD+ P WA  L+ ++  G  VVTF A SPV+   ++TC+++I V+D   P V  CP SF   LSPG+  + I W EP F DN+ ++ V  +  PG     G H + Y ASD  GN   C F+I ++  + +    P
Sbjct: 1535 IEDNGGCSHLCANIEGGVE--CACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNG--GCSHYCSYEDGRVACSC---PTDLVLSENGTVCVEENGCSSGNGGCSHDCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDECSELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECLNDRHNCSH-DCLNLLGSYVCTCYQGHYLHSDKSTCLDIDECLERNG-GCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADC--LHECVNTLGSWTCTCPDGHAL-ANDSKTCVDVDECKVDNGGCSHA-CLNVVGGVRCNCPIGLRLDED-GKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEME---NGECSDNCINVRGSYRCECPAGFRL-KNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQHGCDQLCVNTVGSF--QCSCKQGFEMQNS--TCVDIDECATMDCKGYECINSYGSYRCECDI--GHRLEGDHCVDINECAWNNGGCEHDCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQWNGKEPTCIQASIVTDSRYHSDMPRPFVRCPRDMDVELPARQNTIRVSFPQPKSNMNWWRYVDASPSWAKQLQADLPAGTTVVTFTAWSPVS-NYTSTCRIVIRVRDTENPKVSTCPTSFEVRLSPGERNRLIFWQEPTFTDNVGVERVYKTREPGQLMYPGIHNVRYIASDAAGNRAECHFSIHVRESEHRRDSEP 2655          

HSP 2 Score: 396.741 bits (1018), Expect = 1.326e-111
Identity = 307/916 (33.52%), Postives = 418/916 (45.63%), Query Frame = 0
Query:  316 EVDLLRLDASCIIQ-----FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYC----------------------------------------KCDSGY---EGDDCSDINECETQDLI--CDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-------------------IYGD------------------CINTPGSFYCECHPGFELMED---SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGG-----KCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYC------------------RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            E  + RLD SCI++     FT+A P+ +A   +Y  R  +   P   Y   +Y+C EGY F+ S  D LFCS+  W+G  P CV      + +  R +     Q++  CEH+C  D      C C DGF +     C D+DEC +    C  IC N PG++ C+C  G+   + G +C+D+NECL+NNGHGPCQ  C N++G Y+C C  +PG +L+  DNHTC   + C  NNGGCSH C+++    FCLCPDG+ L  DWKTC D+NEC      C N   C N  GS  C                                        KC+ G+   +  +C DI+EC  +  +  C H C+N  G  +CTC  GF L  D   C D DECE  +  C   CNN EG+F+C C  GF L  DNLTC     C      C                    ++ D                  C+N  G F C C  GF+ +E    +C D++EC N+       C N++G Y C C SG+  +  N TC D++EC+   + C    C+N    Y+CSC  GY         + +C+  N C  GG     +C+N+ G F C C PGY   N    C D NE       C    +CVN  GS+ C C  G    + D  +C+  D C  + C H+ C+     FEC C  GF L E    TC+D +EC  N  DCS  C N LGS+ C                   C EG ++D+ G C   DEC L R  N  C  +C+N     +C C  G+ + S D   CV  + C   N  C H C++      C C  G++    +   C     C   +  CS  C +T+    + C CP GF L  D R+C  +
Sbjct:  152 ETIMSRLDLSCIMKARRKGFTKAPPVENAYPAKYARR-KSVLPPYNRYLVAVYECTEGYVFEDSTTDRLFCSDGAWLGTIPRCVKVEEATLNNVKRCN-----QDRGGCEHVCE-DTQTGVNCSCFDGFRVKGS-SCIDIDECAESTAGCAQICHNDPGSFHCECHSGYQLGTDGKSCLDVNECLVNNGHGPCQGGCINLEGSYECNCSDIPGHKLA-ADNHTCEDIDECSTNNGGCSHVCLNTPGSAFCLCPDGFYLTNDWKTCQDVNECENASKVCTNNTDCENTVGSFKCVSKPQKMTKVLQDEDYDAEDDEDDDDYDEEEGITEIPEFGKCEDGFRKSKNGECIDIDECSDEGELPSCQHGCVNEPGGYYCTCHLGFKLGEDGVSCHDIDECEDGSRPCSHGCNNTEGSFECTCPTGFTLKEDNLTCARARSCETLSTPCSHECRESEDGPICVCPLGYRVHEDEVSCVDTDECAVNPCSHSCVNFEGGFACTCPQGFQTLEHDKYNCTDVDECANNVHDCEHECVNVQGGYTCNCRSGFALNDDNRTCSDVDECLDGVHRCEQ-ICVNSIGNYTCSCREGYRISK---EGFLDCVDINECDEGGHGCSHECSNEEGGFKCGCPPGYLLGNDSRICQDANECLEGTHQCSH--ECVNLQGSYACTCPLGMTVSE-DKRLCVPLDPCRFANCSHT-CERRRDTFECGCPDGFVLHED-GKTCQDFDECLENEHDCSHECANTLGSYECLCPDGLTLLQDGLTCEDPSCPEGLRQDDEGGCRDIDEC-LER--NHECSHICVNEHATYRCSCLSGWTL-SDDGVTCVLSDPCA--NSSCSHICLSYASTPVCDCPPGYEL-AADAATCEDVDECRDGSANCSFSCTNTDGS--YACDCPQGFILGEDGRSCVDV 1040          

HSP 3 Score: 327.405 bits (838), Expect = 1.453e-89
Identity = 273/771 (35.41%), Postives = 356/771 (46.17%), Query Frame = 0
Query:  408 SCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDD-GECEDVDECVDDPELCDHICTNKPGTYMCDC--RLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN-NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI-QCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-------------------------------------------SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYV---DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNG-GCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESG---LHHRCMCPSGFKLKTDARTCKPI 1107
            +C P     + C H  Y   G    C C +GF L DD   C DVDEC + P  C + C N  G+Y C+C   L      T C DI+EC+ NN +G C  +C N  G + C C   P      +D  TC   + C VN NGGCSH+C ++     C+CP GYEL ED KTC D++EC   D   C + C N  GS +C C  GYE    G  C+D++EC   D  C H C NTEGS +C C  G++L+++ + C D DEC   D  GC   C NL+G + C C  G+ +  DN TCT    C     NC     C+N  G + CEC  G+EL  D                                           SC+D NEC       S SC N +G+YEC C +GY      +TC D+NECI +   C H  C N   G  C+C   Y    D    C + DECL DN  G    C+ + G+  C C PG      N  C + N+   +   C  +  C   DG   C C    +  +N + +C++ + C S    C H +C+   G   CLC     L++     C   N+C ++NG CS +C    GS  C C  G+K  E  N  C   DEC         C   C N  GG +C CN G+ V   +P  C D +EC    G GC HAC N +G   C+C  G+  +  N + C     C  NNG CSH C   E G   +H  C CP GF+LK D RTC+ I
Sbjct: 1118 NCFPPSAVHRNCSHA-YERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDECVENN-NGGCSHDCANTQGSFHCVC---PRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDNGCSHECANTEGSFYCICPRGYELIEDGKTCADVDECTRKDVHGCSHRCENLDGGYVCSCPDGWIVGRDNRTCT--MACEAAPHNCSHT--CVNVRGGYECECPAGWELSSDGRTCEEVDFCAGGHGCSHECARVAGGGFQCRCPAGYVLSEDNRSCLDRNECEEGNGGCSHSCVNTDGSYECGCPNGYRLAADRNTCEDVNECIEDNGGCSH-LCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNG-GCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNGGCSHY--CSYEDGRVACSCPTDLVLSENGT-VCVEENGCSSGNGGCSH-DCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDEC---SELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDN-KTCRLVDGCKRNNGNCSHHCHHVEEGGEVVH--CSCPLGFRLKQDQRTCEDI 1867          

HSP 4 Score: 312.768 bits (800), Expect = 4.902e-85
Identity = 258/738 (34.96%), Postives = 351/738 (47.56%), Query Frame = 0
Query:  432 TCE---CHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM---------------------------------------DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNP---CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECL-HDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHY-CRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105
            TCE   C +G   +D+G C D+DEC++    C HIC N+  TY C C  G+T    G  CV  + C     +  C   C +      C+C   PG +L+  D  TC   + C+  +  CS  C ++     C CP G+ L ED ++CVD++EC   D  C  +C+N+ G+  C C  GY        C D++EC T    C H C NT G  +CTC  G+ L                                        DE  C D DEC      C   C N +G+++C C PG  L  D  TC D +EC +   N G   DC NT GSF+C C  G+EL+ED  +C D++EC  +   G S  C N +G++ C C  GY  I    TC D++EC  N    C H +C N    + C C  GY  +++   C D DEC+ +DN  G   +C N  GSF C C  GYE       C D++E +  KD  G    C N DG + C C  G+I  + D+  C    E     C H+ C N  GG+EC C  G+ LS     TCE+++ CA  +G CS  C  + G  + CRC  GY   +D R +C  ++EC      NGGC   C+N  G  +C C  GY + + D   C D NEC  +NGGC H C N  GG  C+C   +K  E + + CV+   C ++NGGC+H+C      +   C CP G  L  D  TC 
Sbjct:  898 TCEDPSCPEGLRQDDEGGCRDIDECLERNHECSHICVNEHATYRCSCLSGWTLSDDGVTCVLSDPC----ANSSCSHICLSYASTPVCDC--PPGYELA-ADAATCEDVDECRDGSANCSFSCTNTDGSYACDCPQGFILGEDGRSCVDVDECARRDHDCPRECVNLEGTYECVCPIGYAFSKTELACVDVDECGTGQHACSHACTNTPGGYNCTCPIGWRLREDSRNCFPPSAVHRNCSHAYERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDEC-VENNNGGCSHDCANTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSH-DCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDN--GCSHECANTEGSFYCICPRGYELIEDGKTCADVDECT-RKDVHGCSHRCENLDGGYVCSCPDGWIVGR-DNRTCTMACEAAPHNCSHT-CVNVRGGYECECPAGWELSSD-GRTCEEVDFCAGGHG-CSHECARVAGGGFQCRCPAGYVLSEDNR-SCLDRNEC---EEGNGGCSHSCVNTDGSYECGCPNGYRL-AADRNTCEDVNECIEDNGGCSHLCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTV--SCFCPPGMILADDNATCA 1612          

HSP 5 Score: 290.041 bits (741), Expect = 5.443e-78
Identity = 245/711 (34.46%), Postives = 334/711 (46.98%), Query Frame = 0
Query:  365 CDEGYAFDPSKP----DTLFCSERRWIGKRPLCV-----------AKSTLEIADPSRPSCDPDVQEKKRCEHICYL--DKGVTPTCECHDGFFLNDDGE-CEDVDECVD---DPEL-CDHICTNKPGTYMCDCRLGFT---SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGC-KPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN-STCLDINECIRNPCG-HGECINESPGYSCSCHSGYVDVDN----VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNG------GCQQLCINIPGGLKC--ECNPGYIVDSQDPRLCVDKNE 1024
            C+EG+   P +P    D   C + R  G    C                LE  + +    D   +    C H C+   + G    C C  GF L  D   CED+DEC +   D +L C HIC N  G Y C+C  G+         C+D+NECL N+ H  C  +C N+ G Y C C    G  L   D  TC+  + C   NGGCSH+C ++    FC CP GYEL +D KTC+D++EC T    CL++C+N  GS  C C  G+    +   C D++EC+  +  C H C+N  G   C C  G  L  D   C D DEC  DNGGC  VC N  G++ C C   G HL+TD  TC D NEC +    C    +CIN  GS+ CEC  GF L  D  +C D+NEC +     S  C N  G Y C C  G+   N S C  ++ C  +  G    C   +   +C C  G+   +N     CRD DEC      G    C N  GSF C C  G+E +N  C DI+E +     C  + +C+N+ GS+ C C  G    + + + C+D +EC   +  C H +C NT+G + C C  G+       N C+DINEC  +NG C+  CVN  GS+YC C        DER     +  CR    P        G     ++ P G +C  +C  G+ ++    R C+  ++
Sbjct: 1764 CNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECL-NDRHN-CSHDCLNLLGSYVCTC--YQGHYLH-SDKSTCLDIDECLERNGGCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADCLHECVNTLGSWTCTCPDGHALANDSKTCVDVDECKVDNGGCSHACLNVVGGVRCNCPIGLRLDEDGKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEMENGECS--DNCINVRGSYRCECPAGFRLKNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQH-GCDQLCVNTVGSFQCSCKQGFEMQNSTCVDIDECATMD--CKGY-ECINSYGSYRCECDIGH---RLEGDHCVDINECAWNNGGCEH-DCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQ 2459          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: XP_016768136.1 (PREDICTED: fibrillin-2 isoform X4 [Apis mellifera])

HSP 1 Score: 451.055 bits (1159), Expect = 2.895e-129
Identity = 369/1146 (32.20%), Postives = 516/1146 (45.03%), Query Frame = 0
Query:  413 VQEKKRCEHICY-LDKGVTPTCECHDGF-FLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL-DEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY---EGDD--CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL--MDETECFDKDECEMDNG-GCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSF-YCECHPGFELMED--SCMDINEC----TNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINECI--RNPCGHGECINESPGYSCSCHSG-YVDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGH----------------------------------------TCSCHLGFKPDE-KNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP-----SNGYYRCNKKKVSGYFVKGTKCK------------------------LKCRKGFMP-----------------TGHITRKCINNG-----TWTGDEDHACEVMNCPPL--------PPLHNGNISP-ETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEW--------KRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENP 1415
            +++   C H+C  ++ GV   C C D +  L DDG+ C ++DEC+ D   C H+C  + GT  C C  G         C + N+C  +NG   C   C   DG   C C   P   +  ++   C+ +  C   NGGCSH+C +   + FCLCPD   L D+D   CV  N+C   +  C + C    GS  C+C SG+   EGD+  C D++EC      C H C NTEG   C C  GF +  ++   C D DECE   G GC   C NL G+F C C  G+ L  DN TC   + C     NC  +   +   G   +C C  GF L +D  +C DI+EC     +  L  S  C N EG Y C+C SGYI    +   C+D+NEC+  R+ C H +C+N    Y C+C+ G Y+  D + C D DECL  N  G   +C N  G   C C  GYE       C D++E   +   C    +CVN  GS+ C C  G     NDS  C+D DEC   +  C H+ C N +GG  C C  G  L E    TC D++EC+ +NG CS VCVN +GS+ CRC     +   +   C   +EC +    NG C   CIN+ G  +CEC  G+ +   D R C D NEC  +NGGC H C+N+LGG+                                         C C  GF+ DE ++P +C     C+ +  GC  +C +T      +C C  GF+++    TC  I    +   +      S G YRC      G+ ++G  C                           CR G++P                  G     C+N       T  GD   A +   C           PPLH     P  +      P G++C   C  G+++ G     C    +W        +   V   + +    RP + CP DM   LP    ++ V  P+P++N+NW RYVD+ P WA  L+ ++  G  VVTF A SPV+   ++TC+++I V+D   P V  CP SF   LSPG+  + I W EP F DN+ ++ V  +  PG     G H + Y ASD  GN   C F+I ++  + +    P
Sbjct: 1407 IEDNGGCSHLCANIEGGVE--CACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNG--GCSHYCSYEDGRVACSC---PTDLVLSENGTVCVEENGCSSGNGGCSHDCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDECSELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECLNDRHNCSH-DCLNLLGSYVCTCYQGHYLHSDKSTCLDIDECLERNG-GCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADC--LHECVNTLGSWTCTCPDGHAL-ANDSKTCVDVDECKVDNGGCSHA-CLNVVGGVRCNCPIGLRLDED-GKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEME---NGECSDNCINVRGSYRCECPAGFRL-KNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQHGCDQLCVNTVGSF--QCSCKQGFEMQN--STCVDIDECATMDCKGYECINSYGSYRCECDI--GHRLEGDHCVDINECAWNNGGCEHDCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQWNGKEPTCIQASIVTDSRYHSDMPRPFVRCPRDMDVELPARQNTIRVSFPQPKSNMNWWRYVDASPSWAKQLQADLPAGTTVVTFTAWSPVS-NYTSTCRIVIRVRDTENPKVSTCPTSFEVRLSPGERNRLIFWQEPTFTDNVGVERVYKTREPGQLMYPGIHNVRYIASDAAGNRAECHFSIHVRESEHRRDSEP 2527          

HSP 2 Score: 395.971 bits (1016), Expect = 2.144e-111
Identity = 307/916 (33.52%), Postives = 418/916 (45.63%), Query Frame = 0
Query:  316 EVDLLRLDASCIIQ-----FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYC----------------------------------------KCDSGY---EGDDCSDINECETQDLI--CDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-------------------IYGD------------------CINTPGSFYCECHPGFELMED---SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGG-----KCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYC------------------RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            E  + RLD SCI++     FT+A P+ +A   +Y  R  +   P   Y   +Y+C EGY F+ S  D LFCS+  W+G  P CV      + +  R +     Q++  CEH+C  D      C C DGF +     C D+DEC +    C  IC N PG++ C+C  G+   + G +C+D+NECL+NNGHGPCQ  C N++G Y+C C  +PG +L+  DNHTC   + C  NNGGCSH C+++    FCLCPDG+ L  DWKTC D+NEC      C N   C N  GS  C                                        KC+ G+   +  +C DI+EC  +  +  C H C+N  G  +CTC  GF L  D   C D DECE  +  C   CNN EG+F+C C  GF L  DNLTC     C      C                    ++ D                  C+N  G F C C  GF+ +E    +C D++EC N+       C N++G Y C C SG+  +  N TC D++EC+   + C    C+N    Y+CSC  GY         + +C+  N C  GG     +C+N+ G F C C PGY   N    C D NE       C    +CVN  GS+ C C  G    + D  +C+  D C  + C H+ C+     FEC C  GF L E    TC+D +EC  N  DCS  C N LGS+ C                   C EG ++D+ G C   DEC L R  N  C  +C+N     +C C  G+ + S D   CV  + C   N  C H C++      C C  G++    +   C     C   +  CS  C +T+    + C CP GF L  D R+C  +
Sbjct:   24 ETIMSRLDLSCIMKARRKGFTKAPPVENAYPAKYARR-KSVLPPYNRYLVAVYECTEGYVFEDSTTDRLFCSDGAWLGTIPRCVKVEEATLNNVKRCN-----QDRGGCEHVCE-DTQTGVNCSCFDGFRVKG-SSCIDIDECAESTAGCAQICHNDPGSFHCECHSGYQLGTDGKSCLDVNECLVNNGHGPCQGGCINLEGSYECNCSDIPGHKLA-ADNHTCEDIDECSTNNGGCSHVCLNTPGSAFCLCPDGFYLTNDWKTCQDVNECENASKVCTNNTDCENTVGSFKCVSKPQKMTKVLQDEDYDAEDDEDDDDYDEEEGITEIPEFGKCEDGFRKSKNGECIDIDECSDEGELPSCQHGCVNEPGGYYCTCHLGFKLGEDGVSCHDIDECEDGSRPCSHGCNNTEGSFECTCPTGFTLKEDNLTCARARSCETLSTPCSHECRESEDGPICVCPLGYRVHEDEVSCVDTDECAVNPCSHSCVNFEGGFACTCPQGFQTLEHDKYNCTDVDECANNVHDCEHECVNVQGGYTCNCRSGFALNDDNRTCSDVDECLDGVHRCEQ-ICVNSIGNYTCSCREGYRISK---EGFLDCVDINECDEGGHGCSHECSNEEGGFKCGCPPGYLLGNDSRICQDANECLEGTHQCSH--ECVNLQGSYACTCPLGMTVSE-DKRLCVPLDPCRFANCSHT-CERRRDTFECGCPDGFVLHED-GKTCQDFDECLENEHDCSHECANTLGSYECLCPDGLTLLQDGLTCEDPSCPEGLRQDDEGGCRDIDEC-LER--NHECSHICVNEHATYRCSCLSGWTL-SDDGVTCVLSDPCA--NSSCSHICLSYASTPVCDCPPGYEL-AADAATCEDVDECRDGSANCSFSCTNTDGS--YACDCPQGFILGEDGRSCVDV 912          

HSP 3 Score: 326.25 bits (835), Expect = 2.976e-89
Identity = 272/769 (35.37%), Postives = 354/769 (46.03%), Query Frame = 0
Query:  408 SCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDD-GECEDVDECVDDPELCDHICTNKPGTYMCDC--RLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN-NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI-QCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-------------------------------------------SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYV---DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNG-GCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLH-HRCMCPSGFKLKTDARTCKPI 1107
            +C P     + C H  Y   G    C C +GF L DD   C DVDEC + P  C + C N  G+Y C+C   L      T C DI+EC+ NN +G C  +C N  G + C C   P      +D  TC   + C VN NGGCSH+C ++     C+CP GYEL ED KTC D++EC   D   C + C N  GS +C C  GYE    G  C+D++EC   D  C H C NTEGS +C C  G++L+++ + C D DEC   D  GC   C NL+G + C C  G+ +  DN TCT    C     NC     C+N  G + CEC  G+EL  D                                           SC+D NEC       S SC N +G+YEC C +GY      +TC D+NECI +   C H  C N   G  C+C   Y    D    C + DECL DN  G    C+ + G+  C C PG      N  C + N+   +   C  +  C   DG   C C    +  +N + +C++ + C S    C H +C+   G   CLC     L++     C   N+C ++NG CS +C    GS  C C  G+K  E  N  C   DEC         C   C N  GG +C CN G+ V   +P  C D +EC    G GC HAC N +G   C+C  G+  +  N + C     C  NNG CSH C   E G     C CP GF+LK D RTC+ I
Sbjct:  990 NCFPPSAVHRNCSHA-YERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDECVENN-NGGCSHDCANTQGSFHCVC---PRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDNGCSHECANTEGSFYCICPRGYELIEDGKTCADVDECTRKDVHGCSHRCENLDGGYVCSCPDGWIVGRDNRTCT--MACEAAPHNCSHT--CVNVRGGYECECPAGWELSSDGRTCEEVDFCAGGHGCSHECARVAGGGFQCRCPAGYVLSEDNRSCLDRNECEEGNGGCSHSCVNTDGSYECGCPNGYRLAADRNTCEDVNECIEDNGGCSH-LCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNG-GCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNGGCSHY--CSYEDGRVACSCPTDLVLSENGT-VCVEENGCSSGNGGCSH-DCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDEC---SELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDN-KTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDI 1739          

HSP 4 Score: 311.612 bits (797), Expect = 1.141e-84
Identity = 258/738 (34.96%), Postives = 351/738 (47.56%), Query Frame = 0
Query:  432 TCE---CHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM---------------------------------------DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNP---CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECL-HDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHY-CRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105
            TCE   C +G   +D+G C D+DEC++    C HIC N+  TY C C  G+T    G  CV  + C     +  C   C +      C+C   PG +L+  D  TC   + C+  +  CS  C ++     C CP G+ L ED ++CVD++EC   D  C  +C+N+ G+  C C  GY        C D++EC T    C H C NT G  +CTC  G+ L                                        DE  C D DEC      C   C N +G+++C C PG  L  D  TC D +EC +   N G   DC NT GSF+C C  G+EL+ED  +C D++EC  +   G S  C N +G++ C C  GY  I    TC D++EC  N    C H +C N    + C C  GY  +++   C D DEC+ +DN  G   +C N  GSF C C  GYE       C D++E +  KD  G    C N DG + C C  G+I  + D+  C    E     C H+ C N  GG+EC C  G+ LS     TCE+++ CA  +G CS  C  + G  + CRC  GY   +D R +C  ++EC      NGGC   C+N  G  +C C  GY + + D   C D NEC  +NGGC H C N  GG  C+C   +K  E + + CV+   C ++NGGC+H+C      +   C CP G  L  D  TC 
Sbjct:  770 TCEDPSCPEGLRQDDEGGCRDIDECLERNHECSHICVNEHATYRCSCLSGWTLSDDGVTCVLSDPC----ANSSCSHICLSYASTPVCDC--PPGYELA-ADAATCEDVDECRDGSANCSFSCTNTDGSYACDCPQGFILGEDGRSCVDVDECARRDHDCPRECVNLEGTYECVCPIGYAFSKTELACVDVDECGTGQHACSHACTNTPGGYNCTCPIGWRLREDSRNCFPPSAVHRNCSHAYERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDEC-VENNNGGCSHDCANTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSH-DCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDN--GCSHECANTEGSFYCICPRGYELIEDGKTCADVDECT-RKDVHGCSHRCENLDGGYVCSCPDGWIVGR-DNRTCTMACEAAPHNCSHT-CVNVRGGYECECPAGWELSSD-GRTCEEVDFCAGGHG-CSHECARVAGGGFQCRCPAGYVLSEDNR-SCLDRNEC---EEGNGGCSHSCVNTDGSYECGCPNGYRL-AADRNTCEDVNECIEDNGGCSHLCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTV--SCFCPPGMILADDNATCA 1484          

HSP 5 Score: 289.271 bits (739), Expect = 1.074e-77
Identity = 244/711 (34.32%), Postives = 332/711 (46.69%), Query Frame = 0
Query:  365 CDEGYAFDPSKP----DTLFCSERRWIGKRPLCV-----------AKSTLEIADPSRPSCDPDVQEKKRCEHICYL--DKGVTPTCECHDGFFLNDDGE-CEDVDECVD---DPEL-CDHICTNKPGTYMCDCRLGFT---SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGC-KPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN-STCLDINECIRNPCG-HGECINESPGYSCSCHSGYVDVDN----VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNG------GCQQLCINIPGGLKC--ECNPGYIVDSQDPRLCVDKNE 1024
            C+EG+   P +P    D   C + R  G    C                LE  + +    D   +    C H C+   + G    C C  GF L  D   CED+DEC +   D +L C HIC N  G Y C+C  G+         C+D+NECL  N    C  +C N+ G Y C C    G  L   D  TC+  + C   NGGCSH+C ++    FC CP GYEL +D KTC+D++EC T    CL++C+N  GS  C C  G+    +   C D++EC+  +  C H C+N  G   C C  G  L  D   C D DEC  DNGGC  VC N  G++ C C   G HL+TD  TC D NEC +    C    +CIN  GS+ CEC  GF L  D  +C D+NEC +     S  C N  G Y C C  G+   N S C  ++ C  +  G    C   +   +C C  G+   +N     CRD DEC      G    C N  GSF C C  G+E +N  C DI+E +     C  + +C+N+ GS+ C C  G    + + + C+D +EC   +  C H +C NT+G + C C  G+       N C+DINEC  +NG C+  CVN  GS+YC C        DER     +  CR    P        G     ++ P G +C  +C  G+ ++    R C+  ++
Sbjct: 1636 CNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECL--NDRHNCSHDCLNLLGSYVCTC--YQGHYLH-SDKSTCLDIDECLERNGGCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADCLHECVNTLGSWTCTCPDGHALANDSKTCVDVDECKVDNGGCSHACLNVVGGVRCNCPIGLRLDEDGKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEMENGECS--DNCINVRGSYRCECPAGFRLKNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQH-GCDQLCVNTVGSFQCSCKQGFEMQNSTCVDIDECATMD--CKGY-ECINSYGSYRCECDIGH---RLEGDHCVDINECAWNNGGCEH-DCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQ 2331          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: EAA10730.5 (AGAP005714-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 433.335 bits (1113), Expect = 2.881e-125
Identity = 330/973 (33.92%), Postives = 454/973 (46.66%), Query Frame = 0
Query:  416 KKRCEHICYLDKGVTPTCECHDGFFLN--DDGECEDVDECVDDPEL-CD-HICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDE-DWKTCVDINECVTG-DIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNL-TCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDEC-LHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNEC-TINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWK----------RIRVNPPK---------CNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFID 1340
            K RC H C +D+     C C DG+ L+  D   C   + C       C+   C      Y C+C  G+     +C + +EC+   G   C  EC N  G Y+C  G             TC     C+ +NGGCS  C++      C C +GYEL E D +TCVD +EC       C + C N  GS YC C +GY+       C D+NECE ++  C H CIN  G   C+C  G  L  D+  C   DECE++NGGC   C+   G   C C  GF L++++  TC D +EC     N G   +C+N+PGS+ C C  G+EL  D  +C D++EC       S  C NL G + C C+ GY   +   TC D++EC    + C H  C+N    Y C C +G+    N   C D DEC    N      +C N  GS+ C C  G+  E  N  C D++E S E   C    DCVN  G F C C  G   D  D   C+D DEC     ++ C H  C+NT G FEC C  G  L +    TC D++ECA+ NG CSQ+CVN  G + C C+ GY     G  C + + C L    NGGCQ  C    G   C C  GY ++  +   C+D NEC    +  CQ  C+N  G + C C+ G++ ++    +C+    C+++NGGC    +   +    RC CP GFKL  D + C  +   C     P N   RC + +        +KC + C+KGF   G   R C   G W   E   C  + CP L    NG I P  C         +C+  C  G++    +   C+    W              V PPK           P   +P I CPPD+ E LP    ++ V + +P TNV+W +YVDS P W   LE E+  G+ +VTFRARSP     +  C+++I ++      V+ C  SF++
Sbjct:  638 KTRCSHEC-VDEVEGFRCHCPDGYLLDEVDQKTCRAEEGCNKHQRRHCEPGRCLRMESDYRCECPEGYVQGQHSCQERDECMP--GQHDCSHECHNTPGSYRCAYG------------RTCEDVNECETDNGGCSQSCLNYEGGYRCSCYEGYELVESDRRTCVDRDECANARGGGCDHNCHNTAGSYYCTCHAGYKLAENARTCMDVNECEERNGNCSHVCINLLGGHQCSCPKGLFLQEDDRTCDFVDECELNNGGCSHGCHYEYGVVSCSCPKGFQLDSEHQKTCVDVDECA-SRGNGGCSHECVNSPGSYECRCPDGYELRHDRHACQDVDECIVENGNCSNICINLPGGHRCACEIGYSLQDDQRTCSDVDECNDGTHDCSH-HCVNVPGAYECECPAGFKLGRNRLSCEDVDECETLPNRGDCEHRCINTIGSYHCGCEDGHRLEANNRTCSDVDECSDELRTCTH--DCVNTKGGFVCSCPSGLRLDV-DGVSCVDVDECRINNFNAGCSHI-CENTHGSFECRCPEGMVLGDDQA-TCSDVDECAVLNGGCSQLCVNRDGGYRCGCHPGYTLMADGKACEVSNPCALR---NGGCQHYCSLKGGQPVCSCREGYTLNKTNQASCIDHNECLQAKDHNCQQRCVNLEGSYRCECYEGYERNDLG--QCLDINECAIDNGGCGAGAQCVNTAGGSRCACPVGFKLTQDRKHCAKLTDNCKPFEAPRNAEVRCTRSRHKTQLFYRSKCIVTCKKGFKLHGPSVRHCNGTGEWDEGES-ICVPLACPRLSRPENGVILPVACTAGKIFASERCVLHCKPGFKPAARRTAVCSLAQTWVPGDNLACVPLDSPVVPPKQLTTTTPTTVAPVAIKPFIQCPPDVHEVLPLGQYTMKVRMERPTTNVDWHKYVDSHPPWGKQLEVELPAGETIVTFRARSPTG-NVNDVCRVVIKIRGEFQEKVRLC-WSFLN 1580          

HSP 2 Score: 275.018 bits (702), Expect = 1.264e-73
Identity = 270/903 (29.90%), Postives = 372/903 (41.20%), Query Frame = 0
Query:  409 CDPDVQEKKRCEHIC---YLDKGVTPT--CECHDGFFLN--DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF---TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEA-----------------CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGD--------IQCLNKCMNVPGSAYCKCDSGYE---------GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE--------------------------------------------CFDKDECEMDNGGCEQVCNNLEGTFQCG--------------------------------CKPGFHL-NTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRN--PCGHGECINESPGYSCSCHSGY---VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECAL--NNGDCSQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN--NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACE 1172
            C PD   +  C+H C   Y    V P   C C+ GF L+  D   C DVDEC D+   C+  C NKPG+Y C C  G    T  G  C+DI+EC        C D C+N  G Y+C     P       +      +E                  C+    GC + C +++    C CP GYEL +D K C D++EC   D          C ++C N  GS  C+C   +           D C D+ E       C H C++      C C  G+ L+DE +                                            C ++DEC      C   C+N  G+++C                                 C  G+ L  +D  TC D +EC       G   +C NT GS+YC CH G++L E++  CMD+NEC       S  C NL G ++C C  G      + TC  ++EC  N   C HG C  E    SCSC  G+    +    C D DEC      G   +C N PGS++C C  GYE ++    C D++E  +E   C     C+N  G   C C  G+   Q+D   C D DEC   +  C H  C N  G +EC C  GF L      +CED++EC    N GDC   C+N +GS++C C +G++ +     C   DEC    R    C   C+N  GG  C C  G  +D  D   CVD +EC IN  N GC H C N  G   C C  G    + +   C     C+V NGGCS +C + + G  +RC C  G+ L  D + C+ +   C  A R     + C+        +KG +    CR+G+         CI++      +DH C+
Sbjct:  388 CGPD---RGGCDHKCRMIYHGNEVEPLVECSCYRGFLLDARDGRTCHDVDECADNNGGCEQTCINKPGSYECGCEPGLQIDTLNGHTCIDIDECQNEATLERCADGCENTFGSYRCLERSKPHEDDEPAEEEEEEEEEEGEGEGEDESENEDDINECEEQEHGCDY-CQNAFGGYQCTCPAGYELADDDKHCQDVDECAASDDDDSGEGGSACSHECHNTVGSFECRCPDAFHLNNDRRTCVRDFCQDLYE-NPNKTRCSHECVDEVEGFRCHCPDGY-LLDEVDQKTCRAEEGCNKHQRRHCEPGRCLRMESDYRCECPEGYVQGQHSCQERDECMPGQHDCSHECHNTPGSYRCAYGRTCEDVNECETDNGGCSQSCLNYEGGYRCSCYEGYELVESDRRTCVDRDECANARGG-GCDHNCHNTAGSYYCTCHAGYKLAENARTCMDVNECEERNGNCSHVCINLLGGHQCSCPKGLFLQEDDRTCDFVDECELNNGGCSHG-CHYEYGVVSCSCPKGFQLDSEHQKTCVDVDECASRGNGGCSHECVNSPGSYECRCPDGYELRHDRHACQDVDECIVENGNCS--NICINLPGGHRCACEIGYSL-QDDQRTCSDVDECNDGTHDCSH-HCVNVPGAYECECPAGFKLGRNRL-SCEDVDECETLPNRGDCEHRCINTIGSYHCGCEDGHRLEANNRTCSDVDECSDELRT---CTHDCVNTKGGFVCSCPSGLRLDV-DGVSCVDVDECRINNFNAGCSHICENTHGSFECRCPEGMVLGD-DQATCSDVDECAVLNGGCSQLCVNRDGG--YRCGCHPGYTLMADGKACE-VSNPC--ALRNGGCQHYCS--------LKGGQPVCSCREGYTLNKTNQASCIDHNECLQAKDHNCQ 1259          

HSP 3 Score: 267.314 bits (682), Expect = 3.004e-71
Identity = 207/569 (36.38%), Postives = 279/569 (49.03%), Query Frame = 0
Query:  393 CVAKSTLEIADPSRPSC-DPDVQEKKR---CEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCIS-DEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEM--DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINEC--TNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGV--GG---KCNNKPGSFDCDCAPGYEF---KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPC-FHSECKNTLGGFECLCETGFALSE 928
            C      E+ +  R +C D D     R   C+H C+   G +  C CH G+ L ++   C DV+EC +    C H+C N  G + C C  G   Q     C  ++EC LNNG   C   C    G   C C    G QL  +   TC+  DE     NGGCSHEC++S     C CPDGYEL  D   C D++EC+  +  C N C+N+PG   C C+ GY   D    CSD++EC      C H+C+N  G+  C C AGF L  +   C D DECE   + G CE  C N  G++ CGC+ G  L  +N TC+D +EC+  +  C    DC+NT G F C C  G  L  D  SC+D++EC   N     S  C N  G++EC+C  G +  +  +TC D++EC + N      C+N   GY C CH GY     +  D   C   NPC +  GG    C+ K G   C C  GY         C D NE    KD       CVN +GS+ C C++G+  ++ND   C+D +EC   +  C   ++C NT GG  C C  GF L++
Sbjct:  769 CSCYEGYELVESDRRTCVDRDECANARGGGCDHNCHNTAG-SYYCTCHAGYKLAENARTCMDVNECEERNGNCSHVCINLLGGHQCSCPKGLFLQEDDRTCDFVDECELNNG--GCSHGCHYEYGVVSCSC--PKGFQLDSEHQKTCVDVDECASRGNGGCSHECVNSPGSYECRCPDGYELRHDRHACQDVDECIVENGNCSNICINLPGGHRCACEIGYSLQDDQRTCSDVDECNDGTHDCSHHCVNVPGAYECECPAGFKLGRNRLSCEDVDECETLPNRGDCEHRCINTIGSYHCGCEDGHRLEANNRTCSDVDECSDELRTC--THDCVNTKGGFVCSCPSGLRLDVDGVSCVDVDECRINNFNAGCSHICENTHGSFECRCPEGMVLGDDQATCSDVDECAVLNGGCSQLCVNRDGGYRCGCHPGYT----LMADGKACEVSNPCALRNGGCQHYCSLKGGQPVCSCREGYTLNKTNQASCIDHNECLQAKDH-NCQQRCVNLEGSYRCECYEGY--ERNDLGQCLDINECAIDNGGCGAGAQCVNTAGGSRCACPVGFKLTQ 1323          

HSP 4 Score: 59.3066 bits (142), Expect = 1.335e-7
Identity = 35/113 (30.97%), Postives = 53/113 (46.90%), Query Frame = 0
Query:  292 IEDIGNSSGEKKEQKARVQFYEKYEVDL-----LRLDASCIIQ-FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKST 398
            I    N +G  K +  +     + E DL      RLD SC+ Q    A  I +  + +Y+ R       G  +    Y+CD+ Y   P + D L+CS ++WIGKRP C++  T
Sbjct:   86 IPAAANQAGNGKRKPGQRAQNIQEETDLDPELAARLDLSCMAQGLLRAPEIDNGYVVKYNRR----KKAGNIFLVAYYECDDYYELQPPEHDRLYCSGKKWIGKRPECISTRT 194          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: XP_006561359.1 (PREDICTED: fibrillin-2 isoform X5 [Apis mellifera])

HSP 1 Score: 391.734 bits (1005), Expect = 5.715e-110
Identity = 307/916 (33.52%), Postives = 418/916 (45.63%), Query Frame = 0
Query:  316 EVDLLRLDASCIIQ-----FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK--CMNVPGSAYC----------------------------------------KCDSGY---EGDDCSDINECETQDLI--CDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCG-------------------IYGD------------------CINTPGSFYCECHPGFELMED---SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGG-----KCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYC------------------RCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            E  + RLD SCI++     FT+A P+ +A   +Y  R  +   P   Y   +Y+C EGY F+ S  D LFCS+  W+G  P CV      + +  R +     Q++  CEH+C  D      C C DGF +     C D+DEC +    C  IC N PG++ C+C  G+   + G +C+D+NECL+NNGHGPCQ  C N++G Y+C C  +PG +L+  DNHTC   + C  NNGGCSH C+++    FCLCPDG+ L  DWKTC D+NEC      C N   C N  GS  C                                        KC+ G+   +  +C DI+EC  +  +  C H C+N  G  +CTC  GF L  D   C D DECE  +  C   CNN EG+F+C C  GF L  DNLTC     C      C                    ++ D                  C+N  G F C C  GF+ +E    +C D++EC N+       C N++G Y C C SG+  +  N TC D++EC+   + C    C+N    Y+CSC  GY         + +C+  N C  GG     +C+N+ G F C C PGY   N    C D NE       C    +CVN  GS+ C C  G    + D  +C+  D C  + C H+ C+     FEC C  GF L E    TC+D +EC  N  DCS  C N LGS+ C                   C EG ++D+ G C   DEC L R  N  C  +C+N     +C C  G+ + S D   CV  + C   N  C H C++      C C  G++    +   C     C   +  CS  C +T+    + C CP GF L  D R+C  +
Sbjct:  152 ETIMSRLDLSCIMKARRKGFTKAPPVENAYPAKYARR-KSVLPPYNRYLVAVYECTEGYVFEDSTTDRLFCSDGAWLGTIPRCVKVEEATLNNVKRCN-----QDRGGCEHVCE-DTQTGVNCSCFDGFRVKG-SSCIDIDECAESTAGCAQICHNDPGSFHCECHSGYQLGTDGKSCLDVNECLVNNGHGPCQGGCINLEGSYECNCSDIPGHKLA-ADNHTCEDIDECSTNNGGCSHVCLNTPGSAFCLCPDGFYLTNDWKTCQDVNECENASKVCTNNTDCENTVGSFKCVSKPQKMTKVLQDEDYDAEDDEDDDDYDEEEGITEIPEFGKCEDGFRKSKNGECIDIDECSDEGELPSCQHGCVNEPGGYYCTCHLGFKLGEDGVSCHDIDECEDGSRPCSHGCNNTEGSFECTCPTGFTLKEDNLTCARARSCETLSTPCSHECRESEDGPICVCPLGYRVHEDEVSCVDTDECAVNPCSHSCVNFEGGFACTCPQGFQTLEHDKYNCTDVDECANNVHDCEHECVNVQGGYTCNCRSGFALNDDNRTCSDVDECLDGVHRCEQ-ICVNSIGNYTCSCREGYRISK---EGFLDCVDINECDEGGHGCSHECSNEEGGFKCGCPPGYLLGNDSRICQDANECLEGTHQCSH--ECVNLQGSYACTCPLGMTVSE-DKRLCVPLDPCRFANCSHT-CERRRDTFECGCPDGFVLHED-GKTCQDFDECLENEHDCSHECANTLGSYECLCPDGLTLLQDGLTCEDPSCPEGLRQDDEGGCRDIDEC-LER--NHECSHICVNEHATYRCSCLSGWTL-SDDGVTCVLSDPCA--NSSCSHICLSYASTPVCDCPPGYEL-AADAATCEDVDECRDGSANCSFSCTNTDGS--YACDCPQGFILGEDGRSCVDV 1040          

HSP 2 Score: 345.125 bits (884), Expect = 2.963e-95
Identity = 280/818 (34.23%), Postives = 387/818 (47.31%), Query Frame = 0
Query:  385 RWIGKRPLCVAKSTLEIADPSRPSC---DPDVQEKKRCEHICYLDKGVTPTCECHDGFFLN--DDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTS---QGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIH---SYNQIFCLCPDGYELDEDWKTCVDINECVT----GDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGYVDVDN---VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEIL-PNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQL-CINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGY-FVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDE 1167
            R+ G    C+    + +AD  +  C   +    +   C  IC    G +  CEC  GF L+  D+  C DVDEC +  + C H CTN  G + C C  GF     +   C D++EC    G G C   C N+ G + C C   P   + + DN TC   + C+ NNG CSH C H       + C CP G+ L +D +TC DI+EC       D+ C + C+N  G  YC+C SGY        +C D+NEC      C H+C+N  GS  CTC  G  L  D++ C D DEC   NGGC   C N  G   C C  G+ L+ D  TC D +EC   +A+C    +C+NT GS+ C C  G  L  DS  C+D++EC       S +C N+ G   C C  G        TC D++EC  +  G  + C+N    YSC C +  + +      C D +EC  +N       C N  GS+ C+C  G+  KN    C D+NE   + D  G   +CVN  G + CVC  G  H+  + + C   D C + +      C    G   C C+ GF L E   P  C DI+ECA +   C Q+CVN +GS  C C +G++  +   C   DEC         C+   CIN  G  +CEC+ G+ ++      CVD NEC  NNGGC+H CIN +G + C+C  G+ P  +N  +C     C  +NGGC+  C +T    +  C C     L +D RTC      C +   P +   RC         +  G +C ++CR+GF   G  TR C+    W G E
Sbjct: 1670 RYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNG-SVACECPSGFKLSEGDNATCVDVDECSELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAG-CSHACANLVGSFHCTC---PTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECLNDRHNCSHDCLNLLGSYVCTCYQGHYLHSDKSTCLDIDECLERNGGCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADC--LHECVNTLGSWTCTCPDGHALANDSKTCVDVDECKVDNGGCSHACLNVVGGVRCNCPIGLRLDEDGKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEMENG-ECSDNCINVRGSYRCECPAGFRLKNDQRTCDDVNE--CDHDNGGCSHECVNELGGYRCVCPPG--HELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQHGCDQLCVNTVGSFQCSCKQGFEM-QNSTCVDIDECATMD-----CKGYECINSYGSYRCECDIGHRLEGDH---CVDINECAWNNGGCEHDCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYY--CTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQWNGKE 2464          

HSP 3 Score: 321.627 bits (823), Expect = 7.895e-88
Identity = 289/848 (34.08%), Postives = 378/848 (44.58%), Query Frame = 0
Query:  343 RYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPL--------------CVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDD-GECEDVDECVDDPELCDHICTNKPGTYMCDC--RLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN-NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGD-IQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDEC-EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-------------------------------------------SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH--NSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYV---DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNG-GCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLH-HRCMCPSGFKLKTDARTCKPI 1107
            R DH  P   +  E   E +  C  GYAF  ++   L C +    G                  C       + + SR +C P     + C H  Y   G    C C +GF L DD   C DVDEC + P  C + C N  G+Y C+C   L      T C DI+EC+ NN +G C  +C N  G + C C   P      +D  TC   + C VN NGGCSH+C ++     C+CP GYEL ED KTC D++EC   D   C + C N  GS +C C  GYE    G  C+D++EC   D  C H C NTEGS +C C  G++L+++ + C D DEC   D  GC   C NL+G + C C  G+ +  DN TCT    C     NC     C+N  G + CEC  G+EL  D                                           SC+D NEC       S SC N +G+YEC C +GY      +TC D+NECI +   C H  C N   G  C+C   Y    D    C + DECL DN  G    C+ + G+  C C PG      N  C + N+   +   C  +  C   DG   C C    +  +N + +C++ + C S    C H +C+   G   CLC     L++     C   N+C ++NG CS +C    GS  C C  G+K  E  N  C   DEC         C   C N  GG +C CN G+ V   +P  C D +EC    G GC HAC N +G   C+C  G+  +  N + C     C  NNG CSH C   E G     C CP GF+LK D RTC+ I
Sbjct: 1045 RRDHDCPRECVNLEGTYECV--CPIGYAFSKTE---LACVDVDECGTGQHACSHACTNTPGGYNCTCPIGWRLREDSR-NCFPPSAVHRNCSHA-YERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDECVENN-NGGCSHDCANTQGSFHCVC---PRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDNGCSHECANTEGSFYCICPRGYELIEDGKTCADVDECTRKDVHGCSHRCENLDGGYVCSCPDGWIVGRDNRTCT--MACEAAPHNCSHT--CVNVRGGYECECPAGWELSSDGRTCEEVDFCAGGHGCSHECARVAGGGFQCRCPAGYVLSEDNRSCLDRNECEEGNGGCSHSCVNTDGSYECGCPNGYRLAADRNTCEDVNECIEDNGGCSH-LCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNG-GCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNGGCSHY--CSYEDGRVACSCPTDLVLSENGT-VCVEENGCSSGNGGCSH-DCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDEC---SELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDN-KTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDI 1867          

HSP 4 Score: 311.997 bits (798), Expect = 9.368e-85
Identity = 300/950 (31.58%), Postives = 414/950 (43.58%), Query Frame = 0
Query:  413 VQEKKRCEHICY-LDKGVTPTCECHDGF-FLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL-DEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY---EGDD--CSDINECETQDLICDHNCINTEGSAHCTCKAGFDL--MDETECFDKDECEMDNG-GCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSF-YCECHPGFELMED--SCMDINEC----TNSTLCGSGSCNNLEGTYECKCDSGYIF---HNSTCLDINECI--RNPCGHGECINESPGYSCSCHSG-YVDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGH----------------------------------------TCSCHLGFKPDE-KNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRP-----SNGYYRCNKKKVSGYFVKGTKCK------------------------LKCRKGFMP-----------------TGHITRKCINNG-----TWTGDEDHACEVMNCPPL--------PPLHNGNISP-ETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEW 1227
            +++   C H+C  ++ GV   C C D +  L DDG+ C ++DEC+ D   C H+C  + GT  C C  G         C + N+C  +NG   C   C   DG   C C   P   +  ++   C+ +  C   NGGCSH+C +   + FCLCPD   L D+D   CV  N+C   +  C + C    GS  C+C SG+   EGD+  C D++EC      C H C NTEG   C C  GF +  ++   C D DECE   G GC   C NL G+F C C  G+ L  DN TC   + C     NC  +   +   G   +C C  GF L +D  +C DI+EC     +  L  S  C N EG Y C+C SGYI    +   C+D+NEC+  R+ C H +C+N    Y C+C+ G Y+  D + C D DECL  N  G   +C N  G   C C  GYE       C D++E   +   C    +CVN  GS+ C C  G     NDS  C+D DEC   +  C H+ C N +GG  C C  G  L E    TC D++EC+ +NG CS VCVN +GS+ CRC     +   +   C   +EC +    NG C   CIN+ G  +CEC  G+ +   D R C D NEC  +NGGC H C+N+LGG+                                         C C  GF+ DE ++P +C     C+ +  GC  +C +T      +C C  GF+++    TC  I    +   +      S G YRC      G+ ++G  C                           CR G++P                  G     C+N       T  GD   A +   C           PPLH     P  +      P G++C   C  G+++ G     C    +W
Sbjct: 1535 IEDNGGCSHLCANIEGGVE--CACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTVSCFCPPGMILADDNATCAEENKCYADNG--GCSHYCSYEDGRVACSC---PTDLVLSENGTVCVEENGCSSGNGGCSHDCRYEGGETFCLCPDDMILADDDKLRCVYANKCFVDNGGCSDICSFSNGSVACECPSGFKLSEGDNATCVDVDECSELLDNCTHRCTNTEGGFECGCNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECLNDRHNCSH-DCLNLLGSYVCTCYQGHYLHSDKSTCLDIDECLERNG-GCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADC--LHECVNTLGSWTCTCPDGHAL-ANDSKTCVDVDECKVDNGGCSHA-CLNVVGGVRCNCPIGLRLDED-GKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEME---NGECSDNCINVRGSYRCECPAGFRL-KNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQHGCDQLCVNTVGSF--QCSCKQGFEMQN--STCVDIDECATMDCKGYECINSYGSYRCECDI--GHRLEGDHCVDINECAWNNGGCEHDCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQW 2460          

HSP 5 Score: 306.22 bits (783), Expect = 4.881e-83
Identity = 258/738 (34.96%), Postives = 351/738 (47.56%), Query Frame = 0
Query:  432 TCE---CHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM---------------------------------------DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNP---CGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECL-HDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHY-CRCYEGY--KKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105
            TCE   C +G   +D+G C D+DEC++    C HIC N+  TY C C  G+T    G  CV  + C     +  C   C +      C+C   PG +L+  D  TC   + C+  +  CS  C ++     C CP G+ L ED ++CVD++EC   D  C  +C+N+ G+  C C  GY        C D++EC T    C H C NT G  +CTC  G+ L                                        DE  C D DEC      C   C N +G+++C C PG  L  D  TC D +EC +   N G   DC NT GSF+C C  G+EL+ED  +C D++EC  +   G S  C N +G++ C C  GY  I    TC D++EC  N    C H +C N    + C C  GY  +++   C D DEC+ +DN  G   +C N  GSF C C  GYE       C D++E +  KD  G    C N DG + C C  G+I  + D+  C    E     C H+ C N  GG+EC C  G+ LS     TCE+++ CA  +G CS  C  + G  + CRC  GY   +D R +C  ++EC      NGGC   C+N  G  +C C  GY + + D   C D NEC  +NGGC H C N  GG  C+C   +K  E + + CV+   C ++NGGC+H+C      +   C CP G  L  D  TC 
Sbjct:  898 TCEDPSCPEGLRQDDEGGCRDIDECLERNHECSHICVNEHATYRCSCLSGWTLSDDGVTCVLSDPC----ANSSCSHICLSYASTPVCDC--PPGYELA-ADAATCEDVDECRDGSANCSFSCTNTDGSYACDCPQGFILGEDGRSCVDVDECARRDHDCPRECVNLEGTYECVCPIGYAFSKTELACVDVDECGTGQHACSHACTNTPGGYNCTCPIGWRLREDSRNCFPPSAVHRNCSHAYERDGEETRCGCPEGFELQDDEATCGDVDECAEHPPPCPYRCVNTKGSYRCECPPGLRLRQDRTTCQDIDEC-VENNNGGCSHDCANTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSHDCTNTQGSFHCVCPRGYELIEDGKTCADVDECAVNDNGGCSH-DCTNTQGSFHCVCPRGYELIEDGKTCADVDECIVNDN--GCSHECANTEGSFYCICPRGYELIEDGKTCADVDECT-RKDVHGCSHRCENLDGGYVCSCPDGWIVGR-DNRTCTMACEAAPHNCSHT-CVNVRGGYECECPAGWELSSD-GRTCEEVDFCAGGHG-CSHECARVAGGGFQCRCPAGYVLSEDNR-SCLDRNEC---EEGNGGCSHSCVNTDGSYECGCPNGYRL-AADRNTCEDVNECIEDNGGCSHLCANIEGGVECACPDNYKLLEDDGKTCVEIDECLIDNGGCTHLCHYENGTV--SCFCPPGMILADDNATCA 1612          

HSP 6 Score: 284.648 bits (727), Expect = 2.694e-76
Identity = 244/707 (34.51%), Postives = 330/707 (46.68%), Query Frame = 0
Query:  365 CDEGYAFDPSKP----DTLFCSERRWIGKRPLCV-----------AKSTLEIADPSRPSCDPDVQEKKRCEHICYL--DKGVTPTCECHDGFFLNDDGE-CEDVDECVD---DPEL-CDHICTNKPGTYMCDCRLGFT---SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGC-KPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN-STCLDINECIRNPCG-HGECINESPGYSCSCHSGYVDVDN----VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEG--YKKDERGNCFLKDECRLSRRPNG------GCQQLCINIPGGLKC--ECNPGYIVDSQDPRLCV 1020
            C+EG+   P +P    D   C + R  G    C                LE  + +    D   +    C H C+   + G    C C  GF L  D   CED+DEC +   D +L C HIC N  G Y C+C  G+         C+D+NECL  N    C  +C N+ G Y C C    G  L   D  TC+  + C   NGGCSH+C ++    FC CP GYEL +D KTC+D++EC T    CL++C+N  GS  C C  G+    +   C D++EC+  +  C H C+N  G   C C  G  L  D   C D DEC  DNGGC  VC N  G++ C C   G HL+TD  TC D NEC +    C    +CIN  GS+ CEC  GF L  D  +C D+NEC +     S  C N  G Y C C  G+   N S C  ++ C  +  G    C   +   +C C  G+   +N     CRD DEC      G    C N  GSF C C  G+E +N  C DI+E +     C  + +C+N+ GS+ C C  G    + + + C+D +EC   +  C H +C NT+G + C C  G+       N C+DINEC  +NG C+  CVN  GS+YC C        DER     +  CR    P        G     ++ P G +C  +C  G+ ++    R C+
Sbjct: 1764 CNEGFKVSPVEPAFCDDVDECEDARGAGCSHACANLVGSFHCTCPTGYVLENDNKTCRLVDGCKRNNGNCSHHCHHVEEGGEVVHCSCPLGFRLKQDQRTCEDIDECEEFENDVDLGCSHICVNTEGGYYCECPSGYILLPENKKNCIDMNECL--NDRHNCSHDCLNLLGSYVCTC--YQGHYLH-SDKSTCLDIDECLERNGGCSHQCTNTIGGHFCSCPTGYELSQDEKTCIDVDECKTDLADCLHECVNTLGSWTCTCPDGHALANDSKTCVDVDECKVDNGGCSHACLNVVGGVRCNCPIGLRLDEDGKTCNDVDECSTDNGGCSDVCVNFVGSYSCRCVNAGLHLHTDAKTCLDVNECEMENGECS--DNCINVRGSYRCECPAGFRLKNDQRTCDDVNECDHDNGGCSHECVNELGGYRCVCPPGHELRNKSKCHPVDPCANDNGGCEQTCTARNGTVACGCKEGFRLDENEDPPRCRDIDECAGSQH-GCDQLCVNTVGSFQCSCKQGFEMQNSTCVDIDECATMD--CKGY-ECINSYGSYRCECDIGH---RLEGDHCVDINECAWNNGGCEH-DCINTVGSYVCACRPGYIPRRRNRNQCQDINECLNHNGGCNGGCVNTAGSYYCTCNGDLVLASDERTCISAESRCRAMEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCM 2455          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: gb|EFA01239.2| (Fibrillin-1-like Protein [Tribolium castaneum])

HSP 1 Score: 377.481 bits (968), Expect = 8.747e-106
Identity = 339/1098 (30.87%), Postives = 470/1098 (42.81%), Query Frame = 0
Query:  419 CEHICY-LDKGVTPTCECHDGFFL-NDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHT-CISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSC-NNLEGTYECKCDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDN-----------------------------------PCGV--GG---KCNNKPGSFDCDCAPGYEFK---------------NGXC-HDINEX------------SLEKDPCGPHGDCVNNDGS-----------FECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIG-GICSSAPRPSNGYYRC---NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQIT-GVKKTRCTRLSEWKRIR-VNPPK--CNPTFNRPQIHCPP--DMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPK-----ESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLK-RLDSQSSE 1413
            C  IC   D G    C+CH+ + L +D+  C  +D C ++   C HICTN     +C C  G+  +  +CV IN C +NNG   C   C++++    C C      +  D  N T C+    C  +NGGCSH C    NQ+ C CP+GYELD+  KTC+ IN C   +  C + C  V     C+C  GYE     C  IN C   +  C H C   +   +C C  G DL+++T C +++ C  DNGGC   C     T  C C P  H   +  +C  +N C      C  +  C        C C   F L    C   + C       S  C +N  G  EC C  GY   + TC+  + C  N   C H EC+++    +C C   YV ++      D CL +N                                   PC V  GG    C N  G+  CDC   Y                  NG C H+  E             SLE   C P   C  N+G              C+C +G+  D  D   CI  + C  +PC H  C+   G   C C   +   E++  TC  IN C +NNG+CS  CV+  G   C C  G K  ++ +C +++ C +    NGGC   C N  G  +C C PGYI+   + R+C + NEC I  GGC H C N  G   C+C  GF+    N   CV    C  +NGGC   C + + G  H+C C  G+ L+ D R C+ I    C     P  G  +C   N +K S   V GTKC + C +G    G   R C + G+W G E   C    CP   P+ NG + P  C    +  G KC   C  GY++    +   C+    W+ +  VN     C        I CP    +   LP+  + +Y  IP+P TN NW R V ++P W + L   +  G   +TF    P +P         +C+++I + D+  P V  CP +    L  G   + + W EP F DN+ I  +  S  PG  F  G H + Y ASD  GN   C FT+ +K  +DS S++
Sbjct:  716 CSQICENFDGGFV--CKCHNYYKLSHDNYTCVPLDPCQENNGGCSHICTNDNNEAVCKCPEGYELEDKSCVKINPCTINNGG--CSHFCQHINDQINCHC-----PERYDLVNDTLCVEQNPCLDHNGGCSHICTTVNNQVKCECPEGYELDD--KTCLKINPCTIHNGGCSHLCTIVNNQVACECPEGYELEAKTCLKINPCTINNGGCSHFCEFVDDQINCLCPEGHDLVNDTLCVERNPCLEDNGGCSHFCAFFNHTIICSC-PHTHELHNETSCYLKNPCLDQNGGCSHF--CHFENDQLSCSCPDNFYLEGRICYRKDPCLVKNGGCSHQCFSNDLGEVECSCPEGYDLRDKTCIIPDPCDNNNGNCSH-ECVSDGIKATCHCPEDYVRINETHCVPDLCLVENGGCSHKCDFDGDQVTCGCPHAYDLGPEGRICAPRDPCTVQNGGCSHLCQNFGGTVKCDCPEFYNLSDDGHTCVRVSLCSIDNGGCSHECTEEGNYVYCLCPEGYSLEDKTCIPIDPCRKNNGGCSHECTSEANIVYCLCPEGYELDGKD---CI-LNPCHDNPCSHF-CEVVDGLAVCKCPQNY---ELVGKTCTRINPCQINNGNCSHTCVSNDGIATCTCPPGLKLQDKTHCVVENPCLID---NGGCSHQCHNQDGTARCTCPPGYILRPNN-RVCKEVNECKIRRGGCSHGCRNLPGSFQCTCPPGFELGFDN-RTCVDVNECLEDNGGCHMTCINYKGG--HKCGCEQGYALQEDGRHCEAITFRDCRVPVAPDQGIIKCIGGNYEKGSLAPV-GTKCMVWCNEGHKLVGESVRVCQSTGSWGGKEPQ-CVAAACPRPGPIQNGWLLPSNCNNGFTYGGEKCRIYCKRGYKLRPRFEFLSCSEDLIWQPLEAVNRLHDVCVRDIEHTYIKCPGGGHLTYTLPQGQRHMYAKIPQPETNANWIRDVKAEPSWGMQLGTILPAGHTQLTFYV-DPEDPSLLLHSNLTSCKLVITILDIEDPKVTGCPTNMEYTLPRGHSSQLVFWKEPQFSDNVGIARLYKSREPGTSFGVGLHHVNYVASDEAGNRAFCHFTVDIKEEIDSPSND 1780          

HSP 2 Score: 250.366 bits (638), Expect = 7.199e-66
Identity = 218/688 (31.69%), Postives = 313/688 (45.49%), Query Frame = 0
Query:  435 CHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF---TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYVDV-DNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACI-NKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKP 1106
            C +G+ +ND G+C D+DEC+     C H C N  G Y C C  G+         C D+NEC+ N    PC  +C N  G + CEC           + +  +++ +C      C  + +  +    C+CP GY    +  TC D+NEC  GD  C + C+N  GS  C C  G+    +   CSD++EC     +C   C NTEGS  C C  G++L  D   C D DECE ++  CEQ+C+N +G ++CGC+ GF L+ D  +C D NEC     NC     C N  G F C+CH  ++L  D  +C+ ++ C  +    S  C N      CKC  GY   + +C+ IN C  N   C H  C + +   +C C   Y  V D +C + + CL  N  G    C        C+C  GYE  +  C  IN  ++    C      VNN     C C +G+   + ++  C+  + C   +  C H  C+       CLC  G  L  +    C + N C  +NG CS  C     +  C C   ++     +C+LK+ C      NGGC   C      L C C   + ++    R+C  K+ C + NGGC H C  N LG   CSC  G+   +K    C+    C  NNG CSH C S   G+   C CP  + ++ +   C P
Sbjct:  459 CIEGYEMNDKGDCVDIDECLSSSPPCSHDCENLEGGYKCLCPPGYELDIPDFNTCQDLNECISN----PCAYKCVNEIGTFHCEC----------PEGYLLLANNSC--TKITCPQDHVVEHGVQRCICPRGYTQSRNKITCDDVNEC-DGDHGCTHLCINHEGSYSCSCYDGFALERDNRTCSDVDECRKG--VCGQKCENTEGSFRCFCDKGYELANDGKTCLDIDECERED-SCEQLCHNFDGGYECGCEKGFKLDEDESSCYDINECESNNGNCSQI--CENFDGGFVCKCHNYYKLSHDNYTCVPLDPCQENNGGCSHICTNDNNEAVCKCPEGYELEDKSCVKINPCTINNGGCSHF-CQHINDQINCHCPERYDLVNDTLCVEQNPCLDHNG-GCSHICTTVNNQVKCECPEGYELDDKTCLKINPCTIHNGGCSHLCTIVNN--QVACECPEGY---ELEAKTCLKINPCTINNGGCSHF-CEFVDDQINCLCPEGHDL--VNDTLCVERNPCLEDNGGCSHFCAFFNHTIICSCPHTHELHNETSCYLKNPC---LDQNGGCSHFCHFENDQLSCSCPDNFYLEG---RICYRKDPCLVKNGGCSHQCFSNDLGEVECSCPEGYDLRDKT---CIIPDPCDNNNGNCSHECVS--DGIKATCHCPEDY-VRINETHCVP 1102          

HSP 3 Score: 212.616 bits (540), Expect = 2.517e-54
Identity = 179/482 (37.14%), Postives = 249/482 (51.66%), Query Frame = 0
Query:  635 HCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNL-TCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECIRNPCGHGECINESPGYSCSCHSGY-VDVDN-VCRDYDECLHDNPCGV-GGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            H  C  G+++ D+ +C D DEC   +  C   C NLEG ++C C PG+ L+  +  TC D NEC   I+N   Y  C+N  G+F+CEC  G+ L+ +     N CT  T        +  G   C C  GY    +  TC D+NEC  +      CIN    YSCSC+ G+ ++ DN  C D DEC      GV G KC N  GSF C C  GYE  N    C DI+E   E D C     C N DG +EC C +GF  D+++S+ C D +EC S+    S+ C+N  GGF C C   + LS     TC  ++ C  NNG CS +C N      C+C EGY+ +++ +C   + C ++   NGGC   C +I   + C C   Y  D  +  LCV++N C  +NGGC H C        C C  G++ D+K    C+K   C+++NGGCSH+C    + +   C CP G++L  +A+TC  I
Sbjct:  456 HDRCIEGYEMNDKGDCVDIDECLSSSPPCSHDCENLEGGYKCLCPPGYELDIPDFNTCQDLNEC---ISNPCAY-KCVNEIGTFHCECPEGYLLLAN-----NSCTKITCPQDHVVEH--GVQRCICPRGYTQSRNKITCDDVNECDGDHGCTHLCINHEGSYSCSCYDGFALERDNRTCSDVDECRK----GVCGQKCENTEGSFRCFCDKGYELANDGKTCLDIDECERE-DSC--EQLCHNFDGGYECGCEKGFKLDEDESS-CYDINECESNNGNCSQICENFDGGFVCKCHNYYKLSHD-NYTCVPLDPCQENNGGCSHICTNDNNEAVCKCPEGYELEDK-SCVKINPCTIN---NGGCSHFCQHINDQINCHCPERY--DLVNDTLCVEQNPCLDHNGGCSHICTTVNNQVKCECPEGYELDDKT---CLKINPCTIHNGGCSHLCTIVNNQV--ACECPEGYEL--EAKTCLKI 904          

HSP 4 Score: 199.904 bits (507), Expect = 1.906e-50
Identity = 145/368 (39.40%), Postives = 186/368 (50.54%), Query Frame = 0
Query:  409 CDPDV--QEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCR--LGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFH 767
            C PD+   E   C H C  D G   TC C   + L  +G  C   D C      C H+C N  GT  CDC      +  G  CV ++ C ++NG   C  EC        C C    G  L DK   TCI  + C+ NNGGCSHEC    N ++CLCP+GYELD   K C+ +N C   D  C + C  V G A CKC   YE  G  C+ IN C+  +  C H C++ +G A CTC  G  L D+T C  ++ C +DNGGC   C+N +GT +C C PG+ L  +N  C + NEC I    C     C N PGSF C C PGFEL  D  +C+D+NEC         +C N +G ++C C+ GY   
Sbjct: 1100 CVPDLCLVENGGCSHKCDFD-GDQVTCGCPHAYDLGPEGRICAPRDPCTVQNGGCSHLCQNFGGTVKCDCPEFYNLSDDGHTCVRVSLCSIDNGG--CSHECTEEGNYVYCLCP--EGYSLEDK---TCIPIDPCRKNNGGCSHECTSEANIVYCLCPEGYELD--GKDCI-LNPC--HDNPCSHFCEVVDGLAVCKCPQNYELVGKTCTRINPCQINNGNCSHTCVSNDGIATCTCPPGLKLQDKTHCVVENPCLIDNGGCSHQCHNQDGTARCTCPPGYILRPNNRVCKEVNECKIRRGGCS--HGCRNLPGSFQCTCPPGFELGFDNRTCVDVNECLEDNGGCHMTCINYKGGHKCGCEQGYALQ 1452          

HSP 5 Score: 179.874 bits (455), Expect = 2.778e-44
Identity = 161/471 (34.18%), Postives = 219/471 (46.50%), Query Frame = 0
Query:  692 TDENECTI--------------GIANCGIYGDCINTPGSFYCECHPGFELMEDS-CMDINECTNSTLCGSGSCNNLEGTYECKCDSGY---IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN----------------------------------VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            T++NE  +                     +GD        +  C  G+E+ +   C+DI+EC +S+   S  C NLEG Y+C C  GY   I   +TC D+NECI NPC + +C+NE   + C C  GY+ + N                                   C D +EC  D+  G    C N  GS+ C C  G+  E  N  C D++E    K  CG    C N +GSF C C +G+    ND   C+D DEC         C N  GG+EC CE GF L E   ++C DINEC  NNG+CSQ+C N  G   C+C+  YK   +   C   D C+ +   NGGC  +C N      C+C  GY ++ +    CV  N CTINNGGC H C  +      +CH   + D  N   CV+   C  +NGGCSHIC +  + +  +C CP G++L  D +TC  I
Sbjct:  424 TEDNERAVDEDDEDYDEDEDEDYDDEDDDFGD--------HDRCIEGYEMNDKGDCVDIDECLSSSPPCSHDCENLEGGYKCLCPPGYELDIPDFNTCQDLNECISNPCAY-KCVNEIGTFHCECPEGYLLLANNSCTKITCPQDHVVEHGVQRCICPRGYTQSRNKITCDDVNECDGDH--GCTHLCINHEGSYSCSCYDGFALERDNRTCSDVDE--CRKGVCGQ--KCENTEGSFRCFCDKGY-ELANDGKTCLDIDECEREDSCEQLCHNFDGGYECGCEKGFKLDED-ESSCYDINECESNNGNCSQICENFDGGFVCKCHNYYKLSHDNYTCVPLDPCQEN---NGGCSHICTNDNNEAVCKCPEGYELEDKS---CVKINPCTINNGGCSHFC--QHINDQINCHCPERYDLVNDTLCVEQNPCLDHNGGCSHICTTVNNQV--KCECPEGYEL--DDKTCLKI 865          

HSP 6 Score: 137.502 bits (345), Expect = 2.580e-31
Identity = 83/195 (42.56%), Postives = 111/195 (56.92%), Query Frame = 0
Query:  409 CDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ--CLNKCMNVPGSAYC 599
            C P++  K +C   C + K   PTC C  G+      +C D++EC +    C+  C N PG+Y C C  GF     G  C DINECLL NGHGPCQD C+N  G Y+C C    GT+L+  + H+C   + C   N GCSH CI+++ +++C CP G EL  DWKTC D+NEC    I+  C   C+N  GS +C
Sbjct:   53 CPPNI--KTKCPQDCII-KNNKPTCRCFPGYTFKHK-KCIDINECKNGKHKCEKKCINLPGSYKCACPQGFRLLPDGKTCEDINECLLRNGHGPCQDLCENTHGSYKCICRN--GTKLA-PNGHSCTDLDECSEKNSGCSHGCINTHGRVYCTCPIGLELGPDWKTCKDVNECDDEKIKGSCPYGCVNTVGSYFC 240          

HSP 7 Score: 80.4925 bits (197), Expect = 5.048e-14
Identity = 68/183 (37.16%), Postives = 88/183 (48.09%), Query Frame = 0
Query:  828 NNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCETGFALSEILPN--TCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            NNKP    C C PGY FK+  C DINE    K  C     C+N  GS++C C QGF     D   C D +ECL      PC    C+NT G ++C+C  G  L+   PN  +C D++EC+  N  CS  C+N  G  YC C  G +   +   C   +EC    +  G C   C+N  G   C
Sbjct:   69 NNKP---TCRCFPGYTFKHKKCIDINECKNGKHKC--EKKCINLPGSYKCACPQGF-RLLPDGKTCEDINECLLRNGHGPC-QDLCENTHGSYKCICRNGTKLA---PNGHSCTDLDECSEKNSGCSHGCINTHGRVYCTCPIGLELGPDWKTCKDVNECD-DEKIKGSCPYGCVNTVGSYFC 240          

HSP 8 Score: 78.5666 bits (192), Expect = 1.896e-13
Identity = 58/163 (35.58%), Postives = 78/163 (47.85%), Query Frame = 0
Query:  947 CSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            C Q C+       CRC+ GY    +  C   +EC+  +     C++ CIN+PG  KC C  G+ +   D + C D NEC + NG   CQ  C N  G + C C  G K    N   C     CS  N GCSH C +T   ++  C CP G +L  D +TCK +
Sbjct:   61 CPQDCIIKNNKPTCRCFPGYTFKHK-KCIDINECKNGKHK---CEKKCINLPGSYKCACPQGFRL-LPDGKTCEDINECLLRNGHGPCQDLCENTHGSYKCICRNGTKL-APNGHSCTDLDECSEKNSGCSHGCINTHGRVY--CTCPIGLELGPDWKTCKDV 215          

HSP 9 Score: 78.1814 bits (191), Expect = 2.400e-13
Identity = 62/183 (33.88%), Postives = 85/183 (46.45%), Query Frame = 0
Query:  623 CDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINEC----IRNPCGHGECINESPGYSCS 797
            C  +CI       C C  G+    + +C D +EC+     CE+ C NL G+++C C  GF L  D  TC D NEC +   +      C NT GS+ C C  G +L  +  SC D++EC+      S  C N  G   C C  G        TC D+NEC    I+  C +G C+N    Y C+
Sbjct:   61 CPQDCIIKNNKPTCRCFPGYTFKHK-KCIDINECKNGKHKCEKKCINLPGSYKCACPQGFRLLPDGKTCEDINECLLRNGHGPCQDLCENTHGSYKCICRNGTKLAPNGHSCTDLDECSEKNSGCSHGCINTHGRVYCTCPIGLELGPDWKTCKDVNECDDEKIKGSCPYG-CVNTVGSYFCA 241          

HSP 10 Score: 77.0258 bits (188), Expect = 6.379e-13
Identity = 68/195 (34.87%), Postives = 90/195 (46.15%), Query Frame = 0
Query:  867 DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPC-FHSECKNTLGGFECLCETGFALSEILPN--TCEDINECALNNGD--CSQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINN--GGCQHACINKLGGHTCSCHLGFKP 1053
            DC+  +    C C  G+         CID +EC +       +C N  G ++C C  GF L   LP+  TCEDINEC L NG   C  +C N  GS+ C C  G K    G+ C   DEC      N GC   CIN  G + C C  G  +   D + C D NEC      G C + C+N +G + C+  +  +P
Sbjct:   64 DCIIKNNKPTCRCFPGYTFKHKK---CIDINECKNGKHKCEKKCINLPGSYKCACPQGFRL---LPDGKTCEDINECLLRNGHGPCQDLCENTHGSYKCICRNGTKLAPNGHSCTDLDECS---EKNSGCSHGCINTHGRVYCTCPIGLEL-GPDWKTCKDVNECDDEKIKGSCPYGCVNTVGSYFCAKAMADQP 248          

HSP 11 Score: 70.4774 bits (171), Expect = 6.458e-11
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 0
Query:  918 CLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFK--PDEK 1056
            C C  G+         C DINEC      C + C+N+ GS+ C C +G++    G  C   +EC L R  +G CQ LC N  G  KC C  G  + + +   C D +EC+  N GC H CIN  G   C+C +G +  PD K
Sbjct:   74 CRCFPGYTFKH---KKCIDINECKNGKHKCEKKCINLPGSYKCACPQGFRLLPDGKTCEDINECLL-RNGHGPCQDLCENTHGSYKCICRNGTKL-APNGHSCTDLDECSEKNSGCSHGCINTHGRVYCTCPIGLELGPDWK 210          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: EEB16551.1 (Fibrillin-3 precursor, putative [Pediculus humanus corporis])

HSP 1 Score: 333.183 bits (853), Expect = 1.041e-92
Identity = 277/753 (36.79%), Postives = 370/753 (49.14%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPEL---CDHICTNKPGTYMCDCRLGFTSQ--GTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY---EGDDCSDINECETQDL-ICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME-DSCMDINECTNSTLCGSGS---CNNLEGTYECKCDSGYIFH--NSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYVDVD-NVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECA---------------LNNGD----CSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI------GGICSSAPRPSNGYYRC 1124
            C H C   +G +  C C DG+ LNDD   CED DEC DD E+   C  IC N+ G+Y C+CR G+  Q   T C+DI+EC LN     C   C N  GG++C C    G +L +  +  C+  + C  +   CSH+CI+      C CP G  +  D  TC D+NEC   +  C   C N  GS  C+C +G+      DC DI+EC  + L  C   C NT GS  C C  G+ ++   +C D DEC  +NG C  +C N +G +QC C  GF L+ +N TC D NEC     NC     CIN  G   C+C PG+ L     C+DINEC ++     G    C NL G+Y C C  GY     N TC DINEC      C H ECIN   GY C C   ++  + NVC + D C   N       CN   G   C C   ++ +     C   N+ S  +  C      +N +    C C +G++  + D   C D +EC  +PC H  CKNT G FEC C  GF +S+I  N C DI+EC                 N  D    CSQ+C+N++G  YC C +GY   D+   C   +EC    + NGGC  +C+N+ GG +C C+ G+I+ S D + C+D +EC++NNG C H C N  G   C C   +   E +   C   + CS+NNG CSH C S     H  C CP G+ ++ D  TC  +       G CS     + G Y C
Sbjct:  114 CSHDCINRQG-SYECSCPDGYDLNDDEITCEDYDECADDMEVEHNCTQICINEIGSYRCECRNGYELQEDKTTCIDIDECELN----VCSHNCNNTIGGFKCYC--PEGMELLNITH--CVDIDECLNHLNNCSHDCINLSGTYECRCPSGMVMTNDTITCEDVNECDYNNGNCTQLCKNEVGSYKCECLNGFILKNNTDCEDIDECSDRTLNHCSFGCRNTPGSYVCYCPVGY-ILGMEDCEDIDECLDNNGNCSHLCINHQGGYQCSCSKGFKLSQNNKTCEDVNECLSNNGNCS--HTCINKDGHHECDCEPGYRLQNLYECIDINECEDNNNIDGGCSDVCLNLPGSYICDCFDGYRLSADNKTCEDINECAIDNGNCTH-ECINLDGGYECKCPLNFIHGEGNVCIEKDPCKEKN---CDQLCNVTDGKAICSCYENFDLQPDGKICKKRNDCSACQQNCV-----INAEDGATCSCKKGYVL-KKDGVSCEDVNECADNPCSHI-CKNTEGSFECDCPEGFKMSDINANQCIDIDECKEWEYEADYYDNTIDDTNYSDFGQLCSQICINVVGGFYCNCRDGYTLSDDDRTCVDDNEC---LKNNGGCSDVCVNLIGGYECLCHKGFILGS-DNKTCLDVDECSLNNGNCSHKCENVKGSFKCHCRDDYLL-EDDGRTC--RRDCSLNNGFCSHTCVSVNGKPH--CECPEGYTIRNDNVTCDDVDECALNNGGCSHTCENTEGSYEC 834          

HSP 2 Score: 327.791 bits (839), Expect = 5.607e-91
Identity = 287/871 (32.95%), Postives = 415/871 (47.65%), Query Frame = 0
Query:  410 DPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICT-NKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ-----------------VNNGG--CSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY----EGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGT-YECKCDSGYIFHNS----------------TCLDINECIRN--PCGHGECINESPGYSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS-PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN-GDCSQVCVNILGSHYCRCYEGYKK-DERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNK-KKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKR 1229
            + D  ++K C+ +C +  G    C C++ F L  DG+ C+  ++C      C   C  N      C C+ G+     G +C D+NEC  N    PC   CKN +G ++C+C    G ++SD + + CI  + C+                  ++ G  CS  CI+     +C C DGY L +D +TCVD NEC+  +  C + C+N+ G   C C  G+    +   C D++EC   +  C H C N +GS  C C+  + L D+     +D C ++NG C   C ++ G   C C  G+ +  DN+TC D +EC +   N G    C NT GS+ C C  G +L+E  C+ +N+C       S +C+    T   C+C +G+   +                  C D NEC  N   C H  CIN +  ++C C  G+ ++ +  C D DEC   N       C N+ GS+ CDC   +E+    C  + +   EK+  G    C N DG  EC C  GF   + +   C D +ECL    CFH  CKNT+G +EC C+ GF   E     CEDI+EC LN  GD  + C+N +GS++C C  GY+  DE   C   DEC + +     C   CIN  G  KC C  GY    +    C+D NEC INNGGC + C+N  G + C C  GF   E   + CV    C ++NGGC HIC +T    +  C C   + L+ D ++CK  G  C     P  G  +C + + ++  F  G++C +KC KG+   G   R C  +G WTG     C  + CP L P  NG+  P +C T  SP    C+  C+ GY + G     C    +W R
Sbjct:  512 EKDPCKEKNCDQLCNVTDG-KAICSCYENFDLQPDGKICKKRNDC----SACQQNCVINAEDGATCSCKKGYVLKKDGVSCEDVNECADN----PCSHICKNTEGSFECDC--PEGFKMSDINANQCIDIDECKEWEYEADYYDNTIDDTNYSDFGQLCSQICINVVGGFYCNCRDGYTLSDDDRTCVDDNECLKNNGGCSDVCVNLIGGYECLCHKGFILGSDNKTCLDVDECSLNNGNCSHKCENVKGSFKCHCRDDYLLEDDGRTCRRD-CSLNNGFCSHTCVSVNGKPHCECPEGYTIRNDNVTCDDVDECALN--NGGCSHTCENTEGSYECVCPDGHDLVERDCVLVNKCDRENGGCSHTCSMHNSTIVVCECPNGFEMESDFKTCVCPIGYSQIDKFECRDDNECEINNGGCSH-TCINLNGSFACECPPGFKLEKEKFCIDVDECARSNG-NCSQVCINEIGSYRCDCYEDFEYVENNC--VRKNPCEKNNGGCDQVCDNFDGVAECSCRSGF---RKNETKCEDVNECLEDHGCFHY-CKNTIGSYECDCKPGFKQIE---KHCEDIDECKLNICGD--KKCINTVGSYHCICPPGYELLDEE--CTDVDECAIMKP----CSGECINTIGSYKCMCKTGYF---ETNGKCIDINECEINNGGCSYNCLNTAGSYRCLCPHGF---EIKNQTCVDIDECKLDNGGCEHICTNTNGSFY--CSCKMHYNLQEDKQSCKIHGKFCDKLKPPLFGEVKCPRVQNLAAEFPPGSECYIKCYKGYKFDGDTLRVCNADGQWTG-RSGECIPLPCPKLKPPENGHFIPSSCSTGKSPPSHHCILACHKGYHVQGRAVLTCLNSQQWNR 1340          

HSP 3 Score: 295.819 bits (756), Expect = 1.121e-80
Identity = 275/806 (34.12%), Postives = 374/806 (46.40%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDP--ELCDHICTNKPGTYMC--------------------DCRLGF-TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECG---GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD---CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDET-ECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYVDVDNV--CRDYDECLHDNPC--GVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH--------------------------------SECK-----NTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDE--RGNCFLKDECRL--------------SRRPNGG--CQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI----GGICSSAPRPSNGYYRC 1124
            C H C    G    C C  G  L +D + C+D+DEC D+     C+  C N  G+Y C                     C  G+ T     C+DI+EC  N  +  C  +C N  G Y+C C     L   +++ +D   C  D   + N   C+  CI+      C C +GYEL ED  TC+DI+EC      C + C N  G   C C  G E  +   C DI+EC      C H+CIN  G+  C C +G  + ++T  C D +EC+ +NG C Q+C N  G+++C C  GF L  +N  C D +EC+    N   +G C NTPGS+ C C  G+ L  + C DI+EC ++    S  C N +G Y+C C  G+    +N TC D+NEC+ N   C H  CIN+   + C C  GY  + N+  C D +EC  +N    G    C N PGS+ CDC  GY     N  C DINE +++   C    +C+N DG +EC C   FIH +   N+CI+ D C    C                                  S C+     N   G  C C+ G+ L +    +CED+NECA N   CS +C N  GS  C C EG+K  +     C   DEC+               +   + G  C Q+CIN+ GG  C C  GY + S D R CVD NEC  NNGGC   C+N +GG+ C CH GF     N + C+    CS+NNG CSH C++ +     +C C   + L+ D RTC+       G CS      NG   C
Sbjct:   11 CSHSCINALG-RAFCLCPAGLELGEDWKTCQDIDECDDEAIENTCEFGCVNTIGSYYCAKEETENDIKLIPEDLKTPVTCSPGYQTDLEGRCIDIDECKENTHN--CSHDCINRQGSYECSCPDGYDLNDDEITCEDYDECADDMEVEHN---CTQICINEIGSYRCECRNGYELQEDKTTCIDIDECELN--VCSHNCNNTIGGFKCYCPEGMELLNITHCVDIDECLNHLNNCSHDCINLSGTYECRCPSGMVMTNDTITCEDVNECDYNNGNCTQLCKNEVGSYKCECLNGFIL-KNNTDCEDIDECSDRTLNHCSFG-CRNTPGSYVCYCPVGYILGMEDCEDIDECLDNNGNCSHLCINHQGGYQCSCSKGFKLSQNNKTCEDVNECLSNNGNCSH-TCINKDGHHECDCEPGYR-LQNLYECIDINECEDNNNIDGGCSDVCLNLPGSYICDCFDGYRLSADNKTCEDINECAIDNGNCTH--ECINLDGGYECKCPLNFIHGE--GNVCIEKDPCKEKNCDQLCNVTDGKAICSCYENFDLQPDGKICKKRNDCSACQQNCVINAEDGATCSCKKGYVLKKDGV-SCEDVNECADN--PCSHICKNTEGSFECDCPEGFKMSDINANQCIDIDECKEWEYEADYYDNTIDDTNYSDFGQLCSQICINVVGGFYCNCRDGYTL-SDDDRTCVDDNECLKNNGGCSDVCVNLIGGYECLCHKGFILGSDN-KTCLDVDECSLNNGNCSHKCENVKGSF--KCHCRDDYLLEDDGRTCRRDCSLNNGFCSHTCVSVNGKPHC 793          

HSP 4 Score: 276.944 bits (707), Expect = 1.137e-74
Identity = 241/654 (36.85%), Postives = 318/654 (48.62%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ--CLNKCMNVPGSAYCK--------------------CDSGYEGD---DCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMD---NGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS-CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECIRNPCGHGECI----NESPGYSCSCHSGYVDVDNV-CRDYDECLHD--NPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSS--PCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN---GDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCEC------NPGYIVDSQDP-------------------------------RLCVDKNECTINNGGCQHAC-INKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLK-TDARTCKPI 1107
            C+  + GCSH CI++  + FCLCP G EL EDWKTC DI+EC    I+  C   C+N  GS YC                     C  GY+ D    C DI+EC+     C H+CIN +GS  C+C  G+DL  DE  C D DEC  D      C Q+C N  G+++C C+ G+ L  D  TC D +EC + + +     +C NT G F C C  G EL+  + C+DI+EC N     S  C NL GTYEC+C SG +  N   TC D+NEC  N   +G C     NE   Y C C +G++  +N  C D DEC     N C  G  C N PGS+ C C  GY      C DI+E       C     C+N+ G ++C C +GF   QN+   C D +ECLS+   C H+ C N  G  EC CE G+ L  +    C DINEC  NN   G CS VC+N+ GS+ C C++GY+   +   C   +EC +    NG C   CIN+ GG +C+C        G +   +DP                               ++C  +N+C+     CQ  C IN   G TCSC  G+   +K+   C     C+ N   CSHICK+TE      C CP GFK+   +A  C  I
Sbjct:    4 CKSGSAGCSHSCINALGRAFCLCPAGLELGEDWKTCQDIDECDDEAIENTCEFGCVNTIGSYYCAKEETENDIKLIPEDLKTPVTCSPGYQTDLEGRCIDIDECKENTHNCSHDCINRQGSYECSCPDGYDLNDDEITCEDYDECADDMEVEHNCTQICINEIGSYRCECRNGYELQEDKTTCIDIDECELNVCS----HNCNNTIGGFKCYCPEGMELLNITHCVDIDECLNHLNNCSHDCINLSGTYECRCPSGMVMTNDTITCEDVNECDYN---NGNCTQLCKNEVGSYKCECLNGFILKNNTDCEDIDECSDRTLNHCSFG--CRNTPGSYVCYCPVGYILGMEDCEDIDECLDNNGNCSHL--CINHQGGYQCSCSKGFKLSQNNK-TCEDVNECLSNNGNCSHT-CINKDGHHECDCEPGYRLQNLYE--CIDINECEDNNNIDGGCSDVCLNLPGSYICDCFDGYRLSADNKTCEDINECAID---NGNCTHECINLDGGYECKCPLNFIHGEGNVCIEKDPCKEKNCDQLCNVTDGKAICSCYENFDLQPDGKICKKRNDCS----ACQQNCVINAEDGATCSCKKGYVL-KKDGVSCEDVNECADN--PCSHICKNTEGSF--ECDCPEGFKMSDINANQCIDI 630          

HSP 5 Score: 267.7 bits (683), Expect = 9.198e-72
Identity = 214/569 (37.61%), Postives = 290/569 (50.97%), Query Frame = 0
Query:  576 INECVTGDIQCLNKCMNVPGSAYCKCDSGYE-GDD---CSDINECETQDL--ICDHNCINTEGSAHC--------------------TCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIA---NCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST-CLDINECIR--NPCGHGECINESPGYSCSCHSGYVDVDNV--CRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105
            ++ C +G   C + C+N  G A+C C +G E G+D   C DI+EC+ + +   C+  C+NT GS +C                    TC  G+    E  C D DEC+ +   C   C N +G+++C C  G+ LN D +TC D +EC   +    NC     CIN  GS+ CEC  G+EL ED  +C+DI+EC  +    S +CNN  G ++C C  G    N T C+DI+EC+   N C H +CIN S  Y C C SG V  ++   C D +EC ++N       C N+ GS+ C+C  G+  KN   C DI+E S         G C N  GS+ C C  G+I    D   C D DECL  +  C H  C N  GG++C C  GF LS+    TCED+NEC  NNG+CS  C+N  G H C C  GY+      C   +EC  +   +GGC  +C+N+PG   C+C  GY + S D + C D NEC I+NG C H CIN  GG+ C C L F   E N   C++   C   N  C  +C  T+      C C   F L+ D + CK
Sbjct:    1 MDYCKSGSAGCSHSCINALGRAFCLCPAGLELGEDWKTCQDIDECDDEAIENTCEFGCVNTIGSYYCAKEETENDIKLIPEDLKTPVTCSPGYQTDLEGRCIDIDECKENTHNCSHDCINRQGSYECSCPDGYDLNDDEITCEDYDECADDMEVEHNCTQI--CINEIGSYRCECRNGYELQEDKTTCIDIDECELNVC--SHNCNNTIGGFKCYCPEGMELLNITHCVDIDECLNHLNNCSH-DCINLSGTYECRCPSGMVMTNDTITCEDVNECDYNNG-NCTQLCKNEVGSYKCECLNGFILKNNTDCEDIDECSDRTLNHCSFG-CRNTPGSYVCYCPVGYILGMED---CEDIDECLDNNGNCSHL-CINHQGGYQCSCSKGFKLSQ-NNKTCEDVNECLSNNGNCSHTCINKDGHHECDCEPGYRLQNLYECIDINECEDNNNIDGGCSDVCLNLPGSYICDCFDGYRL-SADNKTCEDINECAIDNGNCTHECINLDGGYECKCPLNFIHGEGNV--CIEKDPCKEKN--CDQLCNVTDGKA--ICSCYENFDLQPDGKICK 550          

HSP 6 Score: 261.922 bits (668), Expect = 7.334e-70
Identity = 259/808 (32.05%), Postives = 346/808 (42.82%), Query Frame = 0
Query:  450 VDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCE--------------------CGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTG---DIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS-CMDINECTNSTL--CGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRN--PCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN-GXCHDINEXSLEKDPCGPHGD-CVNNDGSFECVCHQGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG--------------NCFLKDE------CR--------------LSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNEC------------TINNGG-------CQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI------GGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCI 1158
            +D C      C H C N  G   C C  G         C DI+EC        C+  C N  G Y C                     C     T L  +    CI  + C+ N   CSH+CI+      C CPDGY+L++D  TC D +EC      +  C   C+N  GS  C+C +GYE  +    C DI+ECE    +C HNC NT G   C C  G +L++ T C D DEC      C   C NL GT++C C  G  +  D +TC D NEC     NC     C N  GS+ CEC  GF L  ++ C DI+EC++ TL  C  G C N  G+Y C C  GYI     C DI+EC+ N   C H  CIN   GY CSC  G+    N   C D +ECL +N       C NK G  +CDC PGY  +N   C DINE     +  G   D C+N  GS+ C C  G+     D+  C D +EC   +  C H EC N  GG+EC C   F   E   N C + + C   N  C Q+C    G   C CYE +     G              NC +  E      C+              ++   +  C  +C N  G  +C+C  G+ +   +   C+D +EC            TI++         C   CIN +GG  C+C  G+   + +   CV    C  NNGGCS +C +   G  + C+C  GF L +D +TC  +       G CS       G ++C+ +        G  C+  C    +  G  +  C+
Sbjct:    1 MDYCKSGSAGCSHSCINALGRAFCLCPAGLELGEDWKTCQDIDECDDEAIENTCEFGCVNTIGSYYCAKEETENDIKLIPEDLKTPVTCSPGYQTDLEGR----CIDIDECKENTHNCSHDCINRQGSYECSCPDGYDLNDDEITCEDYDECADDMEVEHNCTQICINEIGSYRCECRNGYELQEDKTTCIDIDECELN--VCSHNCNNTIGGFKCYCPEGMELLNITHCVDIDECLNHLNNCSHDCINLSGTYECRCPSGMVMTNDTITCEDVNECDYNNGNCTQL--CKNEVGSYKCECLNGFILKNNTDCEDIDECSDRTLNHCSFG-CRNTPGSYVCYCPVGYILGMEDCEDIDECLDNNGNCSH-LCINHQGGYQCSCSKGFKLSQNNKTCEDVNECLSNNG-NCSHTCINKDGHHECDCEPGYRLQNLYECIDINECEDNNNIDGGCSDVCLNLPGSYICDCFDGY-RLSADNKTCEDINECAIDNGNCTH-ECINLDGGYECKCPLNFIHGE--GNVCIEKDPCKEKN--CDQLCNVTDGKAICSCYENFDLQPDGKICKKRNDCSACQQNCVINAEDGATCSCKKGYVLKKDGVSCEDVNECADNPCSHICKNTEGSFECDCPEGFKMSDINANQCIDIDECKEWEYEADYYDNTIDDTNYSDFGQLCSQICINVVGGFYCNCRDGYTLSDDD-RTCVDDNECLKNNGGCSDVCVNLIGG--YECLCHKGFILGSDNKTCLDVDECSLNNGNCSHKCENVKGSFKCHCRDDYLLEDDGRTCRRDCS---LNNGFCSHTCV 785          

HSP 7 Score: 261.536 bits (667), Expect = 8.579e-70
Identity = 269/826 (32.57%), Postives = 363/826 (43.95%), Query Frame = 0
Query:  393 CVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPG------TQLSDKD-------NHT-------------------------CISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLI---CDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNS--TCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVD---NVCRDYDEC--------LHDNPCG----------VGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC-LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHAC-INKLGGHTCSCHLGFKPD-------------EKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLK-----TDARTCKPIGGICSSAPRPSNGYYRCN 1125
            C  ++  E+ +      D D  E   C H C    G    C C +G  L +   C D+DEC++    C H C N  GTY C C  G   T+    C D+NEC  NNG+  C   CKN  G Y+CEC  L G      T   D D       NH                          C   + C  NNG CSH CI+      C C  G++L ++ KTC D+NEC++ +  C + C+N  G   C C+ GY      +C DINECE  + I   C   C+N  GS  C C  G+ L  D   C D +EC +DNG C   C NL+G ++C C   F ++ +   C +++ C     NC     C  T G   C C+  F+L  D   C   N+C   + C      N E    C C  GY+      +C D+NEC  NPC H  C N    + C C  G+   D   N C D DEC         +DN                 C N  G F C+C  GY   +     +++    K+  G    CVN  G +EC+CH+GFI   +D+  C+D DEC L++     +C+N  G F+C C   + L E    TC    +C+LNNG CS  CV++ G  +C C EGY  +++   C   DEC L+   NGGC   C N  G  +C C  G+ +  +D   CV  N+C   NGGC H C ++      C C  GF+ +             + +  +C     C +NNGGCSH C +        C CP GFKL+      D   C    G CS       G YRC+
Sbjct:  171 CECRNGYELQEDKTTCIDIDECELNVCSHNCNNTIG-GFKCYCPEGMELLNITHCVDIDECLNHLNNCSHDCINLSGTYECRCPSGMVMTNDTITCEDVNECDYNNGN--CTQLCKNEVGSYKCEC--LNGFILKNNTDCEDIDECSDRTLNHCSFGCRNTPGSYVCYCPVGYILGMEDCEDIDECLDNNGNCSHLCINHQGGYQCSCSKGFKLSQNNKTCEDVNECLSNNGNCSHTCINKDGHHECDCEPGYRLQNLYECIDINECEDNNNIDGGCSDVCLNLPGSYICDCFDGYRLSADNKTCEDINECAIDNGNCTHECINLDGGYECKCPLNF-IHGEGNVCIEKDPCK--EKNCDQL--CNVTDGKAICSCYENFDLQPDGKICKKRNDC---SACQQNCVINAEDGATCSCKKGYVLKKDGVSCEDVNECADNPCSH-ICKNTEGSFECDCPEGFKMSDINANQCIDIDECKEWEYEADYYDNTIDDTNYSDFGQLCSQICINVVGGFYCNCRDGYTLSDDDRTCVDDNECLKNNGGCSDVCVNLIGGYECLCHKGFIL-GSDNKTCLDVDECSLNNGNCSHKCENVKGSFKCHCRDDYLL-EDDGRTCR--RDCSLNNGFCSHTCVSVNGKPHCECPEGYTIRNDNVTCDDVDECALN---NGGCSHTCENTEGSYECVCPDGHDLVERD---CVLVNKCDRENGGCSHTCSMHNSTIVVCECPNGFEMESDFKTCVCPIGYSQIDKFECRDDNECEINNGGCSHTCINLNGSF--ACECPPGFKLEKEKFCIDVDECARSNGNCSQVCINEIGSYRCD 970          
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Match: EFX89796.1 (hypothetical protein DAPPUDRAFT_40767, partial [Daphnia pulex])

HSP 1 Score: 275.404 bits (703), Expect = 1.593e-80
Identity = 187/449 (41.65%), Postives = 252/449 (56.12%), Query Frame = 0
Query:  487 VDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDD----CSDINECETQDL-ICDH--NCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSE 928
            +D+NEC L NGHGPCQ  C N  G Y C C  +PGTQL+  D H C   + C+V+NGGCSH C+++    +C CP+GY L +DWKTC DI+EC + +  C + C+NVP S  C C  GY  D     C D++EC    L  C     CIN  GS  C C  G++    T C D DEC MD  G    C N  G++ C C  GF    DN TC D NEC+ G+      G C NT GSF C C PG+ L  ++ +D  ECTNS  C  G+C N  G+Y C C+ G+    + C+D +EC+ +PC +  C+N+   + C C  GY+  +N     DEC   NPC V G+C N  GS+ C C  G++     C DI+E   E  PC  +G+C+N  GS++C CH GF + ++DS +    DEC ++PC +  C N LG ++C C  G  L +
Sbjct:    5 IDVNECSLRNGHGPCQGACHNTHGSYFCSCEDMPGTQLA-ADGHLCEDIDECRVDNGGCSHSCLNTLGTAYCACPEGYMLTDDWKTCEDIDECASDNGGCSHTCVNVPSSYKCTCPDGYALDQDWTTCRDVDECAESHLQTCGAVGTCINLPGSYRCLCPVGYEET-TTGCDDIDECLMDPCG-SGECINKMGSYTCTCHEGFTF--DNQTCQDINECSEGVP--CSDGLCENTVGSFICSCKPGYYLENNTYVD--ECTNSP-CIDGTCVNEPGSYLCLCEPGFTLERNVCIDFDECLISPCINATCVNQIGSFRCECPEGYLARNN--SYVDEC-QSNPC-VNGQCVNTDGSYWCRCLEGFKALGNICLDIDE--CETAPC-VNGECINTQGSYQCECHPGF-YLEDDSYV----DECQANPCANGTCVNLLGSYQCNCPPGHILVD 431          

HSP 2 Score: 232.261 bits (591), Expect = 1.101e-65
Identity = 181/453 (39.96%), Postives = 234/453 (51.66%), Query Frame = 0
Query:  612 DINECETQDL--ICDHNCINTEGSAHCTCK--AGFDLM-DETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTL--CGS-GSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDERGN-CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLG 1050
            D+NEC  ++    C   C NT GS  C+C+   G  L  D   C D DEC +DNGGC   C N  GT  C C  G+ L  D  TC D +EC     N G    C+N P S+ C C  G+ L +D  +C D++EC  S L  CG+ G+C NL G+Y C C  GY    + C DI+EC+ +PCG GECIN+   Y+C+CH G+   +  C+D +EC    PC   G C N  GSF C C PGY  +N    D         PC   G CVN  GS+ C+C  GF  ++N   +CIDFDECL SPC ++ C N +G F C C  G+     L      ++EC  N   NG C    VN  GS++CRC EG+K    GN C   DEC  +   NG     CIN  G  +CEC+PG+ ++          N C   NG     C+N LG + C+C  G
Sbjct:    6 DVNECSLRNGHGPCQGACHNTHGSYFCSCEDMPGTQLAADGHLCEDIDECRVDNGGCSHSCLNTLGTAYCACPEGYMLTDDWKTCEDIDEC--ASDNGGCSHTCVNVPSSYKCTCPDGYALDQDWTTCRDVDECAESHLQTCGAVGTCINLPGSYRCLCPVGYEETTTGCDDIDECLMDPCGSGECINKMGSYTCTCHEGFTFDNQTCQDINECSEGVPCS-DGLCENTVGSFICSCKPGYYLENNTYVD----ECTNSPC-IDGTCVNEPGSYLCLCEPGFTLERN---VCIDFDECLISPCINATCVNQIGSFRCECPEGY-----LARNNSYVDECQSNPCVNGQC----VNTDGSYWCRCLEGFKA--LGNICLDIDECETAPCVNG----ECINTQGSYQCECHPGFYLEDDSYVDECQANPCA--NG----TCVNLLGSYQCNCPPG 426          

HSP 3 Score: 230.335 bits (586), Expect = 6.257e-65
Identity = 167/443 (37.70%), Postives = 221/443 (49.89%), Query Frame = 0
Query:  574 VDINECV--TGDIQCLNKCMNVPGSAYCKCDS------GYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE-CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIG-IANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-------------------------------------IRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALN---NGDCSQVCVNILGSHYCRCYEGY 966
            +D+NEC    G   C   C N  GS +C C+         +G  C DI+EC   +  C H+C+NT G+A+C C  G+ L D+ + C D DEC  DNGGC   C N+  +++C C  G+ L+ D  TC D +EC    +  CG  G CIN PGS+ C C  G+E     C DI+EC     CGSG C N  G+Y C C  G+ F N TC DINEC                                       +PC  G C+NE   Y C C  G+    NVC D+DECL  +PC +   C N+ GSF C+C  GY  +N    D      + +PC  +G CVN DGS+ C C +GF   +   NIC+D DEC ++PC + EC NT G ++C C  GF L +        ++EC  N   NG     CVN+LGS+ C C  G+
Sbjct:    5 IDVNECSLRNGHGPCQGACHNTHGSYFCSCEDMPGTQLAADGHLCEDIDECRVDNGGCSHSCLNTLGTAYCACPEGYMLTDDWKTCEDIDECASDNGGCSHTCVNVPSSYKCTCPDGYALDQDWTTCRDVDECAESHLQTCGAVGTCINLPGSYRCLCPVGYEETTTGCDDIDECLMDP-CGSGECINKMGSYTCTCHEGFTFDNQTCQDINECSEGVPCSDGLCENTVGSFICSCKPGYYLENNTYVDECTNSPCIDGTCVNEPGSYLCLCEPGFTLERNVCIDFDECLI-SPC-INATCVNQIGSFRCECPEGYLARNNSYVD----ECQSNPC-VNGQCVNTDGSYWCRCLEGF---KALGNICLDIDECETAPCVNGECINTQGSYQCECHPGFYLEDD-----SYVDECQANPCANG----TCVNLLGSYQCNCPPGH 427          

HSP 4 Score: 207.608 bits (527), Expect = 3.990e-57
Identity = 171/472 (36.23%), Postives = 226/472 (47.88%), Query Frame = 0
Query:  433 CECHD--GFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ---CLNKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICI 894
            C C D  G  L  DG  CED+DEC  D   C H C N  GT  C C  G+  T     C DI+EC  +NG   C   C NV   Y+C                                             CPDGY LD+DW TC D++EC    +Q    +  C+N+PGS  C C  GYE     C DI+EC   D      CIN  GS  CTC  GF   ++T C D +EC       + +C N  G+F C CKPG++L  +       +ECT       I G C+N PGS+ C C PGF L  + C+D +EC  S  C + +C N  G++ C+C  GY+  N++ +D  EC  NPC +G+C+N    Y C C  G+  + N+C D DEC    PC V G+C N  GS+ C+C PG+  ++    D      + +PC  +G CVN  GS++C C  G  H   DS IC+
Sbjct:   32 CSCEDMPGTQLAADGHLCEDIDECRVDNGGCSHSCLNTLGTAYCACPEGYMLTDDWKTCEDIDECASDNGG--CSHTCVNVPSSYKC--------------------------------------------TCPDGYALDQDWTTCRDVDECAESHLQTCGAVGTCINLPGSYRCLCPVGYEETTTGCDDIDEC-LMDPCGSGECINKMGSYTCTCHEGFTFDNQT-CQDINECSEGVPCSDGLCENTVGSFICSCKPGYYLENNTYV----DECTNSPC---IDGTCVNEPGSYLCLCEPGFTLERNVCIDFDECLISP-CINATCVNQIGSFRCECPEGYLARNNSYVD--ECQSNPCVNGQCVNTDGSYWCRCLEGFKALGNICLDIDEC-ETAPC-VNGECINTQGSYQCECHPGFYLED----DSYVDECQANPCA-NGTCVNLLGSYQCNCPPG--HILVDSRICL 436          

HSP 5 Score: 192.971 bits (489), Expect = 3.772e-52
Identity = 173/469 (36.89%), Postives = 230/469 (49.04%), Query Frame = 0
Query:  651 FDKDECEMDNGG--CEQVCNNLEGTFQCGCK--PGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRN---PCGH-GECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN---NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
             D +EC + NG   C+  C+N  G++ C C+  PG  L  D   C D +EC +   N G    C+NT G+ YC C  G+ L +D  +C DI+EC +     S +C N+  +Y+C C  GY      +TC D++EC  +    CG  G CIN    Y C C  GY +    C D DECL D PCG  G+C NK GS+ C C  G+ F N  C DINE S E  PC   G C N  GSF C C  G+  + N        DEC +SPC    C N  G + CLCE GF L     N C D +EC ++    +  CVN +GS  C C EGY    R N ++ DEC+ +   NG     C+N  G   C C  G+        +C+D +EC      NG     CIN  G + C CH GF  ++ +     +A  C+  NG C ++  S      ++C CP G  L  D+R C
Sbjct:    5 IDVNECSLRNGHGPCQGACHNTHGSYFCSCEDMPGTQLAADGHLCEDIDECRV--DNGGCSHSCLNTLGTAYCACPEGYMLTDDWKTCEDIDECASDNGGCSHTCVNVPSSYKCTCPDGYALDQDWTTCRDVDECAESHLQTCGAVGTCINLPGSYRCLCPVGYEETTTGCDDIDECLMD-PCG-SGECINKMGSYTCTCHEGFTFDNQTCQDINECS-EGVPCS-DGLCENTVGSFICSCKPGYYLENNTY-----VDECTNSPCIDGTCVNEPGSYLCLCEPGFTLER---NVCIDFDECLISPCI-NATCVNQIGSFRCECPEGYLA--RNNSYV-DECQSNPCVNG----QCVNTDGSYWCRCLEGFKALG---NICLDIDECETAPCVNG----ECINTQGSYQCECHPGFYLEDDSYVDECQANPCA--NGTCVNLLGS------YQCNCPPGHIL-VDSRIC 435          

HSP 6 Score: 159.844 bits (403), Expect = 6.786e-41
Identity = 134/394 (34.01%), Postives = 194/394 (49.24%), Query Frame = 0
Query:  419 CEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHG-PCQDECKNVDGGYQCECG-GLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN 807
            C H C L+   T  C C +G+ L DD + CED+DEC  D   C H C N P +Y C C  G+      T C D++EC  ++         C N+ G Y+C C  G   T     D   C+ D          S ECI+      C C +G+  D   +TC DINEC  G       C N  GS  C C  GY  ++ + ++EC     I D  C+N  GS  C C+ GF L +   C D DEC + +      C N  G+F+C C  G+    ++      +EC    +N  + G C+NT GS++C C  GF+ + + C+DI+EC  +  C +G C N +G+Y+C+C  G+   + + +D  EC  NPC +G C+N    Y C+C  G++ VD+
Sbjct:   62 CSHSC-LNTLGTAYCACPEGYMLTDDWKTCEDIDECASDNGGCSHTCVNVPSSYKCTCPDGYALDQDWTTCRDVDECAESHLQTCGAVGTCINLPGSYRCLCPVGYEETTTGCDDIDECLMDPC-------GSGECINKMGSYTCTCHEGFTFDN--QTCQDINECSEGVPCSDGLCENTVGSFICSCKPGYYLENNTYVDECTNSPCI-DGTCVNEPGSYLCLCEPGFTL-ERNVCIDFDEC-LISPCINATCVNQIGSFRCECPEGYLARNNSYV----DECQ---SNPCVNGQCVNTDGSYWCRCLEGFKALGNICLDIDECETAP-CVNGECINTQGSYQCECHPGFYLEDDSYVD--ECQANPCANGTCVNLLGSYQCNCPPGHILVDS 432          

HSP 7 Score: 108.997 bits (271), Expect = 8.616e-24
Identity = 104/286 (36.36%), Postives = 134/286 (46.85%), Query Frame = 0
Query:  849 CH-DINEXSLEKDPCGPHGDCVNNDGSFECVCH-QGFIHDQNDSNICIDFDECL--SSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLK----TDARTCKP-IGGICSSAPRPSNGYYRC 1124
            CH D+NE SL        G C N  GS+ C C          D ++C D DEC   +  C HS C NTLG   C C  G+ L++    TCEDI+ECA +NG CS  CVN+  S+ C C +GY  D+    C   DEC  S     G    CIN+PG  +C C  GY    +    C D +EC ++  G    CINK+G +TC+CH GF  D +    C     CS        +C++T       C C  G+ L+     D  T  P I G C + P    G Y C
Sbjct:    3 CHIDVNECSLRNGHGPCQGACHNTHGSYFCSCEDMPGTQLAADGHLCEDIDECRVDNGGCSHS-CLNTLGTAYCACPEGYMLTDDW-KTCEDIDECASDNGGCSHTCVNVPSSYKCTCPDGYALDQDWTTCRDVDECAESHLQTCGAVGTCINLPGSYRCLCPVGY---EETTTGCDDIDECLMDPCG-SGECINKMGSYTCTCHEGFTFDNQ---TCQDINECSEGVPCSDGLCENTVGSF--ICSCKPGYYLENNTYVDECTNSPCIDGTCVNEP----GSYLC 273          

HSP 8 Score: 87.4261 bits (215), Expect = 8.561e-17
Identity = 74/226 (32.74%), Postives = 118/226 (52.21%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDE-CKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN---NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDK 653
            C C  G++L ++     VDEC + P + D  C N+PG+Y+C C  GFT +   C+D +ECL++    PC +  C N  G ++CEC   P   L+  +++     + CQ N   NG    +C+++    +C C +G++       C+DI+EC T    C+N +C+N  GS  C+C  G+  +D S ++EC+      +  C+N  GS  C C  G  L+D   C  K
Sbjct:  237 CSCKPGYYLENNTY---VDECTNSPCI-DGTCVNEPGSYLCLCEPGFTLERNVCIDFDECLIS----PCINATCVNQIGSFRCEC---PEGYLARNNSYV----DECQSNPCVNG----QCVNTDGSYWCRCLEGFK--ALGNICLDIDECETA--PCVNGECINTQGSYQCECHPGFYLEDDSYVDECQANPCA-NGTCVNLLGSYQCNCPPGHILVDSRICLGK 438          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942300243|gb|JAN32054.1| (Fibulin 1 and [Daphnia magna])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 470/1472 (31.93%), Postives = 650/1472 (44.16%), Query Frame = 0
Query:  322 LDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEG--YAFDPSKPDTLFCSERRWIGKRPLCVA------------------KSTLEIADPSRPSCDPDV------------------QEKKRCEHICYLDKGVTP---TCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ------CLNKCMNVPGSAYCK--------CDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAG-FDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECT-IGIANCGIYG--------------------------------------DCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSE------------------------------------ILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKD--ERGNCFLKDECR----------LSRRPNGGCQ-----------QLCINI--------------PGG-LKC-----------------ECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPE---KCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGI-CVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHCYP 1596
            LD SC   FT    I +A + +Y  R   P+ P    AEV+++C +   Y  DP+ PD LFCS + WIG+ P CV                       E+  P   S   +                   +++  CEH+C   +   P    C C+ GF LN DG+ C D+DEC      CD  C+N PG+++C C +GF   S G  C+D+NEC L NGHGPCQ  C N  G Y C C  +PGTQL+  D H C   + C+ +NGGCSH C+++    +C CP+GY L +DWKTC DI+EC            C   C N  GS  C         C  GY+ +D    C DI+EC   +  C H C NTEG+  C C +G F   D   C D DEC  DNGGC   C N+  +++C C  G+ L  D  TC D +EC    +A CGI G                                       CIN  GS+ C CH GF     +C DI+EC  +  C  G C N  G++ C C SGY   N+TC D++EC  +PC  G CIN+   Y C C  G+    NVC D+DECL  +PC +   C N+ GS+ C+C  GY  +N  C D++E   + +PC  +G C+N DGS+ C C  GF   +   NIC+D DEC ++PC + EC NT G ++C C  GF L +                                    +    C D+NECA NNG C Q C+N  GS+YC C +G+  D  ++  C   DEC           L+R  N  C+             C+ I              PGG L C                  C  GY      P+L    N+             N L G   +  L      K  +      K    S N        K  +   H       G K + D R       +  +AP  +    R  ++   G  VK    +L  R+ F       R+C ++G W G     C+ + CPPL    NG++SP +C T  +     C FTC  G+++TG     C    +W  +R  PP C      P+I CP DM   LP   +S  V IP+P TNV++  +V+++P WA  L  E+   + V++FRAR+P   + +A C  ++ V+D   PTV+NCP      LS  +      W +P F DNI + HV+ S  P   F+ G H + Y ASD  GN  RC+FT+ +         +P L  +P   ++  S                     C ++ S  NG  NC +   GQ    C P C +G+ F++   S    Y+C   R  W+    +PDC+P      +  C  GWE R   G+ CV C PG++R  N S +C  CP   Y   F++ +C  C +  TT  + +R    C P
Sbjct:  613 LDTSCG-PFTSLPVIPNAVVAKYG-RTRWPSPPFNLLAEVIFECQDTDVYQLDPTLPDRLFCSNQEWIGQHPKCVTINRQQQPHFAVTDGASGNDEEKELVIPLTSSISSNGVNVSSTAGQQINERSCFNEDRGGCEHVC--SQSAEPDSIRCLCYRGFRLNADGKSCVDIDECETGNGGCDDKCSNLPGSFICSCPVGFRLASNGKKCIDVNECSLRNGHGPCQGACHNTHGSYHCSCEDMPGTQLA-ADGHLCEDIDECRTDNGGCSHSCLNTLGTAYCACPEGYMLADDWKTCEDIDECDYSSDDDDSDRLCPGICRNSIGSYVCVDPDEESVLCPPGYDDEDEDGHCHDIDECSLSNGGCSHICTNTEGAHRCECPSGLFIEADNKTCKDIDECASDNGGCSHTCVNMPSSYKCTCPEGYTLGEDWTTCQDIDECAESNLATCGIVGTCFNVIGSYRCLCPSGYKENDMGCDDIDECLMDPCGSGKCINKMGSYTCACHEGFRFDNQTCQDIDECKENVPCLDGICENTVGSFTCSCKSGYYLENNTCFDVDECTNSPCIDGTCINQPGSYLCLCEPGFTLERNVCIDFDECLI-SPC-INATCVNQIGSYRCECPDGYLSRNNSCFDVDE--CQSNPC-VNGQCINTDGSYWCRCLDGF---KALGNICLDIDECETAPCVNGECINTQGSYQCECHPGFYLEDDSCFDVDECQANPCANGTCVNLLGSYQCNCPPGHILVDSRVCLDVNECATNNGQCDQKCINTPGSYYCACDKGFYLDPEDKQQCLDVDECDVNNGGCSQVCLNRPGNFSCECRTGYILSNDKSSCLEIVSAVTHYCPVIEPPPGGYLHCSSRPGIEGYKPGSTCTLRCRKGYAFRRHKPQLTWQANQVLNKPALLLEEKSNMLSGRQSNAGLAMLQGWKATQVRSGTTKEDWQSANRTNPEDAQKKLKRKNH-------GKKKENDKRQ------VVVNAPVQAGLQRRGRQRTDQGERVKR---QLHGRREF--PDQPFRRCGDDGKWKGKLGF-CQALTCPPLTKPANGSVSPLSCATGDAAPNQLCYFTCETGFRVTGNPVRTCLPSLKWNPLRP-PPACEKVHPWPRIECPKDMTIDLPPGKRSTEVLIPQPATNVDYVSHVEAEPSWAKKLRAELGPIRMVISFRARNPAT-EYTAICSFVLEVRDREAPTVKNCPHDIHVRLSSLEPYANAPWTDPVFNDNIAVTHVIKSKEPNSLFALGEHVVSYTASDAAGNTARCQFTVHV---------SPAL--IPAEFNRSES---------------------CVRLESPPNGDLNCLSWTWGQ---MCRPSCSAGHVFFRPLPS--AVYLCGRDR-RWKPGTSVPDCAPTSIIP-EGGCSVGWEERRTGGMQCVGCAPGLHRPLN-STVCIPCPMGTYQDNFSAGSCKSCPKKLTTCAMAARQCTDCKP 2010          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942297235|gb|JAN30550.1| (Fibulin 1 and [Daphnia magna])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 470/1472 (31.93%), Postives = 650/1472 (44.16%), Query Frame = 0
Query:  322 LDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEG--YAFDPSKPDTLFCSERRWIGKRPLCVA------------------KSTLEIADPSRPSCDPDV------------------QEKKRCEHICYLDKGVTP---TCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ------CLNKCMNVPGSAYCK--------CDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAG-FDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECT-IGIANCGIYG--------------------------------------DCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSE------------------------------------ILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKD--ERGNCFLKDECR----------LSRRPNGGCQ-----------QLCINI--------------PGG-LKC-----------------ECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPE---KCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGI-CVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHCYP 1596
            LD SC   FT    I +A + +Y  R   P+ P    AEV+++C +   Y  DP+ PD LFCS + WIG+ P CV                       E+  P   S   +                   +++  CEH+C   +   P    C C+ GF LN DG+ C D+DEC      CD  C+N PG+++C C +GF   S G  C+D+NEC L NGHGPCQ  C N  G Y C C  +PGTQL+  D H C   + C+ +NGGCSH C+++    +C CP+GY L +DWKTC DI+EC            C   C N  GS  C         C  GY+ +D    C DI+EC   +  C H C NTEG+  C C +G F   D   C D DEC  DNGGC   C N+  +++C C  G+ L  D  TC D +EC    +A CGI G                                       CIN  GS+ C CH GF     +C DI+EC  +  C  G C N  G++ C C SGY   N+TC D++EC  +PC  G CIN+   Y C C  G+    NVC D+DECL  +PC +   C N+ GS+ C+C  GY  +N  C D++E   + +PC  +G C+N DGS+ C C  GF   +   NIC+D DEC ++PC + EC NT G ++C C  GF L +                                    +    C D+NECA NNG C Q C+N  GS+YC C +G+  D  ++  C   DEC           L+R  N  C+             C+ I              PGG L C                  C  GY      P+L    N+             N L G   +  L      K  +      K    S N        K  +   H       G K + D R       +  +AP  +    R  ++   G  VK    +L  R+ F       R+C ++G W G     C+ + CPPL    NG++SP +C T  +     C FTC  G+++TG     C    +W  +R  PP C      P+I CP DM   LP   +S  V IP+P TNV++  +V+++P WA  L  E+   + V++FRAR+P   + +A C  ++ V+D   PTV+NCP      LS  +      W +P F DNI + HV+ S  P   F+ G H + Y ASD  GN  RC+FT+ +         +P L  +P   ++  S                     C ++ S  NG  NC +   GQ    C P C +G+ F++   S    Y+C   R  W+    +PDC+P      +  C  GWE R   G+ CV C PG++R  N S +C  CP   Y   F++ +C  C +  TT  + +R    C P
Sbjct:  615 LDTSCG-PFTSLPVIPNAVVAKYG-RTRWPSPPFNLLAEVIFECQDTDVYQLDPTLPDRLFCSNQEWIGQHPKCVTINRQQQPHFAVTDGASGNDEEKELVIPLTSSISSNGVNVSSTAGQQINERSCFNEDRGGCEHVC--SQSAEPDSIRCLCYRGFRLNADGKSCVDIDECETGNGGCDDKCSNLPGSFICSCPVGFRLASNGKKCIDVNECSLRNGHGPCQGACHNTHGSYHCSCEDMPGTQLA-ADGHLCEDIDECRTDNGGCSHSCLNTLGTAYCACPEGYMLADDWKTCEDIDECDYSSDDDDSDRLCPGICRNSIGSYVCVDPDEESVLCPPGYDDEDEDGHCHDIDECSLSNGGCSHICTNTEGAHRCECPSGLFIEADNKTCKDIDECASDNGGCSHTCVNMPSSYKCTCPEGYTLGEDWTTCQDIDECAESNLATCGIVGTCFNVIGSYRCLCPSGYKENDMGCDDIDECLMDPCGSGKCINKMGSYTCACHEGFRFDNQTCQDIDECKENVPCLDGICENTVGSFTCSCKSGYYLENNTCFDVDECTNSPCIDGTCINQPGSYLCLCEPGFTLERNVCIDFDECLI-SPC-INATCVNQIGSYRCECPDGYLSRNNSCFDVDE--CQSNPC-VNGQCINTDGSYWCRCLDGF---KALGNICLDIDECETAPCVNGECINTQGSYQCECHPGFYLEDDSCFDVDECQANPCANGTCVNLLGSYQCNCPPGHILVDSRVCLDVNECATNNGQCDQKCINTPGSYYCACDKGFYLDPEDKQQCLDVDECDVNNGGCSQVCLNRPGNFSCECRTGYILSNDKSSCLEIVSAVTHYCPVIEPPPGGYLHCSSRPGIEGYKPGSTCTLRCRKGYAFRRHKPQLTWQANQVLNKPALLLEEKSNMLSGRQSNAGLAMLQGWKATQVRSGTTKEDWQSANRTNPEDAQKKLKRKNH-------GKKKENDKRQ------VVVNAPVQAGLQRRGRQRTDQGERVKR---QLHGRREF--PDQPFRRCGDDGKWKGKLGF-CQALTCPPLTKPANGSVSPLSCATGDAAPNQLCYFTCETGFRVTGNPVRTCLPSLKWNPLRP-PPACEKVHPWPRIECPKDMTIDLPPGKRSTEVLIPQPATNVDYVSHVEAEPSWAKKLRAELGPIRMVISFRARNPAT-EYTAICSFVLEVRDREAPTVKNCPHDIHVRLSSLEPYANAPWTDPVFNDNIAVTHVIKSKEPNSLFALGEHVVSYTASDAAGNTARCQFTVHV---------SPAL--IPAEFNRSES---------------------CVRLESPPNGDLNCLSWTWGQ---MCRPSCSAGHVFFRPLPS--AVYLCGRDR-RWKPGTSVPDCAPTSIIP-EGGCSVGWEERRTGGMQCVGCAPGLHRPLN-STVCIPCPMGTYQDNFSAGSCKSCPKKLTTCAMAARQCTDCKP 2012          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942326625|gb|JAN45245.1| (Fibulin 1 and [Daphnia magna])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 468/1472 (31.79%), Postives = 647/1472 (43.95%), Query Frame = 0
Query:  322 LDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEG--YAFDPSKPDTLFCSERRWIGKRPLCVA------------------KSTLEIADPSRPSCDPDV------------------QEKKRCEHICYLDKGVTP---TCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ------CLNKCMNVPGSAYCK--------CDSGYEGDD----CSDINECETQDLICDHNCINTEGSAHCTCKAG-FDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECT-IGIANCGIYG--------------------------------------DCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSE------------------------------------ILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKD--ERGNCFLKDECR----------LSRRPNGGCQ-----------QLCINI--------------PGG-LKC-----------------ECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPE---KCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVHKSQLKSNCDAGWEYRSDEGI-CVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHCYP 1596
            LD SC   FT    I +A + +Y  R   P+ P    AEV+++C +   Y  DP+ PD LFCS + WIG+ P CV                       E+  P   S   +                   +++  CEH+C   +   P    C C+ GF LN DG+ C D+DEC      CD  C+N PG+++C C +GF   S G  C+D+NEC L NGHGPCQ  C N  G Y C C  +PGTQL+  D H C   + C+ +NGGCSH C+++    +C CP+GY L +DWKTC DI+EC            C   C N  GS  C         C  GY+ +D    C DI+EC   +  C H C NTEG+  C C +G F   D   C D DEC  DNGGC   C N+  +++C C  G+ L  D  TC D +EC    +A CGI G                                       CIN  GS+ C CH GF     +C DI+EC  +  C  G C N  G++ C C SGY   N+TC D++EC  +PC  G CIN+   Y C C  G+    NVC D+DECL  +PC +   C N+ GS+ C+C  GY  +N  C D++E   + +PC  +G C+N DGS+ C C  GF   +   NIC+D DEC ++PC + EC NT G ++C C  GF L +                                    +    C D+NECA NNG C Q C+N  GS+YC C +G+  D  ++  C   DEC           L+R  N  C+             C+ I              PGG L C                  C  GY      P+L    N+             N L G   +  L      K  +      K    S N        K  +   H       G K + D R       +  +AP  +    R  ++   G  VK    +L  R+ F       R+C ++G W G     C+ + CPPL    NG++SP +C T  +     C FTC  G+++TG     C    +W  +R  PP C      P+I CP DM   LP   +S  V IP+P TNV++  +V+++P WA  L  E+   + V++FRAR+P   + +A C  ++ V+D   PTV+NCP      LS  +      W +P F DNI + HV+ S  P   F+ G H + Y ASD  GN  RC+FT+ +               +P   ++  S                     C ++ S  NG  NC +   GQ    C P C +G+ F++   S    Y+C   R  W+    +PDC+P      +  C  GWE R   G+ CV C PG++R  N S +C  CP   Y   F++ +C  C +  TT  + +R    C P
Sbjct:  623 LDTSCG-PFTSLPVIPNAVVAKYG-RTRWPSPPFNLLAEVIFECQDTDVYQLDPTLPDRLFCSNQEWIGQHPKCVTINRQQQPHFAVTDGASGNDEEKELVIPLTSSISSNGVNVSSTAGQQINERSCFNEDRGGCEHVC--SQSAEPDSIRCLCYRGFRLNADGKSCVDIDECETGNGGCDDKCSNLPGSFICSCPVGFRLASNGKKCIDVNECSLRNGHGPCQGACHNTHGSYHCSCEDMPGTQLA-ADGHLCEDIDECRTDNGGCSHSCLNTLGTAYCACPEGYMLADDWKTCEDIDECDYSSDDDDSDRLCPGICRNSIGSYVCVDPDEESVLCPPGYDDEDEDGHCHDIDECSLSNGGCSHICTNTEGAHRCECPSGLFIEADNKTCKDIDECASDNGGCSHTCVNMPSSYKCTCPEGYTLGEDWTTCQDIDECAESNLATCGIVGTCFNVIGSYRCLCPSGYKENDMGCDDIDECLMDPCGSGKCINKMGSYTCACHEGFRFDNQTCQDIDECKENVPCLDGICENTVGSFTCSCKSGYYLENNTCFDVDECTNSPCIDGTCINQPGSYLCLCEPGFTLERNVCIDFDECLI-SPC-INATCVNQIGSYRCECPDGYLSRNNSCFDVDE--CQSNPC-VNGQCINTDGSYWCRCLDGF---KALGNICLDIDECETAPCVNGECINTQGSYQCECHPGFYLEDDSCFDVDECQANPCANGTCVNLLGSYQCNCPPGHILVDSRVCLDVNECATNNGQCDQKCINTPGSYYCACDKGFYLDPEDKQQCLDVDECDVNNGGCSQVCLNRPGNFSCECRTGYILSNDKSSCLEIVSAVTHYCPVIEPPPGGYLHCSSRPGIEGYKPGSTCTLRCRKGYAFRRHKPQLTWQANQVLNKPALLLEEKSNMLSGRQSNAGLAMLQGWKATQVRSGTTKEDWQSANRTNPEDAQKKLKRKNH-------GKKKENDKRQ------VVVNAPVQAGLQRRGRQRTDQGERVKR---QLHGRREF--PDQPFRRCGDDGKWKGKLGF-CQALTCPPLTKPANGSVSPLSCATGDAAPNQLCYFTCETGFRVTGNPVRTCLPSLKWNPLRP-PPACEKVHPWPRIECPKDMTIDLPPGKRSTEVLIPQPATNVDYVSHVEAEPSWAKKLRAELGPIRMVISFRARNPAT-EYTAICSFVLEVRDREAPTVKNCPHDIHVRLSSLEPYANAPWTDPVFNDNIAVTHVIKSKEPNSLFALGEHVVSYTASDAAGNTARCQFTVHVSP-----------ALIPAEFNRSES---------------------CVRLESPPNGDLNCLSWTWGQ---MCRPSCSAGHVFFRPLPS--AVYLCGRDR-RWKPGTSVPDCAPTSIIP-EGGCSVGWEERRTGGMQCVGCAPGLHRPLN-STVCIPCPMGTYQDNFSAGSCKSCPKKLTTCAMAARQCTDCKP 2020          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942334123|gb|JAN48994.1| (putative Fibrillin-2 [Daphnia magna])

HSP 1 Score: 588.186 bits (1515), Expect = 2.593e-176
Identity = 397/1076 (36.90%), Postives = 539/1076 (50.09%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLND------DGE-CEDVDEC-VDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ---VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCI-------NTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRC------------------------------------NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPK 1422
            PD++E+K  E    LD+       C +GF L D      DG  C DVDEC   D   C H+C N  G+  CDC  G+  ++ G AC+D++EC  NN    C   C N +G   C C    G  L   +N TC   + C    + N GCSH CI+      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+ECE+ D    H+C        NT GS  C C  GF     T C D DEC  +   C   C NL+G+++C C  GF     N TCTD +EC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC  ++ C  G C N  G++EC C  G+ I +N  C+D +EC+  PC  G CIN    YSCSC  GY   DN  C D DECL+ NPC V  +C N PGS+ C C  GYEF +  C D++E   +K PCG    C+N +GSF C C  G+I   ND   C D DEC  +PC +  C N  G ++C+C+ G+   E+    CEDI+EC   N  C   C N+ G++ C C  GYK  E   C   DEC+ + +P   C+  C+N+PG  +C+C  GY     +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+TD RTC  +   C     P +G   C                                       K    +  G+ C ++C KG+   G  T  C  +G W G E   C  + CP L    +G + P TC T  +  G +C   C  GY++ G     C    +W R    P +C    +  P I CP +M   LP   K  YV   +P++N++W RYVDSDP+WA  L GE+  G + +TFR RSPV+   +ATC   I + D   P + NCP S+  +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI +         +  +  +P+
Sbjct:  700 PDIKEEKSFE----LDQ------TCPEGFQLADRLAEVEDGSACLDVDECETQDNFGCSHLCINTQGSAHCDCPSGWNLSNDGKACLDLDECSDNNFG--CSHRCINTEGSAYCACPS--GYVLDISNNKTCSDIDECSDQDLPNFGCSHHCINLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPEGYRLSETDAKTCQDIDECESVDQEAGHSCRATGGTCRNTLGSYECICPEGFRTTG-TACADIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NINGTCTDIDECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECATTSPC-DGICRNTVGSFECLCAEGFQINNNDQCVDTDECLNEPC-EGICINTQGSYSCSCELGYQLGDNGTCSDIDECLN-NPCPV--ECINSPGSYTCLCPFGYEFDDNVCKDVDE--CQKQPCGNLAKCINTEGSFTCQCEPGYILRGND---CEDVDECKENPC-NGICINLPGSYKCICDPGY---ELRNGRCEDIDECL--NYKCGGRCTNLPGTYRCDCESGYKL-EGERCVDIDECQ-TLKP---CKGSCVNLPGSYRCDCEAGY---RSEGNACIDIDECSHRNGGCSHICVNTIGSFRCTCNSGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLETDGRTCTELPPRCPKMKAPDHGEIECIQNLNHTQHRSREQEDEALIAENGRGDLGASGWSANRSPKSRSLYNSGSTCNVRCNKGYKLVGDFTVSCGRSGLWLG-EPATCIPLACPKLLAPDSGVLMPHTCSTGKTFAGQQCQVRCRAGYRLIGGGIYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQKRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNTITFRVRSPVS-DLTATCNFTIEIFDKEIPRMTNCPTSWTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQAGYHEIAYVAQDGAGNQAKCQFTIHVTSQTVHRDTSSPITKLPR 1724          

HSP 2 Score: 191.43 bits (485), Expect = 3.948e-45
Identity = 118/322 (36.65%), Postives = 158/322 (49.07%), Query Frame = 0
Query:  317 VDLLRLDASCIIQ-------FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKR---------------------CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQV-NNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI--QCLNKCMNVPGSAYCKCDSG 604
            VD   LD SC++           A  I H +  +Y  +       G  YA  +++C  GY F     D L+C + RW+G  P+C+  +T      +    +  + E++                      CE IC  D   T TC C+ G+ L  DG  C DVDEC  D   C+  C N+ G+Y C C  GF   S G  C+D NECLL NGHGPCQ  C+N  G Y+C C   PGTQL+  D HTC   + C + +N GCSH C+++    FC CPDGY L +DWKTC D++EC   D+   C   C+N  GS  C  + G
Sbjct:  241 VDFATLDQSCLVDADNSNSPIVPAPAIPHGSGIKYIRKRNKGPGGGNRYAAAVFQCSVGYQFVVPDADRLYCRQGRWVGPSPICIIPNTDHPDQDASSVSNNALTEREEESSNAGSYGNERSECGDDKGGCEQICD-DTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLA-ADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 3 Score: 107.842 bits (268), Expect = 1.333e-19
Identity = 77/199 (38.69%), Postives = 102/199 (51.26%), Query Frame = 0
Query:  614 NECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGH---GECINESPGYSCSCHSG 801
            +EC      C+  C +T G+A C C  G+ L  D T C D DEC +DNGGCE  C N +G++QC C  GF L ++   C D NEC +   +    G C NT GS+ C C   PG +L  D  +C D++EC+     G S +C N  GT  C C  GY+  +   TC D++EC     G    G CIN    + CS   G
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 4 Score: 102.064 bits (253), Expect = 7.270e-18
Identity = 75/192 (39.06%), Postives = 91/192 (47.40%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDL--ICDHNCINTEGSAHCTC--KAGFDLM-DETECFDKDECEM-DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC 719
            C  + GGC   C  +     CLC  GY L +D  TC D++EC   +  C   C+N  GS  C C SG+     G  C D NEC  ++    C   C NT GS  C+C  + G  L  D   C D DEC + DN GC   C N  GT  C C  G+ L  D  TC D +EC +        G CINT GSF C
Sbjct:  364 CGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 5 Score: 88.9669 bits (219), Expect = 7.323e-14
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 0
Query:  827 CNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCET--GFALSEILPNTCEDINECAL-NNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            C++  G+  C C  GY        C D++E +++   C   G CVN  GS++C C  GF    N    CID +ECL      PC    C+NT G +EC C+   G  L+    +TCED++EC+L +N  CS  C+N LG+ +C C +GY   D+   C   DEC L       C   CIN  G  +C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGC--EGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAAD-GHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECEL-EDVGQACAGTCINTIGSFRC 555          

HSP 6 Score: 86.2705 bits (212), Expect = 3.954e-13
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 0
Query:  938 NECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSV-NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC--------KPIGGICSSAPRPSNGYYRCNKK 1127
            +EC  + G C Q+C +  G+  C CY GY   + G  C   DEC +    NGGC+  C+N  G  +C C+ G+ + S   + C+D NEC + NG   CQ  C N  G + CSC    +P  +   +   C     CS+ +N GCSH C +T       C CP G+ L  D +TC        + +G  C+     + G +RC+++
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTID---NGGCEGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPCQGTCRNTHGSYECSCDE--RPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAF--CTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEE 558          

HSP 7 Score: 85.5001 bits (210), Expect = 7.316e-13
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 0
Query:  909 CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECN--PGYIVDSQDPRLCVDKNECTI-NNGGCQHACINKLGGHTCSCHLGF 1051
            C +T G   CLC  G+ L++    TC D++EC ++NG C   CVN  GS+ C C  G++    G  C   +EC L R  +G CQ  C N  G  +C C+  PG  + + D   C D +EC++ +N GC H C+N LG   C+C  G+
Sbjct:  375 CDDTSGTATCLCYRGYVLAQD-GTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLL-RNGHGPCQGTCRNTHGSYECSCDERPGTQL-AADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGY 518          

HSP 8 Score: 79.7221 bits (195), Expect = 4.183e-11
Identity = 68/184 (36.96%), Postives = 88/184 (47.83%), Query Frame = 0
Query:  787 CINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC-HQGFIHDQNDSNICIDFDECLSSP---CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHYC 960
            C + S   +C C+ GYV   +   C D DEC  DN  G  G C N+ GS+ C C+ G+    NG  C D NE  L        G C N  GS+EC C  +       D + C D DEC       C H+ C NTLG   C C  G+ L +    TCED++EC L +    C+  C+N +GS  C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNG-GCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHT-CLNTLGTAFCTCPDGYMLGDDW-KTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 9 Score: 78.9518 bits (193), Expect = 7.937e-11
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 0
Query:  710 CINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RN---PCGHGECINESPGYSCSCH----SGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFEC 877
            C +T G+  C C+ G+ L +D  +C D++ECT       G+C N +G+Y+C C SG+    +   C+D NEC+ RN   PC  G C N    Y CSC     +      + C D DEC   +  G    C N  G+  C C  GY   +    C D++E  LE       G C+N  GSF C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 10 Score: 75.8702 bits (185), Expect = 6.364e-10
Identity = 68/193 (35.23%), Postives = 92/193 (47.67%), Query Frame = 0
Query:  749 CNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDN---PCGVGGKCNNKPGSFDCDC--APGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFA 925
            C++  GT  C C  GY+     +TC D++EC I N    G C+N    Y C C SG+    N   C D++ECL  N   PC   G C N  GS++C C   PG +       C D++E SL  D  G    C+N  G+  C C  G++   +D   C D DEC    +   C  + C NT+G F C  E G +
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQ--GTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSL-GDNFGCSHTCLNTLGTAFCTCPDGYMLG-DDWKTCEDMDECELEDVGQACAGT-CINTIGSFRCSEEDGAS 562          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942317435|gb|JAN40650.1| (putative Fibrillin-2 [Daphnia magna])

HSP 1 Score: 584.719 bits (1506), Expect = 3.411e-176
Identity = 397/1076 (36.90%), Postives = 539/1076 (50.09%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLND------DGE-CEDVDEC-VDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ---VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCI-------NTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRC------------------------------------NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPK 1422
            PD++E+K  E    LD+       C +GF L D      DG  C DVDEC   D   C H+C N  G+  CDC  G+  ++ G AC+D++EC  NN    C   C N +G   C C    G  L   +N TC   + C    + N GCSH CI+      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+ECE+ D    H+C        NT GS  C C  GF     T C D DEC  +   C   C NL+G+++C C  GF     N TCTD +EC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC  ++ C  G C N  G++EC C  G+ I +N  C+D +EC+  PC  G CIN    YSCSC  GY   DN  C D DECL +NPC V  +C N PGS+ C C  GYEF +  C D++E   +K PCG    C+N +GSF C C  G+I   ND   C D DEC  +PC +  C N  G ++C+C+ G+   E+    CEDI+EC   N  C   C N+ G++ C C  GYK  E   C   DEC+ + +P   C+  C+N+PG  +C+C  GY     +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+TD RTC  +   C     P +G   C                                       K    +  G+ C ++C KG+   G  T  C  +G W G E   C  + CP L    +G + P TC T  +  G +C   C  GY++ G     C    +W R    P +C    +  P I CP +M   LP   K  YV   +P++N++W RYVDSDP+WA  L GE+  G + +TFR RSPV+   +ATC   I + D   P + NCP S+  +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI +         +  +  +P+
Sbjct:  491 PDIKEEKSFE----LDQ------TCPEGFQLADRLAEVEDGSACLDVDECETQDNFGCSHLCINTQGSAHCDCPSGWNLSNDGKACLDLDECSDNNFG--CSHRCINTEGSAYCAC--PSGYVLDISNNKTCSDIDECSDQDLPNFGCSHHCINLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPEGYRLSETDAKTCQDIDECESVDQEAGHSCRATGGTCRNTLGSYECICPEGFRTTG-TACADIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NINGTCTDIDECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECATTSPC-DGICRNTVGSFECLCAEGFQINNNDQCVDTDECLNEPC-EGICINTQGSYSCSCELGYQLGDNGTCSDIDECL-NNPCPV--ECINSPGSYTCLCPFGYEFDDNVCKDVDE--CQKQPCGNLAKCINTEGSFTCQCEPGYILRGND---CEDVDECKENPC-NGICINLPGSYKCICDPGY---ELRNGRCEDIDECL--NYKCGGRCTNLPGTYRCDCESGYKL-EGERCVDIDECQ-TLKP---CKGSCVNLPGSYRCDCEAGY---RSEGNACIDIDECSHRNGGCSHICVNTIGSFRCTCNSGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLETDGRTCTELPPRCPKMKAPDHGEIECIQNLNHTQHRSREQEDEALIAENGRGDLGASGWSANRSPKSRSLYNSGSTCNVRCNKGYKLVGDFTVSCGRSGLWLG-EPATCIPLACPKLLAPDSGVLMPHTCSTGKTFAGQQCQVRCRAGYRLIGGGIYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQKRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNTITFRVRSPVS-DLTATCNFTIEIFDKEIPRMTNCPTSWTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQAGYHEIAYVAQDGAGNQAKCQFTIHVTSQTVHRDTSSPITKLPR 1515          

HSP 2 Score: 184.496 bits (467), Expect = 5.348e-43
Identity = 112/302 (37.09%), Postives = 150/302 (49.67%), Query Frame = 0
Query:  330 FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKR---------------------CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQV-NNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI--QCLNKCMNVPGSAYCKCDSG 604
               A  I H +  +Y  +       G  YA  +++C  GY F     D L+C + RW+G  P+C+  +T      +    +  + E++                      CE IC  D   T TC C+ G+ L  DG  C DVDEC  D   C+  C N+ G+Y C C  GF   S G  C+D NECLL NGHGPCQ  C+N  G Y+C C   PGTQL+  D HTC   + C + +N GCSH C+++    FC CPDGY L +DWKTC D++EC   D+   C   C+N  GS  C  + G
Sbjct:   52 IVPAPAIPHGSGIKYIRKRNKGPGGGNRYAAAVFQCSVGYQFVVPDADRLYCRQGRWVGPSPICIIPNTDHPDQDASSVSNNALTEREEESSNAGSYGNERSECGDDKGGCEQICD-DTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLA-ADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 351          

HSP 3 Score: 107.071 bits (266), Expect = 2.230e-19
Identity = 76/195 (38.97%), Postives = 101/195 (51.79%), Query Frame = 0
Query:  614 NECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGH---GECINESPGYSCS 797
            +EC      C+  C +T G+A C C  G+ L  D T C D DEC +DNGGCE  C N +G++QC C  GF L ++   C D NEC +   +    G C NT GS+ C C   PG +L  D  +C D++EC+     G S +C N  GT  C C  GY+  +   TC D++EC     G    G CIN    + CS
Sbjct:  153 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCS 347          

HSP 4 Score: 101.679 bits (252), Expect = 8.920e-18
Identity = 75/192 (39.06%), Postives = 91/192 (47.40%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDL--ICDHNCINTEGSAHCTC--KAGFDLM-DETECFDKDECEM-DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC 719
            C  + GGC   C  +     CLC  GY L +D  TC D++EC   +  C   C+N  GS  C C SG+     G  C D NEC  ++    C   C NT GS  C+C  + G  L  D   C D DEC + DN GC   C N  GT  C C  G+ L  D  TC D +EC +        G CINT GSF C
Sbjct:  155 CGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 346          

HSP 5 Score: 87.8113 bits (216), Expect = 1.474e-13
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 0
Query:  827 CNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCET--GFALSEILPNTCEDINECAL-NNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            C++  G+  C C  GY        C D++E +++   C   G CVN  GS++C C  GF    N    CID +ECL      PC    C+NT G +EC C+   G  L+    +TCED++EC+L +N  CS  C+N LG+ +C C +GY   D+   C   DEC L       C   CIN  G  +C
Sbjct:  166 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGC--EGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAAD-GHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQ-ACAGTCINTIGSFRC 346          

HSP 6 Score: 85.5001 bits (210), Expect = 7.898e-13
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 0
Query:  938 NECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSV-NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC--------KPIGGICSSAPRPSNGYYRCNKK 1127
            +EC  + G C Q+C +  G+  C CY GY   + G  C   DEC +    NGGC+  C+N  G  +C C+ G+ + S   + C+D NEC + NG   CQ  C N  G + CSC    +P  +   +   C     CS+ +N GCSH C +T       C CP G+ L  D +TC        + +G  C+     + G +RC+++
Sbjct:  153 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTID---NGGCEGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPCQGTCRNTHGSYECSCDE--RPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAF--CTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEE 349          

HSP 7 Score: 84.7297 bits (208), Expect = 1.246e-12
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 0
Query:  909 CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECN--PGYIVDSQDPRLCVDKNECTI-NNGGCQHACINKLGGHTCSCHLGF 1051
            C +T G   CLC  G+ L++    TC D++EC ++NG C   CVN  GS+ C C  G++    G  C   +EC L R  +G CQ  C N  G  +C C+  PG  + + D   C D +EC++ +N GC H C+N LG   C+C  G+
Sbjct:  166 CDDTSGTATCLCYRGYVLAQD-GTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLL-RNGHGPCQGTCRNTHGSYECSCDERPGTQL-AADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGY 309          

HSP 8 Score: 78.9518 bits (193), Expect = 7.830e-11
Identity = 68/184 (36.96%), Postives = 88/184 (47.83%), Query Frame = 0
Query:  787 CINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC-HQGFIHDQNDSNICIDFDECLSSP---CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHYC 960
            C + S   +C C+ GYV   +   C D DEC  DN  G  G C N+ GS+ C C+ G+    NG  C D NE  L        G C N  GS+EC C  +       D + C D DEC       C H+ C NTLG   C C  G+ L +    TCED++EC L +    C+  C+N +GS  C
Sbjct:  166 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNG-GCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHT-CLNTLGTAFCTCPDGYMLGDDW-KTCEDMDECELEDVGQACAGTCINTIGSFRC 346          

HSP 9 Score: 77.7962 bits (190), Expect = 1.715e-10
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 0
Query:  710 CINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RN---PCGHGECINESPGYSCSCH----SGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFEC 877
            C +T G+  C C+ G+ L +D  +C D++ECT       G+C N +G+Y+C C SG+    +   C+D NEC+ RN   PC  G C N    Y CSC     +      + C D DEC   +  G    C N  G+  C C  GY   +    C D++E  LE       G C+N  GSF C
Sbjct:  166 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 346          

HSP 10 Score: 74.7146 bits (182), Expect = 1.602e-9
Identity = 68/193 (35.23%), Postives = 92/193 (47.67%), Query Frame = 0
Query:  749 CNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDN---PCGVGGKCNNKPGSFDCDC--APGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFA 925
            C++  GT  C C  GY+     +TC D++EC I N    G C+N    Y C C SG+    N   C D++ECL  N   PC   G C N  GS++C C   PG +       C D++E SL  D  G    C+N  G+  C C  G++   +D   C D DEC    +   C  + C NT+G F C  E G +
Sbjct:  166 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQ--GTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSL-GDNFGCSHTCLNTLGTAFCTCPDGYMLG-DDWKTCEDMDECELEDVGQACAGT-CINTIGSFRCSEEDGAS 353          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942327517|gb|JAN45691.1| (putative Fibrillin-2 [Daphnia magna])

HSP 1 Score: 590.112 bits (1520), Expect = 3.670e-176
Identity = 397/1076 (36.90%), Postives = 539/1076 (50.09%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLND------DGE-CEDVDEC-VDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ---VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCI-------NTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRC------------------------------------NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPK 1422
            PD++E+K  E    LD+       C +GF L D      DG  C DVDEC   D   C H+C N  G+  CDC  G+  ++ G AC+D++EC  NN    C   C N +G   C C    G  L   +N TC   + C    + N GCSH CI+      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+ECE+ D    H+C        NT GS  C C  GF     T C D DEC  +   C   C NL+G+++C C  GF     N TCTD +EC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC  ++ C  G C N  G++EC C  G+ I +N  C+D +EC+  PC  G CIN    YSCSC  GY   DN  C D DECL +NPC V  +C N PGS+ C C  GYEF +  C D++E   +K PCG    C+N +GSF C C  G+I   ND   C D DEC  +PC +  C N  G ++C+C+ G+   E+    CEDI+EC   N  C   C N+ G++ C C  GYK  E   C   DEC+ + +P   C+  C+N+PG  +C+C  GY     +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+TD RTC  +   C     P +G   C                                       K    +  G+ C ++C KG+   G  T  C  +G W G E   C  + CP L    +G + P TC T  +  G +C   C  GY++ G     C    +W R    P +C    +  P I CP +M   LP   K  YV   +P++N++W RYVDSDP+WA  L GE+  G + +TFR RSPV+   +ATC   I + D   P + NCP S+  +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI +         +  +  +P+
Sbjct:  700 PDIKEEKSFE----LDQ------TCPEGFQLADRLAEVEDGSACLDVDECETQDNFGCSHLCINTQGSAHCDCPSGWNLSNDGKACLDLDECSDNNFG--CSHRCINTEGSAYCACPS--GYVLDISNNKTCSDIDECSDQDLPNFGCSHHCINLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPEGYRLSETDAKTCQDIDECESVDQEAGHSCRATGGTCRNTLGSYECICPEGFRTTG-TACADIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NINGTCTDIDECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECATTSPC-DGICRNTVGSFECLCAEGFQINNNDQCVDTDECLNEPC-EGICINTQGSYSCSCELGYQLGDNGTCSDIDECL-NNPCPV--ECINSPGSYTCLCPFGYEFDDNVCKDVDE--CQKQPCGNLAKCINTEGSFTCQCEPGYILRGND---CEDVDECKENPC-NGICINLPGSYKCICDPGY---ELRNGRCEDIDECL--NYKCGGRCTNLPGTYRCDCESGYKL-EGERCVDIDECQ-TLKP---CKGSCVNLPGSYRCDCEAGY---RSEGNACIDIDECSHRNGGCSHICVNTIGSFRCTCNSGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLETDGRTCTELPPRCPKMKAPDHGEIECIQNLNHTQHRSREQEDEALIAENGRGDLGASGWSANRSPKSRSLYNSGSTCNVRCNKGYKLVGDFTVSCGRSGLWLG-EPATCIPLACPKLLAPDSGVLMPHTCSTGKTFAGQQCQVRCRAGYRLIGGGIYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQKRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNTITFRVRSPVS-DLTATCNFTIEIFDKEIPRMTNCPTSWTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQAGYHEIAYVAQDGAGNQAKCQFTIHVTSQTVHRDTSSPITKLPR 1724          

HSP 2 Score: 192.2 bits (487), Expect = 2.323e-45
Identity = 118/322 (36.65%), Postives = 158/322 (49.07%), Query Frame = 0
Query:  317 VDLLRLDASCIIQ-------FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKR---------------------CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQV-NNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI--QCLNKCMNVPGSAYCKCDSG 604
            VD   LD SC++           A  I H +  +Y  +       G  YA  +++C  GY F     D L+C + RW+G  P+C+  +T      +    +  + E++                      CE IC  D   T TC C+ G+ L  DG  C DVDEC  D   C+  C N+ G+Y C C  GF   S G  C+D NECLL NGHGPCQ  C+N  G Y+C C   PGTQL+  D HTC   + C + +N GCSH C+++    FC CPDGY L +DWKTC D++EC   D+   C   C+N  GS  C  + G
Sbjct:  241 VDFATLDQSCLVDADNSNSPIVPAPAIPHGSGIKYIRKRNKGPGGGNRYAAAVFQCSVGYQFVVPDADRLYCRQGRWVGPSPICIIPNTDHPDQDASSVSNNALTEREEESSNAGSYGNERSECGDDKGGCEQICD-DTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLA-ADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 3 Score: 108.612 bits (270), Expect = 7.610e-20
Identity = 77/199 (38.69%), Postives = 102/199 (51.26%), Query Frame = 0
Query:  614 NECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGH---GECINESPGYSCSCHSG 801
            +EC      C+  C +T G+A C C  G+ L  D T C D DEC +DNGGCE  C N +G++QC C  GF L ++   C D NEC +   +    G C NT GS+ C C   PG +L  D  +C D++EC+     G S +C N  GT  C C  GY+  +   TC D++EC     G    G CIN    + CS   G
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 4 Score: 103.219 bits (256), Expect = 3.443e-18
Identity = 75/192 (39.06%), Postives = 91/192 (47.40%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDL--ICDHNCINTEGSAHCTC--KAGFDLM-DETECFDKDECEM-DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC 719
            C  + GGC   C  +     CLC  GY L +D  TC D++EC   +  C   C+N  GS  C C SG+     G  C D NEC  ++    C   C NT GS  C+C  + G  L  D   C D DEC + DN GC   C N  GT  C C  G+ L  D  TC D +EC +        G CINT GSF C
Sbjct:  364 CGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 5 Score: 89.3521 bits (220), Expect = 5.589e-14
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 0
Query:  827 CNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCET--GFALSEILPNTCEDINECAL-NNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            C++  G+  C C  GY        C D++E +++   C   G CVN  GS++C C  GF    N    CID +ECL      PC    C+NT G +EC C+   G  L+    +TCED++EC+L +N  CS  C+N LG+ +C C +GY   D+   C   DEC L       C   CIN  G  +C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGC--EGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAAD-GHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECEL-EDVGQACAGTCINTIGSFRC 555          

HSP 6 Score: 86.6557 bits (213), Expect = 3.093e-13
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 0
Query:  938 NECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSV-NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC--------KPIGGICSSAPRPSNGYYRCNKK 1127
            +EC  + G C Q+C +  G+  C CY GY   + G  C   DEC +    NGGC+  C+N  G  +C C+ G+ + S   + C+D NEC + NG   CQ  C N  G + CSC    +P  +   +   C     CS+ +N GCSH C +T       C CP G+ L  D +TC        + +G  C+     + G +RC+++
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTID---NGGCEGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPCQGTCRNTHGSYECSCDE--RPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAF--CTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEE 558          

HSP 7 Score: 85.8853 bits (211), Expect = 5.304e-13
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 0
Query:  909 CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECN--PGYIVDSQDPRLCVDKNECTI-NNGGCQHACINKLGGHTCSCHLGF 1051
            C +T G   CLC  G+ L++    TC D++EC ++NG C   CVN  GS+ C C  G++    G  C   +EC L R  +G CQ  C N  G  +C C+  PG  + + D   C D +EC++ +N GC H C+N LG   C+C  G+
Sbjct:  375 CDDTSGTATCLCYRGYVLAQD-GTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLL-RNGHGPCQGTCRNTHGSYECSCDERPGTQL-AADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGY 518          

HSP 8 Score: 80.1073 bits (196), Expect = 3.465e-11
Identity = 68/184 (36.96%), Postives = 88/184 (47.83%), Query Frame = 0
Query:  787 CINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC-HQGFIHDQNDSNICIDFDECLSSP---CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHYC 960
            C + S   +C C+ GYV   +   C D DEC  DN  G  G C N+ GS+ C C+ G+    NG  C D NE  L        G C N  GS+EC C  +       D + C D DEC       C H+ C NTLG   C C  G+ L +    TCED++EC L +    C+  C+N +GS  C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNG-GCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHT-CLNTLGTAFCTCPDGYMLGDDW-KTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 9 Score: 79.337 bits (194), Expect = 6.094e-11
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 0
Query:  710 CINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RN---PCGHGECINESPGYSCSCH----SGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFEC 877
            C +T G+  C C+ G+ L +D  +C D++ECT       G+C N +G+Y+C C SG+    +   C+D NEC+ RN   PC  G C N    Y CSC     +      + C D DEC   +  G    C N  G+  C C  GY   +    C D++E  LE       G C+N  GSF C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 10 Score: 76.2554 bits (186), Expect = 5.179e-10
Identity = 68/193 (35.23%), Postives = 92/193 (47.67%), Query Frame = 0
Query:  749 CNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDN---PCGVGGKCNNKPGSFDCDC--APGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFA 925
            C++  GT  C C  GY+     +TC D++EC I N    G C+N    Y C C SG+    N   C D++ECL  N   PC   G C N  GS++C C   PG +       C D++E SL  D  G    C+N  G+  C C  G++   +D   C D DEC    +   C  + C NT+G F C  E G +
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQ--GTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSL-GDNFGCSHTCLNTLGTAFCTCPDGYMLG-DDWKTCEDMDECELEDVGQACAGT-CINTIGSFRCSEEDGAS 562          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942327515|gb|JAN45690.1| (putative Fibrillin-2 [Daphnia magna])

HSP 1 Score: 587.415 bits (1513), Expect = 3.719e-176
Identity = 397/1076 (36.90%), Postives = 539/1076 (50.09%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLND------DGE-CEDVDEC-VDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ---VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCI-------NTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRC------------------------------------NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPK 1422
            PD++E+K  E    LD+       C +GF L D      DG  C DVDEC   D   C H+C N  G+  CDC  G+  ++ G AC+D++EC  NN    C   C N +G   C C    G  L   +N TC   + C    + N GCSH CI+      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+ECE+ D    H+C        NT GS  C C  GF     T C D DEC  +   C   C NL+G+++C C  GF     N TCTD +EC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC  ++ C  G C N  G++EC C  G+ I +N  C+D +EC+  PC  G CIN    YSCSC  GY   DN  C D DECL +NPC V  +C N PGS+ C C  GYEF +  C D++E   +K PCG    C+N +GSF C C  G+I   ND   C D DEC  +PC +  C N  G ++C+C+ G+   E+    CEDI+EC   N  C   C N+ G++ C C  GYK  E   C   DEC+ + +P   C+  C+N+PG  +C+C  GY     +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+TD RTC  +   C     P +G   C                                       K    +  G+ C ++C KG+   G  T  C  +G W G E   C  + CP L    +G + P TC T  +  G +C   C  GY++ G     C    +W R    P +C    +  P I CP +M   LP   K  YV   +P++N++W RYVDSDP+WA  L GE+  G + +TFR RSPV+   +ATC   I + D   P + NCP S+  +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI +         +  +  +P+
Sbjct:  700 PDIKEEKSFE----LDQ------TCPEGFQLADRLAEVEDGSACLDVDECETQDNFGCSHLCINTQGSAHCDCPSGWNLSNDGKACLDLDECSDNNFG--CSHRCINTEGSAYCACPS--GYVLDISNNKTCSDIDECSDQDLPNFGCSHHCINLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPEGYRLSETDAKTCQDIDECESVDQEAGHSCRATGGTCRNTLGSYECICPEGFRTTG-TACADIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NINGTCTDIDECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECATTSPC-DGICRNTVGSFECLCAEGFQINNNDQCVDTDECLNEPC-EGICINTQGSYSCSCELGYQLGDNGTCSDIDECL-NNPCPV--ECINSPGSYTCLCPFGYEFDDNVCKDVDE--CQKQPCGNLAKCINTEGSFTCQCEPGYILRGND---CEDVDECKENPC-NGICINLPGSYKCICDPGY---ELRNGRCEDIDECL--NYKCGGRCTNLPGTYRCDCESGYKL-EGERCVDIDECQ-TLKP---CKGSCVNLPGSYRCDCEAGY---RSEGNACIDIDECSHRNGGCSHICVNTIGSFRCTCNSGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLETDGRTCTELPPRCPKMKAPDHGEIECIQNLNHTQHRSREQEDEALIAENGRGDLGASGWSANRSPKSRSLYNSGSTCNVRCNKGYKLVGDFTVSCGRSGLWLG-EPATCIPLACPKLLAPDSGVLMPHTCSTGKTFAGQQCQVRCRAGYRLIGGGIYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQKRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNTITFRVRSPVS-DLTATCNFTIEIFDKEIPRMTNCPTSWTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQAGYHEIAYVAQDGAGNQAKCQFTIHVTSQTVHRDTSSPITKLPR 1724          

HSP 2 Score: 191.43 bits (485), Expect = 3.603e-45
Identity = 118/322 (36.65%), Postives = 158/322 (49.07%), Query Frame = 0
Query:  317 VDLLRLDASCIIQ-------FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKR---------------------CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQV-NNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI--QCLNKCMNVPGSAYCKCDSG 604
            VD   LD SC++           A  I H +  +Y  +       G  YA  +++C  GY F     D L+C + RW+G  P+C+  +T      +    +  + E++                      CE IC  D   T TC C+ G+ L  DG  C DVDEC  D   C+  C N+ G+Y C C  GF   S G  C+D NECLL NGHGPCQ  C+N  G Y+C C   PGTQL+  D HTC   + C + +N GCSH C+++    FC CPDGY L +DWKTC D++EC   D+   C   C+N  GS  C  + G
Sbjct:  241 VDFATLDQSCLVDADNSNSPIVPAPAIPHGSGIKYIRKRNKGPGGGNRYAAAVFQCSVGYQFVVPDADRLYCRQGRWVGPSPICIIPNTDHPDQDASSVSNNALTEREEESSNAGSYGNERSECGDDKGGCEQICD-DTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLA-ADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 3 Score: 107.457 bits (267), Expect = 1.615e-19
Identity = 76/195 (38.97%), Postives = 101/195 (51.79%), Query Frame = 0
Query:  614 NECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGH---GECINESPGYSCS 797
            +EC      C+  C +T G+A C C  G+ L  D T C D DEC +DNGGCE  C N +G++QC C  GF L ++   C D NEC +   +    G C NT GS+ C C   PG +L  D  +C D++EC+     G S +C N  GT  C C  GY+  +   TC D++EC     G    G CIN    + CS
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCS 556          

HSP 4 Score: 102.064 bits (253), Expect = 7.072e-18
Identity = 75/192 (39.06%), Postives = 91/192 (47.40%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDL--ICDHNCINTEGSAHCTC--KAGFDLM-DETECFDKDECEM-DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC 719
            C  + GGC   C  +     CLC  GY L +D  TC D++EC   +  C   C+N  GS  C C SG+     G  C D NEC  ++    C   C NT GS  C+C  + G  L  D   C D DEC + DN GC   C N  GT  C C  G+ L  D  TC D +EC +        G CINT GSF C
Sbjct:  364 CGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 5 Score: 88.5817 bits (218), Expect = 8.365e-14
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 0
Query:  827 CNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCET--GFALSEILPNTCEDINECAL-NNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            C++  G+  C C  GY        C D++E +++   C   G CVN  GS++C C  GF    N    CID +ECL      PC    C+NT G +EC C+   G  L+    +TCED++EC+L +N  CS  C+N LG+ +C C +GY   D+   C   DEC L       C   CIN  G  +C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGC--EGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAAD-GHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECEL-EDVGQACAGTCINTIGSFRC 555          

HSP 6 Score: 86.2705 bits (212), Expect = 4.404e-13
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 0
Query:  938 NECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSV-NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC--------KPIGGICSSAPRPSNGYYRCNKK 1127
            +EC  + G C Q+C +  G+  C CY GY   + G  C   DEC +    NGGC+  C+N  G  +C C+ G+ + S   + C+D NEC + NG   CQ  C N  G + CSC    +P  +   +   C     CS+ +N GCSH C +T       C CP G+ L  D +TC        + +G  C+     + G +RC+++
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTID---NGGCEGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPCQGTCRNTHGSYECSCDE--RPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAF--CTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEE 558          

HSP 7 Score: 85.5001 bits (210), Expect = 7.181e-13
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 0
Query:  909 CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECN--PGYIVDSQDPRLCVDKNECTI-NNGGCQHACINKLGGHTCSCHLGF 1051
            C +T G   CLC  G+ L++    TC D++EC ++NG C   CVN  GS+ C C  G++    G  C   +EC L R  +G CQ  C N  G  +C C+  PG  + + D   C D +EC++ +N GC H C+N LG   C+C  G+
Sbjct:  375 CDDTSGTATCLCYRGYVLAQD-GTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLL-RNGHGPCQGTCRNTHGSYECSCDERPGTQL-AADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGY 518          

HSP 8 Score: 79.337 bits (194), Expect = 5.112e-11
Identity = 68/184 (36.96%), Postives = 88/184 (47.83%), Query Frame = 0
Query:  787 CINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC-HQGFIHDQNDSNICIDFDECLSSP---CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHYC 960
            C + S   +C C+ GYV   +   C D DEC  DN  G  G C N+ GS+ C C+ G+    NG  C D NE  L        G C N  GS+EC C  +       D + C D DEC       C H+ C NTLG   C C  G+ L +    TCED++EC L +    C+  C+N +GS  C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNG-GCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHT-CLNTLGTAFCTCPDGYMLGDDW-KTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 9 Score: 78.5666 bits (192), Expect = 9.701e-11
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 0
Query:  710 CINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RN---PCGHGECINESPGYSCSCH----SGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFEC 877
            C +T G+  C C+ G+ L +D  +C D++ECT       G+C N +G+Y+C C SG+    +   C+D NEC+ RN   PC  G C N    Y CSC     +      + C D DEC   +  G    C N  G+  C C  GY   +    C D++E  LE       G C+N  GSF C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 10 Score: 75.485 bits (184), Expect = 8.462e-10
Identity = 68/193 (35.23%), Postives = 92/193 (47.67%), Query Frame = 0
Query:  749 CNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDN---PCGVGGKCNNKPGSFDCDC--APGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFA 925
            C++  GT  C C  GY+     +TC D++EC I N    G C+N    Y C C SG+    N   C D++ECL  N   PC   G C N  GS++C C   PG +       C D++E SL  D  G    C+N  G+  C C  G++   +D   C D DEC    +   C  + C NT+G F C  E G +
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQ--GTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSL-GDNFGCSHTCLNTLGTAFCTCPDGYMLG-DDWKTCEDMDECELEDVGQACAGT-CINTIGSFRCSEEDGAS 562          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942327519|gb|JAN45692.1| (putative Fibrillin-2 [Daphnia magna])

HSP 1 Score: 589.726 bits (1519), Expect = 4.034e-176
Identity = 397/1076 (36.90%), Postives = 539/1076 (50.09%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLND------DGE-CEDVDEC-VDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ---VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCI-------NTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRC------------------------------------NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPK 1422
            PD++E+K  E    LD+       C +GF L D      DG  C DVDEC   D   C H+C N  G+  CDC  G+  ++ G AC+D++EC  NN    C   C N +G   C C    G  L   +N TC   + C    + N GCSH CI+      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+ECE+ D    H+C        NT GS  C C  GF     T C D DEC  +   C   C NL+G+++C C  GF     N TCTD +EC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC  ++ C  G C N  G++EC C  G+ I +N  C+D +EC+  PC  G CIN    YSCSC  GY   DN  C D DECL+ NPC V  +C N PGS+ C C  GYEF +  C D++E   +K PCG    C+N +GSF C C  G+I   ND   C D DEC  +PC +  C N  G ++C+C+ G+   E+    CEDI+EC   N  C   C N+ G++ C C  GYK  E   C   DEC+ + +P   C+  C+N+PG  +C+C  GY     +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+TD RTC  +   C     P +G   C                                       K    +  G+ C ++C KG+   G  T  C  +G W G E   C  + CP L    +G + P TC T  +  G +C   C  GY++ G     C    +W R    P +C    +  P I CP +M   LP   K  YV   +P++N++W RYVDSDP+WA  L GE+  G + +TFR RSPV+   +ATC   I + D   P + NCP S+  +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI +         +  +  +P+
Sbjct:  700 PDIKEEKSFE----LDQ------TCPEGFQLADRLAEVEDGSACLDVDECETQDNFGCSHLCINTQGSAHCDCPSGWNLSNDGKACLDLDECSDNNFG--CSHRCINTEGSAYCACPS--GYVLDISNNKTCSDIDECSDQDLPNFGCSHHCINLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPEGYRLSETDAKTCQDIDECESVDQEAGHSCRATGGTCRNTLGSYECICPEGFRTTG-TACADIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NINGTCTDIDECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECATTSPC-DGICRNTVGSFECLCAEGFQINNNDQCVDTDECLNEPC-EGICINTQGSYSCSCELGYQLGDNGTCSDIDECLN-NPCPV--ECINSPGSYTCLCPFGYEFDDNVCKDVDE--CQKQPCGNLAKCINTEGSFTCQCEPGYILRGND---CEDVDECKENPC-NGICINLPGSYKCICDPGY---ELRNGRCEDIDECL--NYKCGGRCTNLPGTYRCDCESGYKL-EGERCVDIDECQ-TLKP---CKGSCVNLPGSYRCDCEAGY---RSEGNACIDIDECSHRNGGCSHICVNTIGSFRCTCNSGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLETDGRTCTELPPRCPKMKAPDHGEIECIQNLNHTQHRSREQEDEALIAENGRGDLGASGWSANRSPKSRSLYNSGSTCNVRCNKGYKLVGDFTVSCGRSGLWLG-EPATCIPLACPKLLAPDSGVLMPHTCSTGKTFAGQQCQVRCRAGYRLIGGGIYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQKRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNTITFRVRSPVS-DLTATCNFTIEIFDKEIPRMTNCPTSWTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQAGYHEIAYVAQDGAGNQAKCQFTIHVTSQTVHRDTSSPITKLPR 1724          

HSP 2 Score: 192.2 bits (487), Expect = 2.503e-45
Identity = 118/322 (36.65%), Postives = 158/322 (49.07%), Query Frame = 0
Query:  317 VDLLRLDASCIIQ-------FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKR---------------------CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQV-NNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI--QCLNKCMNVPGSAYCKCDSG 604
            VD   LD SC++           A  I H +  +Y  +       G  YA  +++C  GY F     D L+C + RW+G  P+C+  +T      +    +  + E++                      CE IC  D   T TC C+ G+ L  DG  C DVDEC  D   C+  C N+ G+Y C C  GF   S G  C+D NECLL NGHGPCQ  C+N  G Y+C C   PGTQL+  D HTC   + C + +N GCSH C+++    FC CPDGY L +DWKTC D++EC   D+   C   C+N  GS  C  + G
Sbjct:  241 VDFATLDQSCLVDADNSNSPIVPAPAIPHGSGIKYIRKRNKGPGGGNRYAAAVFQCSVGYQFVVPDADRLYCRQGRWVGPSPICIIPNTDHPDQDASSVSNNALTEREEESSNAGSYGNERSECGDDKGGCEQICD-DTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLA-ADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 3 Score: 108.612 bits (270), Expect = 6.736e-20
Identity = 77/199 (38.69%), Postives = 102/199 (51.26%), Query Frame = 0
Query:  614 NECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGH---GECINESPGYSCSCHSG 801
            +EC      C+  C +T G+A C C  G+ L  D T C D DEC +DNGGCE  C N +G++QC C  GF L ++   C D NEC +   +    G C NT GS+ C C   PG +L  D  +C D++EC+     G S +C N  GT  C C  GY+  +   TC D++EC     G    G CIN    + CS   G
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 4 Score: 103.219 bits (256), Expect = 3.548e-18
Identity = 75/192 (39.06%), Postives = 91/192 (47.40%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDL--ICDHNCINTEGSAHCTC--KAGFDLM-DETECFDKDECEM-DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC 719
            C  + GGC   C  +     CLC  GY L +D  TC D++EC   +  C   C+N  GS  C C SG+     G  C D NEC  ++    C   C NT GS  C+C  + G  L  D   C D DEC + DN GC   C N  GT  C C  G+ L  D  TC D +EC +        G CINT GSF C
Sbjct:  364 CGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 5 Score: 88.9669 bits (219), Expect = 6.113e-14
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 0
Query:  827 CNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCET--GFALSEILPNTCEDINECAL-NNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            C++  G+  C C  GY        C D++E +++   C   G CVN  GS++C C  GF    N    CID +ECL      PC    C+NT G +EC C+   G  L+    +TCED++EC+L +N  CS  C+N LG+ +C C +GY   D+   C   DEC L       C   CIN  G  +C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGC--EGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAAD-GHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECEL-EDVGQACAGTCINTIGSFRC 555          

HSP 6 Score: 86.2705 bits (212), Expect = 4.393e-13
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 0
Query:  938 NECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSV-NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC--------KPIGGICSSAPRPSNGYYRCNKK 1127
            +EC  + G C Q+C +  G+  C CY GY   + G  C   DEC +    NGGC+  C+N  G  +C C+ G+ + S   + C+D NEC + NG   CQ  C N  G + CSC    +P  +   +   C     CS+ +N GCSH C +T       C CP G+ L  D +TC        + +G  C+     + G +RC+++
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTID---NGGCEGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPCQGTCRNTHGSYECSCDE--RPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAF--CTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEE 558          

HSP 7 Score: 85.8853 bits (211), Expect = 5.951e-13
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 0
Query:  909 CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECN--PGYIVDSQDPRLCVDKNECTI-NNGGCQHACINKLGGHTCSCHLGF 1051
            C +T G   CLC  G+ L++    TC D++EC ++NG C   CVN  GS+ C C  G++    G  C   +EC L R  +G CQ  C N  G  +C C+  PG  + + D   C D +EC++ +N GC H C+N LG   C+C  G+
Sbjct:  375 CDDTSGTATCLCYRGYVLAQD-GTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLL-RNGHGPCQGTCRNTHGSYECSCDERPGTQL-AADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGY 518          

HSP 8 Score: 80.4925 bits (197), Expect = 2.896e-11
Identity = 68/184 (36.96%), Postives = 88/184 (47.83%), Query Frame = 0
Query:  787 CINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC-HQGFIHDQNDSNICIDFDECLSSP---CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHYC 960
            C + S   +C C+ GYV   +   C D DEC  DN  G  G C N+ GS+ C C+ G+    NG  C D NE  L        G C N  GS+EC C  +       D + C D DEC       C H+ C NTLG   C C  G+ L +    TCED++EC L +    C+  C+N +GS  C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNG-GCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHT-CLNTLGTAFCTCPDGYMLGDDW-KTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 9 Score: 79.337 bits (194), Expect = 5.634e-11
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 0
Query:  710 CINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RN---PCGHGECINESPGYSCSCH----SGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFEC 877
            C +T G+  C C+ G+ L +D  +C D++ECT       G+C N +G+Y+C C SG+    +   C+D NEC+ RN   PC  G C N    Y CSC     +      + C D DEC   +  G    C N  G+  C C  GY   +    C D++E  LE       G C+N  GSF C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 10 Score: 76.6406 bits (187), Expect = 4.292e-10
Identity = 68/193 (35.23%), Postives = 92/193 (47.67%), Query Frame = 0
Query:  749 CNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDN---PCGVGGKCNNKPGSFDCDC--APGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFA 925
            C++  GT  C C  GY+     +TC D++EC I N    G C+N    Y C C SG+    N   C D++ECL  N   PC   G C N  GS++C C   PG +       C D++E SL  D  G    C+N  G+  C C  G++   +D   C D DEC    +   C  + C NT+G F C  E G +
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQ--GTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSL-GDNFGCSHTCLNTLGTAFCTCPDGYMLG-DDWKTCEDMDECELEDVGQACAGT-CINTIGSFRCSEEDGAS 562          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942368319|gb|JAN66089.1| (putative Fibrillin-2 [Daphnia magna])

HSP 1 Score: 590.882 bits (1522), Expect = 4.770e-176
Identity = 396/1056 (37.50%), Postives = 533/1056 (50.47%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLND------DGE-CEDVDEC-VDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ---VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCI-------NTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRC------------------------------------NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTI 1402
            PD++E+K  E    LD+       C +GF L D      DG  C DVDEC   D   C H+C N  G+  CDC  G+  ++ G AC+D++EC  NN    C   C N +G   C C    G  L   +N TC   + C    + N GCSH CI+      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+ECE+ D    H+C        NT GS  C C  GF     T C D DEC  +   C   C NL+G+++C C  GF     N TCTD +EC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC  ++ C  G C N  G++EC C  G+ I +N  C+D +EC+  PC  G CIN    YSCSC  GY   DN  C D DECL+ NPC V  +C N PGS+ C C  GYEF +  C D++E   +K PCG    C+N +GSF C C  G+I   ND   C D DEC  +PC +  C N  G ++C+C+ G+   E+    CEDI+EC   N  C   C N+ G++ C C  GYK  E   C   DEC+ + +P   C+  C+N+PG  +C+C  GY     +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+TD RTC  +   C     P +G   C                                       K    +  G+ C ++C KG+   G  T  C  +G W G E   C  + CP L    +G + P TC T  +  G +C   C  GY++ G     C    +W R    P +C    +  P I CP +M   LP   K  YV   +P++N++W RYVDSDP+WA  L GE+  G + +TFR RSPV+   +ATC   I + D   P + NCP S+  +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI
Sbjct:  700 PDIKEEKSFE----LDQ------TCPEGFQLADRLAEVEDGSACLDVDECETQDNFGCSHLCINTQGSAHCDCPSGWNLSNDGKACLDLDECSDNNFG--CSHRCINTEGSAYCACPS--GYVLDISNNKTCSDIDECSDQDLPNFGCSHHCINLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPEGYRLSETDAKTCQDIDECESVDQEAGHSCRATGGTCRNTLGSYECICPEGFRTTG-TACADIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NINGTCTDIDECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECATTSPC-DGICRNTVGSFECLCAEGFQINNNDQCVDTDECLNEPC-EGICINTQGSYSCSCELGYQLGDNGTCSDIDECLN-NPCPV--ECINSPGSYTCLCPFGYEFDDNVCKDVDE--CQKQPCGNLAKCINTEGSFTCQCEPGYILRGND---CEDVDECKENPC-NGICINLPGSYKCICDPGY---ELRNGRCEDIDECL--NYKCGGRCTNLPGTYRCDCESGYKL-EGERCVDIDECQ-TLKP---CKGSCVNLPGSYRCDCEAGY---RSEGNACIDIDECSHRNGGCSHICVNTIGSFRCTCNSGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLETDGRTCTELPPRCPKMKAPDHGEIECIQNLNHTQHRSREQEDEALIAENGRGDLGASGWSANRSPKSRSLYNSGSTCNVRCNKGYKLVGDFTVSCGRSGLWLG-EPATCIPLACPKLLAPDSGVLMPHTCSTGKTFAGQQCQVRCRAGYRLIGGGIYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQKRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNTITFRVRSPVS-DLTATCNFTIEIFDKEIPRMTNCPTSWTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQAGYHEIAYVAQDGAGNQAKCQFTI 1704          

HSP 2 Score: 192.586 bits (488), Expect = 1.791e-45
Identity = 118/322 (36.65%), Postives = 158/322 (49.07%), Query Frame = 0
Query:  317 VDLLRLDASCIIQ-------FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKR---------------------CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQV-NNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI--QCLNKCMNVPGSAYCKCDSG 604
            VD   LD SC++           A  I H +  +Y  +       G  YA  +++C  GY F     D L+C + RW+G  P+C+  +T      +    +  + E++                      CE IC  D   T TC C+ G+ L  DG  C DVDEC  D   C+  C N+ G+Y C C  GF   S G  C+D NECLL NGHGPCQ  C+N  G Y+C C   PGTQL+  D HTC   + C + +N GCSH C+++    FC CPDGY L +DWKTC D++EC   D+   C   C+N  GS  C  + G
Sbjct:  241 VDFATLDQSCLVDADNSNSPIVPAPAIPHGSGIKYIRKRNKGPGGGNRYAAAVFQCSVGYQFVVPDADRLYCRQGRWVGPSPICIIPNTDHPDQDASSVSNNALTEREEESSNAGSYGNERSECGDDKGGCEQICD-DTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLA-ADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 3 Score: 109.383 bits (272), Expect = 4.266e-20
Identity = 77/199 (38.69%), Postives = 102/199 (51.26%), Query Frame = 0
Query:  614 NECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGH---GECINESPGYSCSCHSG 801
            +EC      C+  C +T G+A C C  G+ L  D T C D DEC +DNGGCE  C N +G++QC C  GF L ++   C D NEC +   +    G C NT GS+ C C   PG +L  D  +C D++EC+     G S +C N  GT  C C  GY+  +   TC D++EC     G    G CIN    + CS   G
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 4 Score: 103.605 bits (257), Expect = 2.462e-18
Identity = 75/192 (39.06%), Postives = 91/192 (47.40%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDL--ICDHNCINTEGSAHCTC--KAGFDLM-DETECFDKDECEM-DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC 719
            C  + GGC   C  +     CLC  GY L +D  TC D++EC   +  C   C+N  GS  C C SG+     G  C D NEC  ++    C   C NT GS  C+C  + G  L  D   C D DEC + DN GC   C N  GT  C C  G+ L  D  TC D +EC +        G CINT GSF C
Sbjct:  364 CGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 5 Score: 89.3521 bits (220), Expect = 5.359e-14
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 0
Query:  827 CNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCET--GFALSEILPNTCEDINECAL-NNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            C++  G+  C C  GY        C D++E +++   C   G CVN  GS++C C  GF    N    CID +ECL      PC    C+NT G +EC C+   G  L+    +TCED++EC+L +N  CS  C+N LG+ +C C +GY   D+   C   DEC L       C   CIN  G  +C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGC--EGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAAD-GHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECEL-EDVGQACAGTCINTIGSFRC 555          

HSP 6 Score: 86.2705 bits (212), Expect = 4.332e-13
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 0
Query:  938 NECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSV-NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC--------KPIGGICSSAPRPSNGYYRCNKK 1127
            +EC  + G C Q+C +  G+  C CY GY   + G  C   DEC +    NGGC+  C+N  G  +C C+ G+ + S   + C+D NEC + NG   CQ  C N  G + CSC    +P  +   +   C     CS+ +N GCSH C +T       C CP G+ L  D +TC        + +G  C+     + G +RC+++
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTID---NGGCEGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPCQGTCRNTHGSYECSCDE--RPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAF--CTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEE 558          

HSP 7 Score: 85.8853 bits (211), Expect = 5.438e-13
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 0
Query:  909 CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECN--PGYIVDSQDPRLCVDKNECTI-NNGGCQHACINKLGGHTCSCHLGF 1051
            C +T G   CLC  G+ L++    TC D++EC ++NG C   CVN  GS+ C C  G++    G  C   +EC L R  +G CQ  C N  G  +C C+  PG  + + D   C D +EC++ +N GC H C+N LG   C+C  G+
Sbjct:  375 CDDTSGTATCLCYRGYVLAQD-GTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLL-RNGHGPCQGTCRNTHGSYECSCDERPGTQL-AADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGY 518          

HSP 8 Score: 80.4925 bits (197), Expect = 2.666e-11
Identity = 68/184 (36.96%), Postives = 88/184 (47.83%), Query Frame = 0
Query:  787 CINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC-HQGFIHDQNDSNICIDFDECLSSP---CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHYC 960
            C + S   +C C+ GYV   +   C D DEC  DN  G  G C N+ GS+ C C+ G+    NG  C D NE  L        G C N  GS+EC C  +       D + C D DEC       C H+ C NTLG   C C  G+ L +    TCED++EC L +    C+  C+N +GS  C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNG-GCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHT-CLNTLGTAFCTCPDGYMLGDDW-KTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 9 Score: 79.337 bits (194), Expect = 5.365e-11
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 0
Query:  710 CINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RN---PCGHGECINESPGYSCSCH----SGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFEC 877
            C +T G+  C C+ G+ L +D  +C D++ECT       G+C N +G+Y+C C SG+    +   C+D NEC+ RN   PC  G C N    Y CSC     +      + C D DEC   +  G    C N  G+  C C  GY   +    C D++E  LE       G C+N  GSF C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 10 Score: 76.6406 bits (187), Expect = 3.692e-10
Identity = 68/193 (35.23%), Postives = 92/193 (47.67%), Query Frame = 0
Query:  749 CNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDN---PCGVGGKCNNKPGSFDCDC--APGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFA 925
            C++  GT  C C  GY+     +TC D++EC I N    G C+N    Y C C SG+    N   C D++ECL  N   PC   G C N  GS++C C   PG +       C D++E SL  D  G    C+N  G+  C C  G++   +D   C D DEC    +   C  + C NT+G F C  E G +
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQ--GTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSL-GDNFGCSHTCLNTLGTAFCTCPDGYMLG-DDWKTCEDMDECELEDVGQACAGT-CINTIGSFRCSEEDGAS 562          
BLAST of EMLSAG00000000097 vs. nr
Match: gi|942363719|gb|JAN63789.1| (putative Fibrillin-2 [Daphnia magna])

HSP 1 Score: 588.571 bits (1516), Expect = 6.193e-176
Identity = 397/1076 (36.90%), Postives = 539/1076 (50.09%), Query Frame = 0
Query:  411 PDVQEKKRCEHICYLDKGVTPTCECHDGFFLND------DGE-CEDVDEC-VDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQ---VNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGY-----EGDDCSDINECETQDLICDHNCI-------NTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY-IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDN-VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRC------------------------------------NKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFN-RPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPK 1422
            PD++E+K  E    LD+       C +GF L D      DG  C DVDEC   D   C H+C N  G+  CDC  G+  ++ G AC+D++EC  NN    C   C N +G   C C    G  L   +N TC   + C    + N GCSH CI+      C C  GY+L  D KTC DI+EC   +  C ++C+N+ G   C+C  GY     +   C DI+ECE+ D    H+C        NT GS  C C  GF     T C D DEC  +   C   C NL+G+++C C  GF     N TCTD +EC  G+ +      C N PGS+ C+CHPG++L+ D C+DI+EC  ++ C  G C N  G++EC C  G+ I +N  C+D +EC+  PC  G CIN    YSCSC  GY   DN  C D DECL+ NPC V  +C N PGS+ C C  GYEF +  C D++E   +K PCG    C+N +GSF C C  G+I   ND   C D DEC  +PC +  C N  G ++C+C+ G+   E+    CEDI+EC   N  C   C N+ G++ C C  GYK  E   C   DEC+ + +P   C+  C+N+PG  +C+C  GY     +   C+D +EC+  NGGC H C+N +G   C+C+ GF    KN   CV    C  NNGGCS  C +T    H  C C   + L+TD RTC  +   C     P +G   C                                       K    +  G+ C ++C KG+   G  T  C  +G W G E   C  + CP L    +G + P TC T  +  G +C   C  GY++ G     C    +W R    P +C    +  P I CP +M   LP   K  YV   +P++N++W RYVDSDP+WA  L GE+  G + +TFR RSPV+   +ATC   I + D   P + NCP S+  +L PGQ  + ++WNEP F DNI+I  +  S  PG  F  G H+I Y A D  GN  +C+FTI +         +  +  +P+
Sbjct:  700 PDIKEEKSFE----LDQ------TCPEGFQLADRLAEVEDGSACLDVDECETQDNFGCSHLCINTQGSAHCDCPSGWNLSNDGKACLDLDECSDNNFG--CSHRCINTEGSAYCACPS--GYVLDISNNKTCSDIDECSDQDLPNFGCSHHCINLPGSAECKCTAGYKLRADQKTCKDIDECAKENGGCSHECVNLKGGMRCECPEGYRLSETDAKTCQDIDECESVDQEAGHSCRATGGTCRNTLGSYECICPEGFRTTG-TACADIDEC-AELSPCSTACTNLQGSYRCDCDDGFE--NINGTCTDIDECPNGVCD----QLCTNIPGSYICDCHPGYQLIGDVCIDIDECATTSPC-DGICRNTVGSFECLCAEGFQINNNDQCVDTDECLNEPC-EGICINTQGSYSCSCELGYQLGDNGTCSDIDECLN-NPCPV--ECINSPGSYTCLCPFGYEFDDNVCKDVDE--CQKQPCGNLAKCINTEGSFTCQCEPGYILRGND---CEDVDECKENPC-NGICINLPGSYKCICDPGY---ELRNGRCEDIDECL--NYKCGGRCTNLPGTYRCDCESGYKL-EGERCVDIDECQ-TLKP---CKGSCVNLPGSYRCDCEAGY---RSEGNACIDIDECSHRNGGCSHICVNTIGSFRCTCNSGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYH--CTCSDQYYLETDGRTCTELPPRCPKMKAPDHGEIECIQNLNHTQHRSREQEDEALIAENGRGDLGASGWSANRSPKSRSLYNSGSTCNVRCNKGYKLVGDFTVSCGRSGLWLG-EPATCIPLACPKLLAPDSGVLMPHTCSTGKTFAGQQCQVRCRAGYRLIGGGIYHCLPSQQW-RSPDEPARCERIDSPVPFIQCPGNMAVNLPAQQKRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNTITFRVRSPVS-DLTATCNFTIEIFDKEIPRMTNCPTSWTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREPGELFQAGYHEIAYVAQDGAGNQAKCQFTIHVTSQTVHRDTSSPITKLPR 1724          

HSP 2 Score: 191.815 bits (486), Expect = 2.837e-45
Identity = 118/322 (36.65%), Postives = 158/322 (49.07%), Query Frame = 0
Query:  317 VDLLRLDASCIIQ-------FTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKR---------------------CEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELCDHICTNKPGTYMCDCRLGF--TSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQV-NNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI--QCLNKCMNVPGSAYCKCDSG 604
            VD   LD SC++           A  I H +  +Y  +       G  YA  +++C  GY F     D L+C + RW+G  P+C+  +T      +    +  + E++                      CE IC  D   T TC C+ G+ L  DG  C DVDEC  D   C+  C N+ G+Y C C  GF   S G  C+D NECLL NGHGPCQ  C+N  G Y+C C   PGTQL+  D HTC   + C + +N GCSH C+++    FC CPDGY L +DWKTC D++EC   D+   C   C+N  GS  C  + G
Sbjct:  241 VDFATLDQSCLVDADNSNSPIVPAPAIPHGSGIKYIRKRNKGPGGGNRYAAAVFQCSVGYQFVVPDADRLYCRQGRWVGPSPICIIPNTDHPDQDASSVSNNALTEREEESSNAGSYGNERSECGDDKGGCEQICD-DTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLA-ADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 3 Score: 108.227 bits (269), Expect = 1.049e-19
Identity = 77/199 (38.69%), Postives = 102/199 (51.26%), Query Frame = 0
Query:  614 NECETQDLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC--HPGFELMED--SCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHN--STCLDINECIRNPCGH---GECINESPGYSCSCHSG 801
            +EC      C+  C +T G+A C C  G+ L  D T C D DEC +DNGGCE  C N +G++QC C  GF L ++   C D NEC +   +    G C NT GS+ C C   PG +L  D  +C D++EC+     G S +C N  GT  C C  GY+  +   TC D++EC     G    G CIN    + CS   G
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEEDG 560          

HSP 4 Score: 102.449 bits (254), Expect = 5.209e-18
Identity = 75/192 (39.06%), Postives = 91/192 (47.40%), Query Frame = 0
Query:  538 CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDL--ICDHNCINTEGSAHCTC--KAGFDLM-DETECFDKDECEM-DNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYC 719
            C  + GGC   C  +     CLC  GY L +D  TC D++EC   +  C   C+N  GS  C C SG+     G  C D NEC  ++    C   C NT GS  C+C  + G  L  D   C D DEC + DN GC   C N  GT  C C  G+ L  D  TC D +EC +        G CINT GSF C
Sbjct:  364 CGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 5 Score: 88.9669 bits (219), Expect = 7.782e-14
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 0
Query:  827 CNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECL----SSPCFHSECKNTLGGFECLCET--GFALSEILPNTCEDINECAL-NNGDCSQVCVNILGSHYCRCYEGYK-KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKC 1003
            C++  G+  C C  GY        C D++E +++   C   G CVN  GS++C C  GF    N    CID +ECL      PC    C+NT G +EC C+   G  L+    +TCED++EC+L +N  CS  C+N LG+ +C C +GY   D+   C   DEC L       C   CIN  G  +C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGC--EGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAAD-GHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECEL-EDVGQACAGTCINTIGSFRC 555          

HSP 6 Score: 86.2705 bits (212), Expect = 3.992e-13
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 0
Query:  938 NECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGG--CQHACINKLGGHTCSCHLGFKPDEK---NPEKCVKAKACSV-NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTC--------KPIGGICSSAPRPSNGYYRCNKK 1127
            +EC  + G C Q+C +  G+  C CY GY   + G  C   DEC +    NGGC+  C+N  G  +C C+ G+ + S   + C+D NEC + NG   CQ  C N  G + CSC    +P  +   +   C     CS+ +N GCSH C +T       C CP G+ L  D +TC        + +G  C+     + G +RC+++
Sbjct:  362 SECGDDKGGCEQICDDTSGTATCLCYRGYVLAQDGTTCTDVDECTID---NGGCEGTCVNRQGSYQCFCSSGFRLASNGKK-CIDHNECLLRNGHGPCQGTCRNTHGSYECSCDE--RPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAF--CTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRCSEE 558          

HSP 7 Score: 85.8853 bits (211), Expect = 6.347e-13
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 0
Query:  909 CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECN--PGYIVDSQDPRLCVDKNECTI-NNGGCQHACINKLGGHTCSCHLGF 1051
            C +T G   CLC  G+ L++    TC D++EC ++NG C   CVN  GS+ C C  G++    G  C   +EC L R  +G CQ  C N  G  +C C+  PG  + + D   C D +EC++ +N GC H C+N LG   C+C  G+
Sbjct:  375 CDDTSGTATCLCYRGYVLAQD-GTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLL-RNGHGPCQGTCRNTHGSYECSCDERPGTQL-AADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGY 518          

HSP 8 Score: 79.7221 bits (195), Expect = 4.952e-11
Identity = 68/184 (36.96%), Postives = 88/184 (47.83%), Query Frame = 0
Query:  787 CINESPGYSCSCHSGYVDVDN--VCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFK-NGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVC-HQGFIHDQNDSNICIDFDECLSSP---CFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNN--GDCSQVCVNILGSHYC 960
            C + S   +C C+ GYV   +   C D DEC  DN  G  G C N+ GS+ C C+ G+    NG  C D NE  L        G C N  GS+EC C  +       D + C D DEC       C H+ C NTLG   C C  G+ L +    TCED++EC L +    C+  C+N +GS  C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNG-GCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHT-CLNTLGTAFCTCPDGYMLGDDW-KTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 9 Score: 78.9518 bits (193), Expect = 8.564e-11
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 0
Query:  710 CINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI-RN---PCGHGECINESPGYSCSCH----SGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG--XCHDINEXSLEKDPCGPHGDCVNNDGSFEC 877
            C +T G+  C C+ G+ L +D  +C D++ECT       G+C N +G+Y+C C SG+    +   C+D NEC+ RN   PC  G C N    Y CSC     +      + C D DEC   +  G    C N  G+  C C  GY   +    C D++E  LE       G C+N  GSF C
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPC-QGTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSLGDNFGCSHTCLNTLGTAFCTCPDGYMLGDDWKTCEDMDECELEDVGQACAGTCINTIGSFRC 555          

HSP 10 Score: 75.8702 bits (185), Expect = 7.466e-10
Identity = 68/193 (35.23%), Postives = 92/193 (47.67%), Query Frame = 0
Query:  749 CNNLEGTYECKCDSGYIFHN--STCLDINEC-IRNPCGHGECINESPGYSCSCHSGYVDVDN--VCRDYDECLHDN---PCGVGGKCNNKPGSFDCDC--APGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC----LSSPCFHSECKNTLGGFECLCETGFA 925
            C++  GT  C C  GY+     +TC D++EC I N    G C+N    Y C C SG+    N   C D++ECL  N   PC   G C N  GS++C C   PG +       C D++E SL  D  G    C+N  G+  C C  G++   +D   C D DEC    +   C  + C NT+G F C  E G +
Sbjct:  375 CDDTSGTATCLCYRGYVLAQDGTTCTDVDECTIDNGGCEGTCVNRQGSYQCFCSSGFRLASNGKKCIDHNECLLRNGHGPCQ--GTCRNTHGSYECSCDERPGTQLAADGHTCEDLDECSL-GDNFGCSHTCLNTLGTAFCTCPDGYMLG-DDWKTCEDMDECELEDVGQACAGT-CINTIGSFRCSEEDGAS 562          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold651_size119386-snap-gene-0.25 (protein:Tk06042 transcript:maker-scaffold651_size119386-snap-gene-0.25-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_303147")

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 685/1523 (44.98%), Postives = 909/1523 (59.68%), Query Frame = 0
Query:  145 TTXESSTSPSPATTTTXLPTTTTKSTTTTSTTTTKSYSDYEYGSGRGFITDDEDFDLGSGDNNGLYDSEDLFPLISTSTTTKILTTATTRTTXASTTTTIATLTTSEVP-PVFKSLNNIFITDDEDLI-----DGSGFDLDYETSGSGYYVHEIEDIGNSSGEKKEQKARVQFYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRCEHICYLD-KGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEG---DDCSDINECETQDL-ICDHNCINTEGSAHCTCKAGFDLMDETE--CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLN-TDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECTNSTLCG-SGSCNNLEGTYECKCDSGYIFHNSTCLDINECIR-NPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS-SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN--CFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKP----IGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVF--VPKNGHKVSSSEEGLSYYNYHKLPSDHGLF------KCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRVDWELKRFIPDCSPVH-KSQLKSNCDAGWEYRSDEGICVACPPGMYRDSNISVLCQLCPKSYYSSKFASNTCNQCQRSYTTKGLGSRGYRHCYPNRSSFESRRGRKEYLLNKKRNKEKTGGLRFYKSWMS 1632
            TT E+S S S    +T  PT+TT+      T    S  +Y  GSG    TDDED  L    + G   S       S +T T   +T+   +T  +   T  +L   +V     +      +TDDEDL      DGSG D DYE S    + H+  DI  +   + + + R  FY   E D+LRLD SC+I+F EA  + HATIR YDHRV N ALPG+FYAEVLY+C+EG+     +   L+CSE  WIGKRP C    T E    +   C P  +++  CE +C LD  G  P C+CH G+ L  DG  C D+DEC  +   CDH+C NKPGT+MC+C  GF  QG  C+DINECLLNNGHGPCQD C N++GGY+C C  LPGT LS +DNHTC +   C+VNNGGCSHEC+ SY+QIFCLCP G++LD+DWKTC+DI+EC T  + C   C+N PGSA+C C  G++    +DC DI+EC   D+  C H C N+ GS  C C +GF +MDE E  C D DEC  +NG CE  C N EG   C C  G+ ++ +D  +C D +EC      CG +GDC N+ GSF C CH GF L    D+C D++EC+ S  C  SG C NL G+YEC+C  GY F + +C+DINEC+  NPC +G+C+N  PGY C C  G+   + +C D DEC  DNPCG  G+C N+ G + C+C  G+EF    C D++E  +E+  CG HGDC+N  GSF C CH GF  +  +   C+D DEC     C    C N +G FEC C  GF + E   + C DI+EC+ +NG C   CVN LGS+ C C +G++ +      C   DEC  S     GC Q C+N  G  +C C  GY VD +D + C+D NEC  +NGGC+H C+N  G   CSC  GF      P +C+    C V NGGCSH+C++ E     +C CP G+KLK D + CK     I   C SA RP +G  +CN++K +G F  GTKCKLKCR+G+ P+  + +KC+ + TW+G  D  CE + CP +PP+ NG   P TC   SSP G+KC F C  GY ++G + T+C+   +W+ +  + P C     +P I CP D  +PLP  + SVYV  P+P+TNV+W RYV++DP WA  LEGEM RGKHV+TFRARSP++    A CQM+IHV+D  PP V+ CP SF + L  G   KR++W EP F DN++IQHVMASFLPGH+FSEG H ++Y A+D DGN  RC FTIT+K            +    P     + S+ + L   + H++P  +         KC +VP L+NG+ +C +    Q G KC P+C++G+ FYQKFSSR P+Y+CN  RVDWE++RFIPDCSP   K   ++ C+ GWE RSD   CVACPPGM++  +   LCQLC K YYS  F S +C+QC   ++T+  GSR    C+  R S  +       LL ++R+++   G ++Y  W S
Sbjct:  139 TTLEASES-SDDEFSTHPPTSTTEILVEHPTHVPTSADEYS-GSG-DMETDDEDLLLS---DPGSGSSSQEEREESFTTVTSTTSTSRPWSTSTAWEATTPSLRVDQVGIDGERHQQPTVVTDDEDLYELNIDDGSGED-DYEVS----FDHQGVDIRPTISIEAQLELRNSFYILNEADILRLDTSCVIEFKEAPVVVHATIRGYDHRVENAALPGDFYAEVLYECEEGHELANPEIKRLYCSENDWIGKRPECQPIGTNEYGGLN---CRP--EDEADCEQLCALDSAGGEPMCQCHGGYVLQVDGRSCLDIDECAVENGGCDHLCINKPGTFMCECSKGFKVQGNYCIDINECLLNNGHGPCQDRCVNIEGGYECSCEDLPGTTLSKEDNHTCEATNGCRVNNGGCSHECLDSYSQIFCLCPTGFQLDKDWKTCLDIDECATLALNCSGICVNTPGSAHCDCSVGFKKNPENDCVDIDECVDSDIPPCSHECRNSLGSFDCACPSGF-VMDEEELICQDVDECLQENGQCEHRCINHEGGSHCECHAGYSIDPSDGRSCVDTDECISHPHPCGDHGDCFNSVGSFACHCHQGFRLDAANDTCQDVDECSESDPCQRSGECINLVGSYECECYHGYFFESGSCVDINECLLGNPCVNGDCVNMDPGYDCLCFRGFTSRNGMCEDQDECELDNPCGAHGECRNRQGDYMCECETGFEFDGHTCVDLDE-CVERSLCGEHGDCINLSGSFACRCHPGF--EATEQGSCVDIDECRDPQRCPTGTCINLVGSFECSCPPGFYVPEGSKD-CADIDECSADNGGCHHQCVNSLGSYACSCEDGFEVNPSNERLCVDHDECSSSL---AGCSQSCVNHLGSFQCGCFRGYRVDPEDSKSCLDINECLSSNGGCRHECVNNEGSFNCSCRSGFWTPPTEPSECLDLNECLVGNGGCSHLCENLEGSF--KCECPPGYKLKHDGKACKKIHENIDMACKSAQRPRHGGLKCNRRKRNGRFPVGTKCKLKCRRGYRPSRQMRKKCMADATWSG-PDATCEPLVCPAIPPVANGWAEPVTCQRGSSPVGTKCDFRCRPGYTLSGPEMTQCSGPGQWRNL-TSIPVCTTDVPKPFIICPADTTKPLPGSATSVYVMFPQPKTNVDWFRYVEADPPWAKQLEGEMTRGKHVLTFRARSPMS-HHVAACQMVIHVQDTEPPRVRRCPHSFEEILPRGHSSKRVTWTEPIFHDNVQIQHVMASFLPGHFFSEGRHHVLYTATDADGNKARCGFTITVKPAVPPPPRTSVGLHDRTPDLTPSLVSTSQSLG--SSHQIPPPNLAHQYSIPDKCHQVPQLDNGRMDCHDT---QIGKKCTPQCNAGHVFYQKFSSRAPTYLCNNFRVDWEIRRFIPDCSPTRDKRATEAECEPGWESRSD--TCVACPPGMFKARD-DRLCQLCAKGYYSETFGSVSCHQCPVHHSTRARGSRRSGMCHYQRPSPTNS------LLGRRRHRKYNLGFQYYNRWSS 1618          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold105_size367834-snap-gene-2.37 (protein:Tk10187 transcript:maker-scaffold105_size367834-snap-gene-2.37-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_303147")

HSP 1 Score: 574.318 bits (1479), Expect = 3.028e-178
Identity = 392/1112 (35.25%), Postives = 529/1112 (47.57%), Query Frame = 0
Query:  311 FYEKYEVDLLRLDASCIIQFTEAHPITHATIRRYDHRVPNPALPGEFYAEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEI--ADPSRPSCDPDVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI---QCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCIN---TEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIRNPCGHGECINESPGYSCSCHSG--YVDVDNVCRDYDECLHDNP--CGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKD-ERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISP-ETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDMIEPLPRDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGKHVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITL 1404
            FY+K+ VDL  LD SC  +     PI +  ++ Y   V N  LPG+ Y EV+Y CD G+ F  S    +FC ++ W+G +P C      +   A      CDP+      CEH C L  G TP C C++G+    D  C D+DEC D    C H C NKPGTY C+C  GF+  G+ C+DINEC+ NNGHGPCQD C N +GGY+C C GLPGT+L + D H C   + C  NNGGCSHEC  +Y Q FC+CP G++LDEDWKTCVD++EC T       C N C N  GS  C         + S++   ETQ L       +    E    C C  GF    +T C D DEC  D  G    C N + ++ C C PGF    D  TC D NEC      C   G C+N+ GSF C+C  G+E    SC D++EC  S +C +G C+N +G+++C C+ G+ +   T  C DI+EC    CG  +C N    + CSC     Y      C+  + C   NP  CG  G C      F+C C PG++     C D++E + ++  C    +C N+ GSF+C C  G+  + ND   CID DEC  L   C  + C NT G + C C  G+      P+ C  +  CA       Q C +      C C E      +   C  +   +L+     GC  +       ++C  +P                    N G      I +       C  GF P  +  +KC K  + S +NG C  +             CP             P+G      P        C+ + V    +   +CK  C++GF   G  + +C  N TW           N  P P   N    P E   T       K +      YQ T     R              P   P++ +P I+CPPD+   LP DS ++YV IP+P+TNVNW  +V S P WA +LEG++  GK ++TF+A SPV   ES +C   +HVKD +PP V NCP  F  YL  GQ  +++ W EP F DN+KI+HVMAS +PG    EG H ++Y ASD D N  +C FTI +
Sbjct:  411 FYKKHFVDLRVLDTSCDPKAVPPPPIANGGVQEY-QTVENVLLPGKQYHEVVYGCDPGFKFSESSLGHMFCQQQGWMGVQPYCEEDPNAQQSPAHNRLKDCDPN----HGCEHSCSLVDG-TPKCSCNEGYQPLGDTSCMDIDECADANGGCIHECINKPGTYTCECPKGFSPSGSDCLDINECVANNGHGPCQDTCINNEGGYECTCEGLPGTELQE-DGHKCSGVDLCADNNGGCSHECYTTYGQSFCMCPSGFKLDEDWKTCVDVDECATMSTVRKSCPNGCENTIGSFKCV--------EVSEMESVETQTLCNPGYAFDDTLNESEYTCDCVLGFRFDGQT-CVDVDECAKDPCGKNGECVNGDASYSCECSPGFSF--DGETCVDINECAEDEERCD-QGTCLNSEGSFECDCAKGYEFRAGSCFDVDEC-QSNICQNGECSNWDGSFDCNCNEGFQWSEETKQCEDIDECEHRMCGRAQCDNSIGSFKCSCRGNRVYSVALRRCQRLNPCKQ-NPELCGAHGYCEMVRNGFECHCDPGFQSNGTVCLDVDECATDQGGC--DHECKNSQGSFQCSCQIGYQINPNDPQSCIDVDECSELEDSCLQN-CINTDGSYRCTCSEGYQKDPEEPSNCLVVPTCA-------QECSHQCQEGVCACPESMVLGMDEATCIPEAPPKLN-----GCAPMKAEEGMSIQCSESP--------------------NQGAYGKGTICRG-----KCTTGFIPFGRLKQKCRKDGSWSGSNGTCQQV------------FCPP-----------LPLGSQVQVMPE------TCSTQDV----LVRQRCKFSCQEGFNLVGSRSTRCRRNQTWK---------YNGGP-PKCINAKRGPNELEFTTPKVTQPKSIGNYYEEYQPTSTPSYR-------------QPTSTPSYTQPYIYCPPDISRDLPSDSATLYVRIPQPKTNVNWYDFVKSTPDWAKNLEGQLPLGKTLITFQALSPVT-DESTSCSFTVHVKDTVPPRVYNCPNDFNVYLDEGQTKRQVFWEEPIFADNVKIKHVMASKMPGQLLGEGKHDVLYQASDDDSNQAKCRFTIKV 1404          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold426_size175065-snap-gene-0.43 (protein:Tk08646 transcript:maker-scaffold426_size175065-snap-gene-0.43-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_315775")

HSP 1 Score: 252.677 bits (644), Expect = 1.265e-67
Identity = 254/778 (32.65%), Postives = 346/778 (44.47%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFT--SQGTACVD--INECLLNNGHGPCQDECKNVDG---------------GYQCECGGLPGTQLSDK------------DNHTCIS-DEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYEG----DDCSDINECETQDLIC-DHNCINTEGSAHCTCKAGFDLM-DETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNS-TLCGSGSCNNLEGTYECKCDSGYIF--HNSTCLDINECI--RNPCGHGECINESPGYSCSCHSGYV-----DVDNVCRDYDECLHD-NPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFAL-SEILPNTCEDINECAL-----NNGDCSQV---------CVNILGSHYCRCYEGYKKDERGNCFLK---DECRLSRRPNGGCQQLC----------------INIPGGLKCE-------------CNPGYIVDSQDPRLCV-DKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGC-SHICKSTESGLHHRCMCPSGFKLKTDARTC 1104
            C+C  G    D   C D++EC  DP +C   IC N  G++ C C  G +  S GT+C+D  +  C L+   G C    KN+ G               G+QC     PG++   K            D + C++  + C+  NG C +  I SY+   C C  GY LDE+   CV+INEC      C N  C++VPG   C+CD G+E       C D+NEC+ Q  +C    CINT GS HC C  G +L  D   C D DEC +++G C   VC N+ G +QC C  GF       +C D +EC    +N G    C+NTPGS+ C C  GF L+ D  SC DINEC  +   C  G C N  G++ C C  G +     S+CLD++EC   +N C  G+C N    + C C  GY      +++  C D DECL +   C    +C N  GS+ C C  GY      C D+NE       C  H  CVN  GSF+CVC QG+     D   C D DEC   P  C +  C N  G F C C+ G+   ++     C D++EC +      NG+C  +         C N  GS+ C C         G   +    ++C L      G   +C                + +  G KCE             C  G      +  + + D NEC    G C++  C N  G + C+C  GFK D    E CV    C  N   C +  C + E G    C+CP G+ L +D + C
Sbjct:  474 CDCPQGMAKLDGKVCSDLNECTLDPSICQGGICINTEGSFKCRCPPGLSLDSSGTSCIDERVEPCYLDYRMGVCS---KNIGGFYKREHCCCSIGEAWGHQCLQCPRPGSETFAKLCPKGPGFVDHLDVNECLNYPDMCE--NGRCKNT-IGSYS---CRCNQGYALDENGVRCVNINECDIMFGVCGNGTCIDVPGGFTCECDQGFETTPMMQVCMDVNECQRQPGLCRGGRCINTPGSFHCECPRGHELSEDGKSCKDIDECGLNSGVCSNGVCENMMGAYQCICDEGFQQAGSGTSCIDIDECQE--SNGGCDDTCMNTPGSYSCTCSTGFMLLLDGRSCQDINECQETQNPCNGGKCLNTPGSFSCVCSGGLMMGPEGSSCLDLDECAINQNVCRDGKCENTLGSFKCLCDDGYSIKDPEELEEGCTDDDECLLNLYHCDPRAECQNTNGSYVCTCNQGYSGDGFDCQDVNECLTNNGGCDAHAQCVNIPGSFKCVCDQGYT---GDGYQCQDIDECSDDPTLCENGVCLNGQGSFSCECQMGYMHPAQDDTQACIDVDECLMLDNVCLNGECENLNGLSCQYGTCSNEDGSYLCECPPNMDLLPSGTGCVDQRLEQCYLHYNTTYGGYSVCGGPLGEEVSRSACCCSVGLAWGDKCEECPEIGSEEYALVCPGGKGFHPNEKTIILEDINECLEIKGICKNGRCSNTFGSYMCTCDHGFKLDFGQVE-CVDVDECVENPNACGTGQCVNIEGGFE--CICPEGYMLSSDGQEC 1234          

HSP 2 Score: 216.468 bits (550), Expect = 1.722e-56
Identity = 251/796 (31.53%), Postives = 337/796 (42.34%), Query Frame = 0
Query:  428 GVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGF--TSQGTACVDINEC-----LLNNGHGP------CQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH--ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGYE-------GDDCSDIN--EC--ETQDLICDH---------NCINTEGSAH------CTCKAGFDLMDE--TECFDKDECEMDNGGC-EQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMDINECTNSTLCGSGSCNNLEGTYECKCDSGY--IFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY--VDVDNVCRDYDECLHDNPCGVGGKC---NNKPGS------FDCDCAPGYEFKNG-----------------------XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRR---PNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHI-CKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSA-------PRPSNGY 1121
            G +  C C  GF L    + C D DEC+ +P +C +  C N  G+Y C C  GF  ++QG  C D++EC     +LN+          C++  CKN  G + CEC   P   +   D   C   + C  N   CS    C ++     C CP GY+L+    TC DINECVT +  C N  C N  G A C+C  G+E          C D    +C  E +  +C            C  T+G A       C C  G  ++D    +C D +EC      C    C+N++G F+C C  G+      + C D +EC      C     C N PGSF C C  G+ L  D   CMD+NEC +        C NL G++ C C  GY  I ++  C DINEC  NP  CG G C+N   GY C C  GY        C D  E         GG+C   N  P S       DC C  G  +                             DI+E     + C  +G C+N+ GS+ C+C +GF  D + + +C D +ECL    PC H EC+N  G + C C +G+ L+     TC DI+EC+     C   CVN  GS+ C C  G+ +     C   DEC        P G C+    N  G  KC C  GY +D      C+D NEC  +   C  A C N LG + C C  GF        +C     C   +  C +  C+++  G    C CPSG++       C      CS A       P  SNG+
Sbjct: 1415 GGSFQCVCDQGFVLTTSKDACVDRDECILNPTICGNGSCLNTQGSYRCQCHFGFQISAQGD-CEDVDECRIRQVILNDAFASLTRYDLCRNGRCKNTRGSFTCEC---PDGYMLSADGQNCQDTDEC-ANPAICSQPGACQNTMGSFICTCPPGYKLNLAGDTCGDINECVTIEGFCENGFCENQDGDAVCQCPEGWELTVDPSGRPRCVDARAEQCFNEYRGRLCSQPRSLTFTKPTCCCTKGQAWGANCEPCECPTGL-ILDPLGNQCIDDNECLTKPYICGNGTCSNVKGGFECECADGYAPGPRGI-CEDIDECREYGHQCAFR--CHNVPGSFRCICPFGYTLAPDGRHCMDLNECESEANACRYECKNLIGSFMCVCPEGYRKIGYSDDCEDINECADNPGICGQGRCLNIEGGYQCECLPGYEIAASGQECIDRREGFCFQKKVFGGRCPRPNLSPESTVLVTKADCCCTMGAAWGESCEICPSRGTGAFEELCMESGFGVYGQDIDECQTLPNLCA-NGQCINSMGSYRCICDRGFKPDTSKT-LCHDVNECLQRPGPCEH-ECQNAFGSYTCSCPSGYLLNSD-GRTCRDIDECSTGQHMCEHECVNTQGSYECICPPGFSQFGD-RCLDTDECVEQPGLCPPPGTCK----NTRGSFKCVCPRGYRLDGSG-TFCIDTNECDEDPARCDKAECKNSLGSYKCGCPEGFDL-HSYLNQCEDQNECQHESNPCGNARCQNSIGGF--ACTCPSGYQYNQALLICVQASLGCSQASCSFGCNPVGSNGF 2188          

HSP 3 Score: 213.001 bits (541), Expect = 2.096e-55
Identity = 230/746 (30.83%), Postives = 312/746 (41.82%), Query Frame = 0
Query:  445 GECEDVDECVDDPELCDH-ICTNKPGTYMCDCRLGFTSQGTA--CVDINECLLNNGHGPC--QDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE---GDDCSDINECETQ--------------DLICDHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQ--VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED-----SCMDIN--ECTN---STLCGSG--------SCNNLEGTY------ECKCDSGYIFH--NSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYV-DVDNVCRDYDECL-HDNPCGVGGKCNNKPGSFDCDCAPGYEFK--NGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSP--CFHSECKNTLGGFECLCETGFALS-----------------EILPNTCEDIN------------ECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTD 1100
            G   ++DEC+  P +C H  C N  G++ CDC LGFT    +  C+D NEC  N G   C     C N  G Y+C C   PG +L D     C+  + C  N   C + +C +      C+C  G+ L      CVD +EC+     C N  C+N  GS  C+C  G++     DC D++EC  +              DL  +  C NT GS  C C  G+ L  D   C D DEC  +   C Q   C N  G+F C C PG+ LN    TC D NEC      C   G C N  G   C+C  G+EL  D      C+D    +C N     LC           +C   +G         C+C +G I     + C+D NEC+  P  CG+G C N   G+ C C  GY      +C D DEC  + + C    +C+N PGSF C C  GY        C D+NE   E + C    +C N  GSF CVC +G+      S+ C D +EC  +P  C    C N  GG++C C  G+ ++                 ++    C   N            +C    G        I  S     +E    +     + +D       PN      CIN  G  +C C+ G+  D+    LC D NEC    G C+H C N  G +TCSC  G+  +  +   C     CS     C H C +T+    + C+CP GF    D
Sbjct: 1305 GTTHEIDECLMMPGMCQHGTCMNTMGSFTCDCDLGFTYDEASHQCIDTNECNYN-GAAACFGNSRCVNTQGSYECVC--PPGYKL-DHSGRDCLDVDECSENFNICRNGQCTNIGGSFQCVCDQGFVLTTSKDACVDRDECILNPTICGNGSCLNTQGSYRCQCHFGFQISAQGDCEDVDECRIRQVILNDAFASLTRYDLCRNGRCKNTRGSFTCECPDGYMLSADGQNCQDTDEC-ANPAICSQPGACQNTMGSFICTCPPGYKLNLAGDTCGDINECVTIEGFC-ENGFCENQDGDAVCQCPEGWELTVDPSGRPRCVDARAEQCFNEYRGRLCSQPRSLTFTKPTCCCTKGQAWGANCEPCECPTGLILDPLGNQCIDDNECLTKPYICGNGTCSNVKGGFECECADGYAPGPRGICEDIDECREYGHQCAF--RCHNVPGSFRCICPFGYTLAPDGRHCMDLNECESEANAC--RYECKNLIGSFMCVCPEGY-RKIGYSDDCEDINECADNPGICGQGRCLNIEGGYQCECLPGYEIAASGQECIDRREGFCFQKKVFGGRCPRPNLSPESTVLVTKADCCCTMGAAWGESCEICPSRGTGAFEELCMESGFGVYGQDIDECQTLPNLCANGQCINSMGSYRCICDRGFKPDTSK-TLCHDVNECLQRPGPCEHECQNAFGSYTCSCPSGYLLN-SDGRTCRDIDECSTGQHMCEHECVNTQG--SYECICPPGFSQFGD 2035          

HSP 4 Score: 206.453 bits (524), Expect = 2.136e-53
Identity = 246/841 (29.25%), Postives = 343/841 (40.78%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLG--FTSQGTACVDINECLLNN--GHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETE---------CFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTC-------------------------TDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINEC-TNSTLCGSGSCNNLEGTYECKCDSGYIFHNST--CLDINECIR---NPCGHGECINESPGYSCSCHSGYV--DVDNVCRD------------YDECLHDNP---------CGV----GGKCNNKPGSFDCDCAPGYEFKNGX-CHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF----HSECKNTLGGF----ECLCETGFAL-----------SEILPNTCE---------DINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVD-----------------------------------------SQDPRLCVDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNG 1120
            CEC  G+     G C D++EC++  +     C N PG + C C  G   +  G AC+D NEC  +    HG    +C N  G ++C+C    G +LS     +C+  + C  N   C    C ++     C C  GY    D   C+D NEC T D  C N +C+N+ G   C CD GYE    G  C DINEC +      H C NTEG   C C +GF L  +           C+D        G C    +N+     C C  G  +    + C                          D NEC      C   G C N  G++ C C+PG+E+  +   C+D++EC  N  LC  G C N  G+Y+C C  G  F+ ++  C D +EC +     C +G C+N    Y+C C+ G V       C D             ++C ++ P         C V    G  C     + DCDC  G    +G  C D+NE +L+   C   G C+N +GSF+C C  G   D + ++ CID       PC+       C   +GGF     C C  G A            SE     C          D+NEC LN  D  +   C N +GS+ CRC +GY  DE G  C   +EC +     G     CI++PGG  CEC+ G+                                            S+D + C D +EC +N+G C +  C N +G + C C  GF+    +   C+    C  +NGGC   C +T     + C C +GF L  D R+C+ I   C     P NG
Sbjct:    7 CECEVGYQNAPTGSCVDINECLEG-KCQGGRCRNSPGGFDCQCPPGMHLSQDGLACIDHNECEQSGFCAHG----QCINAMGSFKCKC--HEGFELS-SSGLSCVDIDECLENPRICLRGRCRNTPGAYVCECEGGYMHSSDGGFCMDENEC-THDHMCENGQCINMEGGFKCVCDPGYELARNGKTCVDINECRSNPCRNGH-CTNTEGGFQCECHSGFSLGPDGRTCSDSVMGPCYDI----FRYGQCSNPSSNMVSKSSCCCNTGMVIQGWGMPCQSCPFPGSMEFKDLCPHGSGFTNSGNDINECAQNKDICA-NGACENLIGAYRCICNPGYEIDPLGKQCVDVDECKINHLLCAGGQCKNTPGSYQCDCPPGTKFNPASNICEDEDECQQLGDAACANGRCLNTKGSYTCECNPGSVLDSSGRFCLDNRRGSCWTKMNNANQCENNLPTTTTKSECCCSVGVAWGSPCEKCDQALDCDCPQGMAKLDGKVCSDLNECTLDPSIC-QGGICINTEGSFKCRCPPGLSLDSSGTS-CIDE---RVEPCYLDYRMGVCSKNIGGFYKREHCCCSIGEAWGHQCLQCPRPGSETFAKLCPKGPGFVDHLDVNEC-LNYPDMCENGRCKNTIGSYSCRCNQGYALDENGVRCVNINECDIMFGVCG--NGTCIDVPGGFTCECDQGFETTPMMQVCMDVNECQRQPGLCRGGRCINTPGSFHCECPRGHELSEDGKSCKDIDECGLNSGVCSNGVCENMMGAYQCICDEGFQ-QAGSGTSCIDIDECQESNGGCDDTCMNTPG--SYSCTCSTGFMLLLDGRSCQDI-NECQETQNPCNG 820          

HSP 5 Score: 204.912 bits (520), Expect = 5.468e-53
Identity = 226/751 (30.09%), Postives = 337/751 (44.87%), Query Frame = 0
Query:  412 DVQEKKRCEHICYLDKGVTPTCECHDGFFLNDDG-ECEDVDECVDDPELC-DHICTNKPGTYMCDCRLGF--TSQGTACVDINEC----LLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI----QCLNKCMNVPGSAYCKCDSG--------------YEG-----DDC----------SDINEC-ETQDLICDHNCINTEGSAHCTCKAGFDLMD-ETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECT-IGIANCGIYGDCINTPGSFYCECHPGFELMEDS--CMD------------INECTNST---------LCGSG-----SCNNLEGTYECKCDSGYI-FHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVG---GKCNNKPGSF----DCDCA--------------PGYEFKNGXC---------HDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDEC--LSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERG-NCFLKDECRLSRRPNGGCQQ-LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF 1051
            + ++   C H   ++   +  C+CH+GF L+  G  C D+DEC+++P +C    C N PG Y+C+C  G+  +S G  C+D NEC    +  NG      +C N++GG++C C   PG +L+ ++  TC+    C+ N     H C ++     C C  G+ L  D +TC D       DI    QC N   N+   + C C++G              + G     D C          +DINEC + +D+  +  C N  G+  C C  G+++     +C D DEC++++  C    C N  G++QC C PG   N  +  C DE+EC  +G A C   G C+NT GS+ CEC+PG  L      C+D             N+C N+           C  G      C   +   +C C  G        C D+NEC  +P  C  G CIN    + C C  G     +     DE     PC +    G C+   G F     C C+              PG E     C          D+NE     D C  +G C N  GS+ C C+QG+  D+N    C++ +EC  +   C +  C +  GGF C C+ GF  + ++   C D+NEC    G C    C+N  GS +C C  G++  E G +C   DEC L+   +G C   +C N+ G  +C C+ G+   +     C+D +EC  +NGGC   C+N  G ++C+C  GF
Sbjct:   66 ECEQSGFCAHGQCINAMGSFKCKCHEGFELSSSGLSCVDIDECLENPRICLRGRCRNTPGAYVCECEGGYMHSSDGGFCMDENECTHDHMCENG------QCINMEGGFKCVCD--PGYELA-RNGKTCVDINECRSNPCRNGH-CTNTEGGFQCECHSGFSLGPDGRTCSDSVMGPCYDIFRYGQCSNPSSNMVSKSSCCCNTGMVIQGWGMPCQSCPFPGSMEFKDLCPHGSGFTNSGNDINECAQNKDICANGACENLIGAYRCICNPGYEIDPLGKQCVDVDECKINHLLCAGGQCKNTPGSYQCDCPPGTKFNPASNICEDEDECQQLGDAACA-NGRCLNTKGSYTCECNPGSVLDSSGRFCLDNRRGSCWTKMNNANQCENNLPTTTTKSECCCSVGVAWGSPCEKCDQALDCDCPQGMAKLDGKVCSDLNECTLDPSICQGGICINTEGSFKCRCPPGLSLDSSGTSCIDE--RVEPCYLDYRMGVCSKNIGGFYKREHCCCSIGEAWGHQCLQCPRPGSETFAKLCPKGPGFVDHLDVNECLNYPDMC-ENGRCKNTIGSYSCRCNQGYALDENGVR-CVNINECDIMFGVCGNGTCIDVPGGFTCECDQGFETTPMM-QVCMDVNECQRQPGLCRGGRCINTPGSFHCECPRGHELSEDGKSCKDIDECGLN---SGVCSNGVCENMMGAYQCICDEGF-QQAGSGTSCIDIDECQESNGGCDDTCMNTPGSYSCTCSTGF 796          

HSP 6 Score: 199.904 bits (507), Expect = 1.897e-51
Identity = 233/795 (29.31%), Postives = 330/795 (41.51%), Query Frame = 0
Query:  432 TCECHDGFFLNDDGE-CEDVDECVDDPELC-DHICTNKPGTYMCDCRLGFTSQG-----TACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH--ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNK-CMNVPGSAYCKCDSGY------EGDDCSDINECETQDLICDHN--------------CINTEGSAHCTCKAGFDLMDE-TECFDK--DECEMDNG---GCEQVCNNLEG-------------------------------TFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL--MEDSCMDINECT-NSTLCGSGSCNNLEGTYECKCDSGYIFHN--STCLDINE--CIRN----------------------------PCGHGECINESPGYSCSCHSG----YVD-VDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGX--CHDINEXSLE-KDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLS--SPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSR-----------RPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQH--ACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTD 1100
            +C C  G  +  +G  C D+DEC  +  +C D  C N  G++ C C  G++ +        C D +ECLLN  H   + EC+N +G Y C C      Q    D   C     C  NNGGC    +C++      C+C  GY    D   C DI+EC      C N  C+N  GS  C+C  GY      +   C D++EC   D +C +               C N +GS  C C    DL+   T C D+  ++C +      G   VC    G                                  C    GFH N   +   D NEC + I      G C NT GS+ C C  GF+L   +  C+D++EC  N   CG+G C N+EG +EC C  GY+  +    C D+ +  C  +                            P   G  +  +P Y   C +G     +D +     + DECL        G C N  GSF CDC  G+ +      C D NE +      C  +  CVN  GS+ECVC  G+  D +  + C+D DEC    + C + +C N  G F+C+C+ GF L+    + C D +EC LN   C    C+N  GS+ C+C+ G++   +G+C   DECR+ +           R +      C N  G   CEC  GY++ S D + C D +EC  N   C    AC N +G   C+C  G+K +    + C     C    G C +     + G    C CP G++L  D
Sbjct:  831 SCVCSGGLMMGPEGSSCLDLDECAINQNVCRDGKCENTLGSFKCLCDDGYSIKDPEELEEGCTDDDECLLNLYHCDPRAECQNTNGSYVCTC-----NQGYSGDGFDCQDVNECLTNNGGCDAHAQCVNIPGSFKCVCDQGYT--GDGYQCQDIDECSDDPTLCENGVCLNGQGSFSCECQMGYMHPAQDDTQACIDVDECLMLDNVCLNGECENLNGLSCQYGTCSNEDGSYLCECPPNMDLLPSGTGCVDQRLEQCYLHYNTTYGGYSVCGGPLGEEVSRSACCCSVGLAWGDKCEECPEIGSEEYALVCPGGKGFHPNEKTIILEDINEC-LEIKGICKNGRCSNTFGSYMCTCDHGFKLDFGQVECVDVDECVENPNACGTGQCVNIEGGFECICPEGYMLSSDGQECFDMRKEMCFMHFSEANCSKPMSRPQTKVVCCCSMGQGWGPTCEGCPVPGTPLYQDLCGNGSPGMIIDPISGTTHEIDECLMMPGMCQHGTCMNTMGSFTCDCDLGFTYDEASHQCIDTNECNYNGAAACFGNSRCVNTQGSYECVCPPGYKLDHSGRD-CLDVDECSENFNICRNGQCTNIGGSFQCVCDQGFVLT-TSKDACVDRDECILNPTICGNGSCLNTQGSYRCQCHFGFQISAQGDCEDVDECRIRQVILNDAFASLTRYDLCRNGRCKNTRGSFTCECPDGYML-SADGQNCQDTDECA-NPAICSQPGACQNTMGSFICTCPPGYKLNLAG-DTCGDINECVTIEGFCENGFCENQDG-DAVCQCPEGWELTVD 1611          

HSP 7 Score: 190.66 bits (483), Expect = 1.357e-48
Identity = 226/741 (30.50%), Postives = 306/741 (41.30%), Query Frame = 0
Query:  470 TYMCDCRLGFTSQGT-ACVDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE----GDDCSDINECETQDLICDHN-CINTEGSAHCTCKAGF-DLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDS----------CMDI---NECTN---------STLCGSG-----------SCNNLEGTYECK--CDSGYIFHNSTCLDINECIRNP--CGHGECINESPGYSCSCHSGY-VD-VDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF--KNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICID--FDECLSSPCFHSECKNTL----GGFECLCETGFA-------------------LSEILPNTCEDINECALNNGDC-SQVCVNILGSHYCRCYEGYKKDERGNCFLKDE---CRLSRRPNGGCQQLCINIPGGLK---CECNPGYIVDSQ-----------DPRLC---------VDKNECTINNGGCQHA-CINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-ICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107
            +Y C+C +G+ +  T +CVDINECL     G CQ   C+N  GG+ C+                                            CP G  L +D   C+D NEC         +C+N  GS  CKC  G+E    G  C DI+EC     IC    C NT G+  C C+ G+    D   C D++EC  D+      C N+EG F+C C PG+ L  +  TC D NEC    +N    G C NT G F CECH GF L  D           C DI    +C+N         S  C +G           SC    G+ E K  C  G  F NS   DINEC +N   C +G C N    Y C C+ GY +D +   C D DEC  ++    GG+C N PGS+ CDC PG +F   +  C D +E     D    +G C+N  GS+ C C+ G + D +    C+D     C +     ++C+N L       EC C  G A                   ++++    C D+NEC L+   C   +C+N  GS  CRC  G   D  G   + +    C L  R  G C +   NI G  K   C C+ G     Q             +LC         +D NEC      C++  C N +G ++C C+ G+  DE N  +CV    C +  G C +  C     G    C C  GF+     + C  +
Sbjct:    4 SYQCECEVGYQNAPTGSCVDINECL----EGKCQGGRCRNSPGGFDCQ--------------------------------------------CPPGMHLSQDGLACIDHNECEQSGFCAHGQCINAMGSFKCKCHEGFELSSSGLSCVDIDECLENPRICLRGRCRNTPGAYVCECEGGYMHSSDGGFCMDENECTHDHMCENGQCINMEGGFKCVCDPGYELARNGKTCVDINECR---SNPCRNGHCTNTEGGFQCECHSGFSLGPDGRTCSDSVMGPCYDIFRYGQCSNPSSNMVSKSSCCCNTGMVIQGWGMPCQSC-PFPGSMEFKDLCPHGSGFTNSG-NDINECAQNKDICANGACENLIGAYRCICNPGYEIDPLGKQCVDVDECKINHLLCAGGQCKNTPGSYQCDCPPGTKFNPASNICEDEDECQQLGDAACANGRCLNTKGSYTCECNPGSVLDSS-GRFCLDNRRGSCWTKMNNANQCENNLPTTTTKSECCCSVGVAWGSPCEKCDQALDCDCPQGMAKLDGKVCSDLNECTLDPSICQGGICINTEGSFKCRCPPGLSLDSSGTSCIDERVEPCYLDYR-MGVCSK---NIGGFYKREHCCCSIGEAWGHQCLQCPRPGSETFAKLCPKGPGFVDHLDVNECLNYPDMCENGRCKNTIGSYSCRCNQGYALDE-NGVRCVNINECDIMFGVCGNGTCIDVPGGF--TCECDQGFETTPMMQVCMDV 683          

HSP 8 Score: 122.094 bits (305), Expect = 9.220e-28
Identity = 112/345 (32.46%), Postives = 153/345 (44.35%), Query Frame = 0
Query:  448 EDVDECVDDPELC-DHICTNKPGTYMCDCRLGFT--SQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYE--GDDCSDINECETQDLIC--DHNCINTEGSAHCTCKAGFDL-MDETECFDKDECEMDNGGCEQV-CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTL-CGSGSCN---NLEGT--YECKCDSGYI-FHNSTCLDINE 776
            +D+DEC   P LC +  C N  G+Y C C  GF   +  T C D+NE                                              C    G C HEC +++    C CP GY L+ D +TC DI+EC TG   C ++C+N  GS  C C  G+   GD C D +EC  Q  +C     C NT GS  C C  G+ L    T C D +EC+ D   C++  C N  G+++CGC  GF L++    C D+NEC      CG    C N+ G F C C  G++  +   +    C  ++L C   SC+   N  G+  + C C  GY    +S CL IN+
Sbjct: 1916 QDIDECQTLPNLCANGQCINSMGSYRCICDRGFKPDTSKTLCHDVNE----------------------------------------------CLQRPGPCEHECQNAFGSYTCSCPSGYLLNSDGRTCRDIDECSTGQHMCEHECVNTQGSYECICPPGFSQFGDRCLDTDECVEQPGLCPPPGTCKNTRGSFKCVCPRGYRLDGSGTFCIDTNECDEDPARCDKAECKNSLGSYKCGCPEGFDLHSYLNQCEDQNECQHESNPCG-NARCQNSIGGFACTCPSGYQYNQALLI----CVQASLGCSQASCSFGCNPVGSNGFSCGCPRGYQGIGSSHCLAIND 2209          

HSP 9 Score: 97.0561 bits (240), Expect = 3.784e-20
Identity = 71/197 (36.04%), Postives = 91/197 (46.19%), Query Frame = 0
Query:  413 VQEKKRCEHICYLDKGVTPTCECHDGFFLNDDGE-CEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSH-ECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYE 606
            +Q    CEH C    G + TC C  G+ LN DG  C D+DEC     +C+H C N  G+Y C C  GF+  G  C+D +EC+   G  P    CKN  G ++C C   P     D     CI    C  +   C   EC +S     C CP+G++L      C D NEC      C N +C N  G   C C SGY+
Sbjct: 1964 LQRPGPCEHECQNAFG-SYTCSCPSGYLLNSDGRTCRDIDECSTGQHMCEHECVNTQGSYECICPPGFSQFGDRCLDTDECVEQPGLCPPPGTCKNTRGSFKCVC---PRGYRLDGSGTFCIDTNECDEDPARCDKAECKNSLGSYKCGCPEGFDLHSYLNQCEDQNECQHESNPCGNARCQNSIGGFACTCPSGYQ 2156          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold642_size120736-snap-gene-0.27 (protein:Tk12598 transcript:maker-scaffold642_size120736-snap-gene-0.27-mRNA-1 annotation:"GH13743")

HSP 1 Score: 166.777 bits (421), Expect = 3.082e-41
Identity = 187/623 (30.02%), Postives = 273/623 (43.82%), Query Frame = 0
Query:  549 CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ--CLN--KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIG-----IANCGIYGDCINTPGSFYCECHPGFEL-MEDSCMDINECTNSTL--CGSGS-CNNLEGTYECKCDSGY----------IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLH-DNPCGVGGKCNNKPGSFDCDC------APGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQND-SNICIDFDECLSSPC------FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKD--------ERGNCFLKDECRLS----------RRPNGG--CQQLCIN----------IPGGLK-CECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFK 1096
            C ++    FC C +GYE   D   C DI+EC   ++   C+   +C N+P    CKC  G+EGD   +C DI+EC T + +C  N  CINT G+  C C  GF       C D DEC  +  G    C NL G +QC C  G   +     C  +   ++        +CG    C  +     C C  GF    + SC+DINEC +S+L  CG G+ C N    Y C+C +GY          +   +TC    +C  N     +C+   P  SC+C  G+     +C+D DEC   +NPCG    C N PG ++C C       P  +     C ++N        CG    C        C+C +G+ ++  + S+ C+D DEC  S         ++ C N+ G F C+C  GF     +   C DI+ECA N   C +  +C N +GS+ C+CY G + D        +R +C    EC  +          + P  G  C+  C +          +  GL  C+C PG+ + S + R C+D +EC  N  G    C N LG   C C  G   D  +  +      C+ ++      C   ES L  RC+C  G++
Sbjct:  127 CTNTLGSFFCSCNEGYE--GDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLT-NQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNN----AQCL---PNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVN--------CGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI--GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKL-SPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQ-----CDQGESCLSSRCVCRRGYE 723          

HSP 2 Score: 138.272 bits (347), Expect = 1.587e-32
Identity = 208/721 (28.85%), Postives = 269/721 (37.31%), Query Frame = 0
Query:  473 CDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDG--YELDEDWKTCVDINEC-----VTGDIQCLNKCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHN--CINTEGSAHCTCKAG--FDLMDETECFDKDECEMD----------NGGC-----------EQVCNNL-----------EGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPG--------------FELMEDS--------------------------CMDINECTNSTLCGSGS-CNNLEGTYECKCDSGYIFHNSTC-----------LDINECIRNPCGHGECIN-ESPGYS---------CSCHSGYVDVDNV--CRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPC------FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN---------CFLKDECRLSRRPNGG-CQQLCINIPGGLK-----------CECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF 1051
            C CR GF   G  C DI+EC            C NV G Y+C+C   L GT         C+     +VN G     C    ++ FC+C +G  Y   E    C+DI+EC      TG       C N PGS  C C  G+ GD    C DI+EC     IC     C N  GS  C C  G  +D    +    +  C+ D          NG C           E  C +             G   C C PGF L+ +  +C D +EC      CG    C N  GSF C+C  G              FE  +DS                          C+D+NEC    +CG  S C NL G+Y+C+C SG+  +  T            L   + I   C   +C N E+P            C+C  GY        C D DEC  +   PCG G  C N PGSF C C PG   +   G C  +         C  + +C+      +C+C   F  D  D N C        SPC      F++EC  +    +CLC+ GF  + +    CED++ECALN      +C+N L ++ C C  G   D   N         C   DEC       G  C   C ++P G             C C  G+  DSQ    CV  + C     G    CI    G TC C  G 
Sbjct:  392 CACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCL-----EVNCGQ-RASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNP--CGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQG----KCICSPPFFVDTLDGNHC-------KSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPL--TGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQG--NCV--SLCNQVICGSNAQCIVSPSGPTCQCFEGM 1086          

HSP 3 Score: 115.546 bits (288), Expect = 1.119e-25
Identity = 228/910 (25.05%), Postives = 325/910 (35.71%), Query Frame = 0
Query:  359 AEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRC--EHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELC--DHICTNKPGTYMCDC---------RLGFTSQGTACVDINECLLN----NGHGPCQDECKNVDGGYQCECGGLPGTQLSDK-DNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDIN-----ECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDN-GGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTD--------------ENECTIG-IANCGIYGDCINTPGSF-YCECHPGFEL--MEDSCMDINEC--TNSTLCGSGS-CNNLEGTYECKCDSGY---------IFHNSTCLDINECIRN-PCGHGECINESPGY------------------------------SCSCHSGYV-DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY---EFKNG-------------XCHD---------INEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQN-------DSNICIDFDECLSSP------CFHSECKNTLGG---------------------------------------------FECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGS-HYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNP-EKCVKAKACSVNNGGCS-HICKSTESGLHHRCMCPSGFK 1096
            +E    C+EG+A++P +                  ++   L+I +     CD  +    +C    IC    G +  C C  GF  +    C D+DEC ++  +C  + +CTN+ G+Y C C          L    +  +C    EC+ N    NG   CQ+                 G    D   + TC  +  C V NG             FC C  G++L  + ++C+DI+EC          C N+ GS  CKC  G  GD  S        EC TQD  CD     +  S+ C C+ G++     +C D +EC + N  G   VC NL G++ C C  GF  N      +               E  C +   +NC     C+   G   YC C  G+E+     +C DI+EC     T CGSG+ C N  G++ C C  G          +   S C   ++C  N  C  G+CI   P +                               C C +G+  +    C D DEC   NPC  G  C NK  ++ C+C PG     + NG              CH          IN  S    PCG + +CV  + +  C C  GF  D         +  IC    +C+ SP      CF     N   G                                               C C++GF     L   C    + A  + +C      I G+ + C C  GY  +    C +            G   +C    G  +C C  GY  D      C D +EC  +  G    CIN  GG+ C CH  F     NP E CV  +A + ++  C+   C         +C+C SGFK
Sbjct:  468 SEAFCICEEGWAYNPKE------------------ISSGCLDIDE-----CDKSISPTGKCGVNAICSNSPG-SFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEP--------------YVGPNCEDACRDATCFPNSQCLVQNG-----------LPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFEC-TQDSQCDQG--ESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECAL-NPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCS--SVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTL--VCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGY--DGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFV---GNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFK 1315          

HSP 4 Score: 67.781 bits (164), Expect = 3.402e-11
Identity = 63/204 (30.88%), Postives = 79/204 (38.73%), Query Frame = 0
Query:  675 QCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC-------HPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYEC--KCDSGYIFHNSTCLDINE---------------------------CIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY 842
            QC C+PG+ +      C+D NEC   I  CG    C NTPGS+ C C         G     D C    +C ++  C + S   L G  +C   CD  Y    +TC  I                             C    CGHG C  E     C C  GY  + + C+D DEC   NPC    KC N+ GS+ C C  G 
Sbjct: 1843 QCSCQPGYEMTQSG--CSDLNECKNNI--CGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADS---LSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGM 2039          

HSP 5 Score: 53.5286 bits (127), Expect = 6.663e-7
Identity = 156/632 (24.68%), Postives = 224/632 (35.44%), Query Frame = 0
Query:  431 PTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFT----------SQGTACVDINEC--LLNNGHGPCQDECKNVDGGYQCECGG-------LPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLC---------PDGYELD----------EDWKTCVDINECVT--GDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAH-----CTCKAGFDLMDETEC---FDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELME-DSCMDINECT-NSTLCGSGSC--NNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGEC-INESPGYSCSC----HSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ---------------------------VCVNILGSHYCRCYEGYK--KDERGNCFL 976
            P C C  GF  N    CED+DEC  +P     IC NK  TY C+C  G T          S+   C   +EC   L      C + C +V  G    C            +  ++     C+S   C     G + +CI S +   C C         P G+             E  +TC     C+T  G  QC       P    C C SG+ GD  + +    TQ   C   C       +     C C  G+     T C      ++C+    G   VC+   G  +C CK G+        C D +EC   +  CG    CINTPG + C CH  F     + C+ +   T +  LC +  C  N +    +C C SG+        D N+ +        C  N   GY+  C    HSG+    + C+          CG    C        C C  G+    G  +D       ++ C  + DC          CH  F    N    C+D  + +S P  + +C  + G   CLC +GF  +++  +   D+ +  L + DC+Q                            CV+     YCRC  GY    D+R  C +
Sbjct:  936 PQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVS--LCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQG-GRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDP-TLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYD-GIPYERCQDVDECLFSV--CGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGD-----DPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQ-------CGPNSFCITDNHQKSCICQDGF---TGDANDPQRGCQREEKCSTNEDCPAGR-----TCHINF----NGEQTCLDPCQIMSCP-TNEKCMVSDGMPICLCNSGFEKNKLTGSC--DVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMI 1533          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold287_size221780-snap-gene-1.29 (protein:Tk01903 transcript:maker-scaffold287_size221780-snap-gene-1.29-mRNA-1 annotation:"neurogenic locus notch protein isoform x1")

HSP 1 Score: 149.828 bits (377), Expect = 3.076e-36
Identity = 212/687 (30.86%), Postives = 306/687 (44.54%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECE-DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGG---YQCECG-GLPGTQLSDKDNHTCISDEACQVN---NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCV-DINEC-VTGDI-QCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNN--LEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCE-DINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLK-DECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN---NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF 1095
            C+CH+GF   D   C+ DV+EC    +  +  C N  G+Y C C  G+T Q     +  E        PCQ+  +  D G   Y+C C  G  G Q         I+ + C  N   NGG   + I SY    C CP  Y      + C  D++EC + GDI Q    C N      C C +GYEG +C  D+++C  Q  +    C +   + HC C  G   +    C   D C  +      +C    + G+++C C  GF  +  N    D NEC  G + C   G C+NTPGS+ C+C  GF       ++INEC ++     G+C +  G + C C  GY   +    D +EC  NPC +G  C +    Y C+C +G+    N   + DEC  D+PC  GG C +   S+ CDC  G+   +G   ++N      +PC  +G CV+ D SF C C+ G+     +  +    +EC S PC + ++C++   G++C C     L       CE +INEC  N   NG+    C++ + ++ C+C  GY      NC  + DEC      N G    C+++  G KC C  GY      PR   D NEC I+   NGG    C N    + C C  G+  D K  E   +   C  N   C H          + C CP G+
Sbjct:  175 CQCHEGFKGPD---CKIDVNEC-HLRQCYNGRCVNTHGSYRCICDQGYTGQ-----NCEEHFYPCKPSPCQNGGQCTDLGNYNYRCACPIGFDGEQCE-------INIDNCPGNLCQNGGLCLDQIDSYT---CDCPAEYT----GQHCTEDVDECAIHGDICQNGATCANTNHGYSCICVNGYEGRNCEIDVDDCAQQPCLNGGTCHDRVANYHCECPPGKTGL---LCHLNDACASNPCNTGAICETDIVTGSYKCSCPKGFIGDECN---QDINECDEG-SPCEHDGKCVNTPGSYRCDCARGFTGPRCE-VNINECDSNPCQNEGTCIDERGGFRCICMPGYNGRHCQ-TDEDECASNPCRNGGICTDLINSYRCTCPNGFKG-KNCETNVDEC-EDSPCQNGGTCRDSFASYSCDCPLGF---SGIHCEVNRNDCASNPC-RNGRCVDGDNSFVCDCNPGYTGYLCERQV----NECDSDPCQNGAKCEDLTNGYQCRC-----LKGTWGQNCENNINECYSNPCLNGE----CIDGINNYECQCRPGYTGP---NCETEIDECLSQPCLNNG---ACVDMVAGFKCNCPRGYY----GPRCQSDVNECAIDPCLNGG---TCENGFNEYICQCKPGY--DGKQCEN--EVDYCKSNP--CQHGGHCQSHFNSYSCQCPEGY 791          

HSP 2 Score: 146.362 bits (368), Expect = 4.002e-35
Identity = 201/709 (28.35%), Postives = 298/709 (42.03%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACV-DINECLLNNGHGPCQ--DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLNKCMNVPGSAY----CKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFD----LMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLD-INECIRNPCGHG-ECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-----EFKNGXCH---DINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFA-------LSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQ--LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN--NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-------ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAP 1115
            DV+EC  DP L    C N    Y+C C+ G+   G  C  +++ C  N    PCQ    C++    Y C+C      Q  + +   C+        NGG    CI   N   C+C   Y      KTC ++++ C     +C N     P + Y    C C  G+ G  C  DINEC          CINT+GS  C C+ GF+    L++  +C D       NGG    C +   +F+C C  GF     NL   D NEC    + C     C +   S+ CEC  GF   +    D  +CT S+    G+C +   ++ C C   Y    S C   +N+C  NPC +G  C++ S  Y+C C SG    +  C    +   +NPC  G +C+    ++ CDC  G+     + +   CH    +   S E+  C   G C +   S EC+C +G+        +    DECLS PC + + CK+ +G ++C+C  GF        + +  PN C+       NNG    VC +++    C C  G          L  E  ++    G C     C++  GG +C C PG++     PR   D NEC  N  +      CI  +  + CSC  G++            + C      C H       +C +T++G  H+C+CP GF        C+  G  C S+P
Sbjct:  723 DVNECAIDPCLNGGTCENGFNEYICQCKPGY--DGKQCENEVDYCKSN----PCQHGGHCQSHFNSYSCQCPEGYTGQNCESNIDDCLLQPCL---NGG---TCIDHINDFKCVCEPPYT----GKTCAMEMDPCSPS--KCANGATCSPSTNYRDYFCSCPLGFTGRHCDVDINECLNTPCRNGATCINTDGSYKCQCRPGFEGRDCLLNRDDCADS---PCKNGG---TCIDGIDSFKCVCIDGF---GGNLCQNDINECAS--SPCLNGATCHDYVNSYTCECQSGFSGTKCEIND-EDCTQSSCMNGGTCIDGINSFNCVCLPDYT--GSYCQSAVNQCDTNPCRNGGTCVDHSGFYTCHCSSGRTGRN--CERLVDWCKENPCENGARCSQVGTTYQCDCLDGWTGKVCDVRQVSCHVAAKLRGVSREQ-LCQNAGHCRDIGNSHECICSEGYYGSYCQEEV----DECLSQPCQNGATCKDLIGTYQCMCPPGFQGKNCEFNIDDCTPNPCQ-------NNG----VCHDLVNDFRCSCPHGTMG-------LLCEINVNECFEGACHHGGTCVDKIGGYECRCRPGFV----GPRCEGDVNECLSNPCSPLGTKECIQVVNNYQCSCKPGWQ-----------GRHCETKRNFCQHSPCQNGGVCTNTQTG--HQCVCPHGFY----GTNCQFSGKSCDSSP 1353          

HSP 3 Score: 123.635 bits (309), Expect = 3.502e-28
Identity = 155/562 (27.58%), Postives = 228/562 (40.57%), Query Frame = 0
Query:  541 NNGGCSHECIHSYNQIFCLCPDGYELDEDWKT--CVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF---DKDECEMDNGGCEQVCNNLEG-TFQCGCKPGF-----HLNTDNL---------TCTDE--------------NECTIGIANCGIYGD-------CINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHG---ECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK----KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYI-------VDSQDPRLCVDKNECTINNGGCQHACINKLGGHTC 1045
            N G CS   + S     C CP G      WK   C + + C  G+      C++   S  C+C  G++G DC  D+NEC  +    +  C+NT GS  C C  G+   +  E F       C+  NGG    C +L    ++C C  GF      +N DN           C D+                CT  +  C I+GD       C NT   + C C  G+E   +  +D+++C        G+C++    Y C+C  G       C   + C  NPC  G   E    +  Y CSC  G++  D   +D +EC   +PC   GKC N PGS+ CDCA G+    G   ++N    + +PC   G C++  G F C+C  G+    N  +   D DEC S+PC +   C + +  + C C  GF       N    ++EC  +       C +   S+ C C  G+     +  R +C   + CR  R         C++      C+CNPGY        V+  D   C +  +C     G Q  C+    G  C
Sbjct:  125 NGGTCS---LLSLTSFTCTCPLG------WKGVHCTERDHCA-GNPCHNGDCISHANSHRCQCHEGFKGPDCKIDVNECHLRQCY-NGRCVNTHGSYRCICDQGYTGQNCEEHFYPCKPSPCQ--NGG---QCTDLGNYNYRCACPIGFDGEQCEINIDNCPGNLCQNGGLCLDQIDSYTCDCPAEYTGQHCTEDVDECAIHGDICQNGATCANTNHGYSCICVNGYE-GRNCEIDVDDCAQQPCLNGGTCHDRVANYHCECPPGKT--GLLCHLNDACASNPCNTGAICETDIVTGSYKCSCPKGFIG-DECNQDINECDEGSPCEHDGKCVNTPGSYRCDCARGF---TGPRCEVNINECDSNPCQNEGTCIDERGGFRCICMPGY----NGRHCQTDEDECASNPCRNGGICTDLINSYRCTCPNGFKGKNCETN----VDECEDSPCQNGGTCRDSFASYSCDCPLGFSGIHCEVNRNDC-ASNPCRNGR---------CVDGDNSFVCDCNPGYTGYLCERQVNECDSDPCQNGAKCEDLTNGYQCRCLKGTWGQNC 645          

HSP 4 Score: 103.605 bits (257), Expect = 4.426e-22
Identity = 148/572 (25.87%), Postives = 212/572 (37.06%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNN---GHGPCQDECKNVDG--GYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL------DED--------WKTCVD---------------------INECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSD-INECETQDLICDHNCINTEGSAHCTCKAGF----------------------------------DLMDETECF------------DKDECEMDNGGCEQVCNNLEGTFQCGCKPGFH-----LNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC-HPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPC---GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGF 924
            D++EC++ P      C N  G+Y C CR GF  +        +CLLN       PC++    +DG   ++C C    G  L   D + C S       NG   H+ ++SY    C C  G+        DED          TC+D                     +N+C T   +    C++  G   C C SG  G +C   ++ C+         C     +  C C  G+                                  D+ +  EC             + DEC          C +L GT+QC C PGF       N D+ T    N C     N G+  D +N    F C C H    L+ +  +++NEC        G+C +  G YEC+C  G++       D+NEC+ NPC   G  ECI     Y CSC  G+      C         +PC  GG C N      C C  G+   N      +  S +  PC   G CV+    F C+C  G +  Q + +     +EC  SPC    C + LG ++C C  G+
Sbjct:  877 DINECLNTPCRNGATCINTDGSYKCQCRPGFEGR--------DCLLNRDDCADSPCKNGGTCIDGIDSFKCVCIDGFGGNLCQNDINECASSPCL---NGATCHDYVNSYT---CECQSGFSGTKCEINDEDCTQSSCMNGGTCIDGINSFNCVCLPDYTGSYCQSAVNQCDTNPCRNGGTCVDHSGFYTCHCSSGRTGRNCERLVDWCKENPCENGARCSQVGTTYQCDCLDGWTGKVCDVRQVSCHVAAKLRGVSREQLCQNAGHCRDIGNSHECICSEGYYGSYCQEEVDECLSQPCQNGATCKDLIGTYQCMCPPGFQGKNCEFNIDDCT---PNPCQ----NNGVCHDLVN---DFRCSCPHGTMGLLCE--INVNECFEGACHHGGTCVDKIGGYECRCRPGFVGPRCE-GDVNECLSNPCSPLGTKECIQVVNNYQCSCKPGWQGRH--CETKRNFCQHSPCQNGGVCTNTQTGHQCVCPHGFYGTNC---QFSGKSCDSSPCHNGGTCVDGASGFTCLCPHGTVGKQCEKD---SLNECQYSPCQKGTCIDKLGDYDCNCNAGW 1413          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold966_size75752-snap-gene-0.14 (protein:Tk02195 transcript:maker-scaffold966_size75752-snap-gene-0.14-mRNA-1 annotation:"neurogenic locus notch protein isoform x1")

HSP 1 Score: 149.828 bits (377), Expect = 3.698e-36
Identity = 213/688 (30.96%), Postives = 307/688 (44.62%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECE-DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGG---YQCECG-GLPGTQLSDKDNHTCISDEACQVN---NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCV-DINEC-VTGDIQCLN--KCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNN--LEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCE-DINECALN---NGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLK-DECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN---NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF 1095
            C+CH+GF   D   C+ DV+EC    +  +  C N  G+Y C C  G+T Q     +  E        PCQ+  +  D G   Y+C C  G  G Q         I+ + C  N   NGG   + I SY    C CP  Y      + C  D++EC + GDI C N   C N      C C +GYEG +C  D+++C  Q  +    C +   + HC C  G   +    C   D C  +      +C    + G+++C C  GF  +  N    D NEC  G + C   G C+NTPGS+ C+C  GF       ++INEC ++     G+C +  G + C C  GY   +    D +EC  NPC +G  C +    Y C+C +G+    N   + DEC  D+PC  GG C +   S+ CDC  G+   +G   ++N      +PC  +G CV+ D SF C C+ G+     +  +    +EC S PC + ++C++   G++C C     L       CE +INEC  N   NG+    C++ + ++ C+C  GY      NC  + DEC      N G    C+++  G KC C  GY      PR   D NEC I+   NGG    C N    + C C  G+  D K  E   +   C  N   C H          + C CP G+
Sbjct:  120 CQCHEGFKGPD---CKIDVNEC-HLRQCYNGRCVNTHGSYRCICDQGYTGQ-----NCEEHFYPCKPSPCQNGGQCTDLGNYNYRCACPIGFDGEQCE-------INIDNCPGNLCQNGGLCLDQIDSYT---CDCPAEYT----GQHCTEDVDECAIHGDI-CQNGATCANTNHGYSCICVNGYEGRNCEIDVDDCAQQPCLNGGTCHDRVANYHCECPPGKTGL---LCHLNDACASNPCNTGAICETDIVTGSYKCSCPKGFIGDECN---QDINECDEG-SPCEHDGKCVNTPGSYRCDCARGFTGPRCE-VNINECDSNPCQNEGTCIDERGGFRCICMPGYNGRHCQ-TDEDECASNPCRNGGICTDLINSYRCTCPNGFKG-KNCETNVDEC-EDSPCQNGGTCRDSFASYSCDCPLGF---SGIHCEVNRNDCASNPC-RNGRCVDGDNSFVCDCNPGYTGYLCERQV----NECDSDPCQNGAKCEDLTNGYQCRC-----LKGTWGQNCENNINECYSNPCLNGE----CIDGINNYECQCRPGYTGP---NCETEIDECLSQPCLNNG---ACVDMVAGFKCNCPRGYY----GPRCQSDVNECAIDPCLNGG---TCENGFNEYICQCKPGY--DGKQCEN--EVDYCKSNP--CQHGGHCQSHFNSYSCQCPEGY 736          

HSP 2 Score: 146.362 bits (368), Expect = 4.313e-35
Identity = 201/709 (28.35%), Postives = 298/709 (42.03%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACV-DINECLLNNGHGPCQ--DECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLNKCMNVPGSAY----CKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFD----LMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLD-INECIRNPCGHG-ECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY-----EFKNGXCH---DINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFA-------LSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQ--LCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTIN--NGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSH-------ICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAP 1115
            DV+EC  DP L    C N    Y+C C+ G+   G  C  +++ C  N    PCQ    C++    Y C+C      Q  + +   C+        NGG    CI   N   C+C   Y      KTC ++++ C     +C N     P + Y    C C  G+ G  C  DINEC          CINT+GS  C C+ GF+    L++  +C D       NGG    C +   +F+C C  GF     NL   D NEC    + C     C +   S+ CEC  GF   +    D  +CT S+    G+C +   ++ C C   Y    S C   +N+C  NPC +G  C++ S  Y+C C SG    +  C    +   +NPC  G +C+    ++ CDC  G+     + +   CH    +   S E+  C   G C +   S EC+C +G+        +    DECLS PC + + CK+ +G ++C+C  GF        + +  PN C+       NNG    VC +++    C C  G          L  E  ++    G C     C++  GG +C C PG++     PR   D NEC  N  +      CI  +  + CSC  G++            + C      C H       +C +T++G  H+C+CP GF        C+  G  C S+P
Sbjct:  668 DVNECAIDPCLNGGTCENGFNEYICQCKPGY--DGKQCENEVDYCKSN----PCQHGGHCQSHFNSYSCQCPEGYTGQNCESNIDDCLLQPCL---NGG---TCIDHINDFKCVCEPPYT----GKTCAMEMDPCSPS--KCANGATCSPSTNYRDYFCSCPLGFTGRHCDVDINECLNTPCRNGATCINTDGSYKCQCRPGFEGRDCLLNRDDCADS---PCKNGG---TCIDGIDSFKCVCIDGF---GGNLCQNDINECAS--SPCLNGATCHDYVNSYTCECQSGFSGTKCEIND-EDCTQSSCMNGGTCIDGINSFNCVCLPDYT--GSYCQSAVNQCDTNPCRNGGTCVDHSGFYTCHCSSGRTGRN--CERLVDWCKENPCENGARCSQVGTTYQCDCLDGWTGKVCDVRQVSCHVAAKLRGVSREQ-LCQNAGHCRDIGNSHECICSEGYYGSYCQEEV----DECLSQPCQNGATCKDLIGTYQCMCPPGFQGKNCEFNIDDCTPNPCQ-------NNG----VCHDLVNDFRCSCPHGTMG-------LLCEINVNECFEGACHHGGTCVDKIGGYECRCRPGFV----GPRCEGDVNECLSNPCSPLGTKECIQVVNNYQCSCKPGWQ-----------GRHCETKRNFCQHSPCQNGGVCTNTQTG--HQCVCPHGFY----GTNCQFSGKSCDSSP 1298          

HSP 3 Score: 142.895 bits (359), Expect = 4.820e-34
Identity = 204/666 (30.63%), Postives = 299/666 (44.89%), Query Frame = 0
Query:  433 CECHDGFFLNDDGEC-EDVDECVDDPELCDH--ICTNKPGTYMCDCRLGFTSQGTAC-VDINECLLNNGHGPCQDE--CKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVN---NGGCSHECIHSYNQIFCLCPDGYELDEDWKTC-VDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGF-DLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPG-FHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPC-GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSEC---KNTLGGFECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFL-KDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCV-DKNECTIN---NGGCQHACINKLGGHTCSCHLGFKPD--EKNPEKCVKAKACSVNNGG 1073
            C C  GF  +   EC +D++EC D+   C+H   C N PG+Y CDC  GFT  G  C V+INEC  N    PCQ+E  C +  GG++C C  +PG        H    ++ C  N   NGG   + I+SY    C CP+G++     K C  +++EC     Q    C +   S  C C  G+ G  C  + N+C +     +  C++ + S  C C  G+   + E +    +EC+ D       C +L   +QC C  G +  N +N    + NEC    +N  + G+CI+   ++ C+C PG+    +   +I+EC +     +G+C ++   ++C C  GY +      D+NEC  +PC   G C N    Y C C  GY D      + D C   NPC  GG C +   S+ C C  GY  +N    +I++  L+  PC   G C+++   F+CVC   +          ++ D C  S C +            + C C  GF         C+ DINEC          C+N  GS+ C+C  G+   E  +C L +D+C  S   NGG    CI+     KC C     +D     LC  D NEC  +   NG   H  +N    +TC C  GF     E N E C ++   S  NGG
Sbjct:  351 CSCPKGFIGD---ECNQDINEC-DEGSPCEHDGKCVNTPGSYRCDCARGFT--GPRCEVNINECDSN----PCQNEGTCIDERGGFRCIC--MPGY----NGRHCQTDEDECASNPCRNGGICTDLINSYR---CTCPNGFK----GKNCETNVDECEDSPCQNGGTCRDSFASYSCDCPLGFSGIHCEVNRNDCASNPCR-NGRCVDGDNSFVCDCNPGYTGYLCERQ---VNECDSDPCQNGAKCEDLTNGYQCRCLKGTWGQNCEN----NINEC---YSNPCLNGECIDGINNYECQCRPGY-TGPNCETEIDECLSQPCLNNGACVDMVAGFKCNCPRGY-YGPRCQSDVNECAIDPCLNGGTCENGFNEYICQCKPGY-DGKQCENEVDYC-KSNPCQHGGHCQSHFNSYSCQCPEGYTGQNCE-SNIDDCLLQ--PCLNGGTCIDHINDFKCVCEPPYT----GKTCAMEMDPCSPSKCANGATCSPSTNYRDYFCSCPLGFTGRH-----CDVDINECLNTPCRNGATCINTDGSYKCQCRPGF---EGRDCLLNRDDCADSPCKNGG---TCIDGIDSFKCVC-----IDGFGGNLCQNDINECASSPCLNGATCHDYVNS---YTCECQSGFSGTKCEINDEDCTQS---SCMNGG 949          

HSP 4 Score: 127.487 bits (319), Expect = 2.300e-29
Identity = 199/703 (28.31%), Postives = 307/703 (43.67%), Query Frame = 0
Query:  433 CECHDGFFLNDDGECE-DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTAC-VDINECLLNNGHGPCQD-ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDW-KTCV-DINECVTGDIQCLN-KCMNVPGSAYCKCDSGYEGDDC-SDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMD---NGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIAN-CGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGHGECINESPGYS---CSCHSGYV----DVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICI-DFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ-------VCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPG-------YIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTC-----SCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF 1095
            C C +GF   +   CE +VDEC D P      C +   +Y CDC LGF+  G  C V+ N+C  N    PC++  C + D  + C+C       L ++  + C SD  CQ  NG    +C    N   C C     L   W + C  +INEC +    CLN +C++   +  C+C  GY G +C ++I+EC +Q  + +  C++      C C  G+         D +EC +D   NGG    C N    + C CKPG+    D   C  ENE     +N C   G C +   S+ C+C  G+   ++   +I++C        G+C +    ++C C+  Y     TC ++++ C  + C +G   + S  Y    CSC  G+     DV     D +ECL + PC  G  C N  GS+ C C PG+E ++     +N       PC   G C++   SF+CVC  GF       N+C  D +EC SSPC + + C + +  + C C++GF+ +           +C +N+ DC+Q        C++ + S  C C   Y      +    ++C  +   NGG    C++  G   C C+ G        +VD      C +   C+      Q  C++   G  C     SCH+  K    + E+  +      N G C  I      G  H C+C  G+
Sbjct:  466 CTCPNGFKGKN---CETNVDECEDSPCQNGGTCRDSFASYSCDCPLGFS--GIHCEVNRNDCASN----PCRNGRCVDGDNSFVCDCNPGYTGYLCERQVNECDSD-PCQ--NGA---KCEDLTNGYQCRC-----LKGTWGQNCENNINECYSN--PCLNGECIDGINNYECQCRPGYTGPNCETEIDECLSQPCLNNGACVDMVAGFKCNCPRGY--YGPRCQSDVNECAIDPCLNGG---TCENGFNEYICQCKPGY----DGKQC--ENEVDYCKSNPCQHGGHCQSHFNSYSCQCPEGY-TGQNCESNIDDCLLQPCLNGGTCIDHINDFKCVCEPPYT--GKTCAMEMDPCSPSKCANGATCSPSTNYRDYFCSCPLGFTGRHCDV-----DINECL-NTPCRNGATCINTDGSYKCQCRPGFEGRDCL---LNRDDCADSPCKNGGTCIDGIDSFKCVCIDGF-----GGNLCQNDINECASSPCLNGATCHDYVNSYTCECQSGFSGT-----------KCEINDEDCTQSSCMNGGTCIDGINSFNCVCLPDYTGSYCQSAV--NQCDTNPCRNGG---TCVDHSGFYTCHCSSGRTGRNCERLVDWCKENPCENGARCSQVGTTYQCDCLDGWTGKVCDVRQVSCHVAAKLRGVSREQLCQ------NAGHCRDI------GNSHECICSEGY 1090          

HSP 5 Score: 123.25 bits (308), Expect = 4.046e-28
Identity = 155/562 (27.58%), Postives = 228/562 (40.57%), Query Frame = 0
Query:  541 NNGGCSHECIHSYNQIFCLCPDGYELDEDWKT--CVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECF---DKDECEMDNGGCEQVCNNLEG-TFQCGCKPGF-----HLNTDNL---------TCTDE--------------NECTIGIANCGIYGD-------CINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHG---ECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSE-CKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYK----KDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYI-------VDSQDPRLCVDKNECTINNGGCQHACINKLGGHTC 1045
            N G CS   + S     C CP G      WK   C + + C  G+      C++   S  C+C  G++G DC  D+NEC  +    +  C+NT GS  C C  G+   +  E F       C+  NGG    C +L    ++C C  GF      +N DN           C D+                CT  +  C I+GD       C NT   + C C  G+E   +  +D+++C        G+C++    Y C+C  G       C   + C  NPC  G   E    +  Y CSC  G++  D   +D +EC   +PC   GKC N PGS+ CDCA G+    G   ++N    + +PC   G C++  G F C+C  G+    N  +   D DEC S+PC +   C + +  + C C  GF       N    ++EC  +       C +   S+ C C  G+     +  R +C   + CR  R         C++      C+CNPGY        V+  D   C +  +C     G Q  C+    G  C
Sbjct:   70 NGGTCS---LLSLTSFTCTCPLG------WKGVHCTERDHCA-GNPCHNGDCISHANSHRCQCHEGFKGPDCKIDVNECHLRQCY-NGRCVNTHGSYRCICDQGYTGQNCEEHFYPCKPSPCQ--NGG---QCTDLGNYNYRCACPIGFDGEQCEINIDNCPGNLCQNGGLCLDQIDSYTCDCPAEYTGQHCTEDVDECAIHGDICQNGATCANTNHGYSCICVNGYE-GRNCEIDVDDCAQQPCLNGGTCHDRVANYHCECPPGKT--GLLCHLNDACASNPCNTGAICETDIVTGSYKCSCPKGFIG-DECNQDINECDEGSPCEHDGKCVNTPGSYRCDCARGF---TGPRCEVNINECDSNPCQNEGTCIDERGGFRCICMPGY----NGRHCQTDEDECASNPCRNGGICTDLINSYRCTCPNGFKGKNCETN----VDECEDSPCQNGGTCRDSFASYSCDCPLGFSGIHCEVNRNDC-ASNPCRNGR---------CVDGDNSFVCDCNPGYTGYLCERQVNECDSDPCQNGAKCEDLTNGYQCRCLKGTWGQNC 590          

HSP 6 Score: 103.219 bits (256), Expect = 5.432e-22
Identity = 148/572 (25.87%), Postives = 212/572 (37.06%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNN---GHGPCQDECKNVDG--GYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYEL------DED--------WKTCVD---------------------INECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSD-INECETQDLICDHNCINTEGSAHCTCKAGF----------------------------------DLMDETECF------------DKDECEMDNGGCEQVCNNLEGTFQCGCKPGFH-----LNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC-HPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPC---GHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGF 924
            D++EC++ P      C N  G+Y C CR GF  +        +CLLN       PC++    +DG   ++C C    G  L   D + C S       NG   H+ ++SY    C C  G+        DED          TC+D                     +N+C T   +    C++  G   C C SG  G +C   ++ C+         C     +  C C  G+                                  D+ +  EC             + DEC          C +L GT+QC C PGF       N D+ T    N C     N G+  D +N    F C C H    L+ +  +++NEC        G+C +  G YEC+C  G++       D+NEC+ NPC   G  ECI     Y CSC  G+      C         +PC  GG C N      C C  G+   N      +  S +  PC   G CV+    F C+C  G +  Q + +     +EC  SPC    C + LG ++C C  G+
Sbjct:  822 DINECLNTPCRNGATCINTDGSYKCQCRPGFEGR--------DCLLNRDDCADSPCKNGGTCIDGIDSFKCVCIDGFGGNLCQNDINECASSPCL---NGATCHDYVNSYT---CECQSGFSGTKCEINDEDCTQSSCMNGGTCIDGINSFNCVCLPDYTGSYCQSAVNQCDTNPCRNGGTCVDHSGFYTCHCSSGRTGRNCERLVDWCKENPCENGARCSQVGTTYQCDCLDGWTGKVCDVRQVSCHVAAKLRGVSREQLCQNAGHCRDIGNSHECICSEGYYGSYCQEEVDECLSQPCQNGATCKDLIGTYQCMCPPGFQGKNCEFNIDDCT---PNPCQ----NNGVCHDLVN---DFRCSCPHGTMGLLCE--INVNECFEGACHHGGTCVDKIGGYECRCRPGFVGPRCE-GDVNECLSNPCSPLGTKECIQVVNNYQCSCKPGWQGRH--CETKRNFCQHSPCQNGGVCTNTQTGHQCVCPHGFYGTNC---QFSGKSCDSSPCHNGGTCVDGASGFTCLCPHGTVGKQCEKD---SLNECQYSPCQKGTCIDKLGDYDCNCNAGW 1358          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold828_size91184-snap-gene-0.12 (protein:Tk04682 transcript:maker-scaffold828_size91184-snap-gene-0.12-mRNA-1 annotation:"protein crumbs-like")

HSP 1 Score: 129.413 bits (324), Expect = 5.426e-30
Identity = 199/646 (30.80%), Postives = 269/646 (41.64%), Query Frame = 0
Query:  500 PCQD--ECKNVDGGYQCECGGLPGT-QLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCV------------DINECVTGDIQCLN--KCM--NVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCI-NTEGSAHCTCKAGFDLMDETE-CFDKDECEM---DNGGCEQVCNNL--EGTFQCGCKPGFH---LNTDNLTCTDENECTIGIANCGIYGDCINT--PGSFYCECHPGFELMEDSC-MDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGHGE-CINESPGYSCSCHSGYVDVDNVCR-DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKD-----PCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCF-HSECKNTLGGFECLCETGFALSEILPNTCEDINECA----LNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECT---INNGGCQHACINKLGGHTCSCHLGFK-PD-EKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGF 1095
            PCQ    C  V G  +C C G   +      + + C +   CQ N+G C H     Y    C C +GY +  D +T V              N CV+G   CLN  +C   +V   A C C  G+ G  C +I  C+  +      C+ N  G   C C  GF     T  C    +C      NGG   VC N    G FQC C  GF      T    C   N C  G         C N   P S  C+C  GF    D C  DINEC   T C  G+C N  G ++C C++G+      C ++INEC  NPC +G  C ++S G+ C C +GY      C  D DECL   PC  GG C++  G+F C+CAP   F    C    +   E       PC    D  +    F C C +GF   + ++NI    DEC  + C     C + +  +EC C  GFA      N  ++I++C      NNG C    V++     C C EG+     G+   +D    S         +C N  G  +C C PG+  +    R   D +EC      NGG    C NK+  + C C  GF  P+ E N ++C ++  C +N G C      T+      C C +GF
Sbjct:  287 PCQGGGMCSIVTGEVRCNCAGTGRSGHFCQMETNPCTTSSPCQ-NDGTCFHLPSGGY---VCECTNGY-IGSDCETSVLPLLASRSLTTSSSNPCVSG--FCLNGGECFYQSVEDMALCDCAEGFSGSRC-EITPCDALECTEHSECVSNAGGQYRCQCVQGFSGDPPTSPCVAFQDCTTVPCANGG---VCTNQTGNGLFQCSCPSGFGGQVCQTVVDDCLASNPCQNGAT-------CRNLLEPQSVACDCAQGF--TGDFCSQDINEC-GETPCSHGTCQNYPGGFKCNCEAGWT--GPVCDVNINECSSNPCLNGATCRDQSNGFLCVCPAGYTGA--ACESDIDECLSA-PCQNGGSCSDGVGNFTCECAPA--FMGATCDLPYDPCAENSCQNGAPCKKTKDFRDPGNDFYCECPEGFEGLRCENNI----DECAEAQCPPFKVCVDLVARYECQCPQGFAGE----NCTQEIDDCLSSPCANNGSC----VDLKDGFLCNCSEGWT----GSTCSEDIDECSENDTLCNNGICRNTAGSFECYCRPGFSGN----RCNHDFDECLSRPCQNGG---NCTNKINDYECVCPAGFAGPNCEINIDEC-ESNPC-LNGGTC------TDGINDFTCACLAGF 873          

HSP 2 Score: 124.02 bits (310), Expect = 2.351e-28
Identity = 143/557 (25.67%), Postives = 237/557 (42.55%), Query Frame = 0
Query:  449 DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTAC-VDINECLLNNGHGPCQD--ECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGC--SHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQ-VCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVN------------------------------NDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRCYEGY 966
            +++EC  +P L    C ++   ++C C  G+T  G AC  DI+ECL      PCQ+   C +  G + CEC         D     C ++ +CQ N   C  + +     N  +C CP+G+E     +   +I+EC          C+++     C+C  G+ G++C+ +I++C +     + +C++ +    C C  G+     +E  D DEC  ++  C   +C N  G+F+C C+PGF  N  N    D +EC      C   G+C N    + C C  GF    +  ++I+EC ++     G+C +    + C C +G+       ++I+EC   PC +G  C++    Y+C C+    +  +   + DECL   PC     C ++   + CDC  G+  KN    DI+       PC     C                                +   F C C  G+       N  ID +EC  SPC H EC++ +  + C+C+ G+         CE +I+EC          C + +    C C  G+
Sbjct:  570 NINECSSNPCLNGATCRDQSNGFLCVCPAGYT--GAACESDIDECL----SAPCQNGGSCSDGVGNFTCECAPAFMGATCDLPYDPC-AENSCQ-NGAPCKKTKDFRDPGNDFYCECPEGFE---GLRCENNIDECAEAQCPPFKVCVDLVARYECQCPQGFAGENCTQEIDDCLSSPCANNGSCVDLKDGFLCNCSEGWTGSTCSE--DIDECSENDTLCNNGICRNTAGSFECYCRPGFSGNRCN---HDFDECLS--RPCQNGGNCTNKINDYECVCPAGFA-GPNCEINIDECESNPCLNGGTCTDGINDFTCACLAGFTGLGCE-INIDECEGAPCLNGGLCVDGIDAYNCVCNGTGFEGLHCEFNIDECL-PQPCQNNATCTDEINDYTCDCFQGFGGKN---CDIDIAECMDRPCENGAICFERSNLTLYRPEVMAELPLDVRDIFNQSFSYFDASGFVCSCLPGY----EGPNCEIDINECADSPCLHGECQDGIAQYFCVCDDGYE-----GQNCEFEIDECDRYQPCQHGSCTDRIADFICNCEPGW 1093          

HSP 3 Score: 116.701 bits (291), Expect = 4.641e-26
Identity = 173/611 (28.31%), Postives = 237/611 (38.79%), Query Frame = 0
Query:  461 DHICTNKP-GTYMCDCRLGFTSQGTAC------VDINECLLNNGHGPCQD-------EC--KNVDGGYQCECG-GLPGT--QLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVT---------------GDIQC--------------------LNKCMN--------VPGSAYCKCDSGYEGDDCS-DINECETQDLICDH-NCINTEGSAHCTCKAGF---------------------DLMDETECF---------------DKDEC---EMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCT--DENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCG-HGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALS--EILPNTCEDINECALNNGDCSQVCVNILGSHYCRC 962
            D  C + P G Y+C+C  G+   G+ C      +  +  L  +   PC         EC  ++V+    C+C  G  G+  +++  D   C     C  N GG          Q  C C  G+  D     CV   +C T               G  QC                     N C N         P S  C C  G+ GD CS DINEC   +  C H  C N  G   C C+AG+                        D++  F               D DEC      NGG    C++  G F C C P F   T +L      EN C  G A C    D  +    FYCEC  GFE +     +I+EC  +       C +L   YEC+C  G+   N T  +I++C+ +PC  +G C++   G+ C+C  G+        D DEC  ++     G C N  GSF+C C PG+   N   HD +E      PC   G+C N    +ECVC  GF       N  I+ DEC S+PC +   C + +  F C C  GF     EI  + CE      LN G    +CV+ + ++ C C
Sbjct:  331 DGTCFHLPSGGYVCECTNGYI--GSDCETSVLPLLASRSLTTSSSNPCVSGFCLNGGECFYQSVEDMALCDCAEGFSGSRCEITPCDALECTEHSECVSNAGG----------QYRCQCVQGFSGDPPTSPCVAFQDCTTVPCANGGVCTNQTGNGLFQCSCPSGFGGQVCQTVVDDCLASNPCQNGATCRNLLEPQSVACDCAQGFTGDFCSQDINEC--GETPCSHGTCQNYPGGFKCNCEAGWTGPVCDVNINECSSNPCLNGATCRDQSNGFLCVCPAGYTGAACESDIDECLSAPCQNGG---SCSDGVGNFTCECAPAFMGATCDLPYDPCAENSCQNG-APCKKTKDFRDPGNDFYCECPEGFEGLRCE-NNIDECAEAQCPPFKVCVDLVARYECQCPQGFAGENCT-QEIDDCLSSPCANNGSCVDLKDGFLCNCSEGWTG-STCSEDIDECSENDTLCNNGICRNTAGSFECYCRPGFS-GNRCNHDFDE--CLSRPCQNGGNCTNKINDYECVCPAGFA----GPNCEINIDECESNPCLNGGTCTDGINDFTCACLAGFTGLGCEINIDECEGAP--CLNGG----LCVDGIDAYNCVC 907          

HSP 4 Score: 105.145 bits (261), Expect = 1.246e-22
Identity = 108/333 (32.43%), Postives = 156/333 (46.85%), Query Frame = 0
Query:  653 KDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFE-LMEDSCMDINECTNSTLCGSGSCNN--LEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPG----------YSCSCHSGYVDVD-NVCRDYDECLHDNPCGVGGKCNNKPGS--FDCDCAPGYEFKNGXCH-DINEXSLEKDPCGPHGDCVNNDGSFECVCHQ-GFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGF-ALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGY 966
            +DEC   NGG    C++ E  F+C C  GF    D+   T+ +EC     N  + G CI+   ++ C C+PG+   + D  +D +ECTN      G C+   L G Y C+C   YI  N   L I  C + PC +G      PG          Y+C C+ G+   D    +D+ E  H  PC  G  C +   +  + C+C PG  F    C  DINE   E +PC   G C N   +F+C C+  GF       NI    +ECL +PC + +C++TLG +EC C  G+  ++    N C   +E  +N G C   C ++   H C C E +
Sbjct: 1976 QDECR--NGG---TCSDPEEIFECSCPVGFE---DSWCFTNIDECA---QNGCLNGACIDGVANYTCSCNPGWTGWLCD--VDFDECTNEPCQNGGVCSQTILPGNYTCECSDEYIGKNCEELKIKTCEQQPCQNGGTCR--PGASYYSGSNNQYTCDCNPGFKGEDCERKKDFCEEFH-QPCVNGATCLSLHSTLNYKCNCMPG--FAGDTCEEDINE--CEAEPCQNGGKCTNLVNAFQCDCNATGFTGKTCSQNI----NECLENPCVYGDCQDTLGAYECRCNPGYCGINCQRSNPCLGSDEMCMNGGICVPAC-DVEPFHTCNCTENW 2283          

HSP 5 Score: 93.5893 bits (231), Expect = 4.793e-19
Identity = 105/337 (31.16%), Postives = 156/337 (46.29%), Query Frame = 0
Query:  740 NSTLC------GSGSCNNLEGTYECKCDSGYIFHNSTCL-DINECIRNPCGHGECINESPGYSCSCHSGYV----DVDNVCRDYDECLHDNPCGVGGKCNNK--PGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDC-------VNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGG---FECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRC----YEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYI-VDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSC 1047
            N TLC        G+C++ E  +EC C  G  F +S C  +I+EC +N C +G CI+    Y+CSC+ G+     DVD     +DEC ++ PC  GG C+    PG++ C+C+  Y  KN  C ++   + E+ PC   G C         ++  + C C+ GF  +  D     DF E    PC +     +L     ++C C  GFA      +TCE DINEC          C N++ +  C C    + G    +  N  L++ C       G CQ    +  G  +C CNPGY  ++ Q    C+  +E  +N G C  AC +    HTC+C
Sbjct: 1970 NCTLCYQDECRNGGTCSDPEEIFECSCPVG--FEDSWCFTNIDECAQNGCLNGACIDGVANYTCSCNPGWTGWLCDVD-----FDECTNE-PCQNGGVCSQTILPGNYTCECSDEYIGKN--CEELKIKTCEQQPCQNGGTCRPGASYYSGSNNQYTCDCNPGFKGE--DCERKKDFCEEFHQPCVNGATCLSLHSTLNYKCNCMPGFA-----GDTCEEDINECEAEPCQNGGKCTNLVNAFQCDCNATGFTGKTCSQNINECLENPCVY-----GDCQ----DTLGAYECRCNPGYCGINCQRSNPCLGSDEMCMNGGICVPAC-DVEPFHTCNC 2279          

HSP 6 Score: 78.9518 bits (193), Expect = 1.222e-14
Identity = 123/442 (27.83%), Postives = 171/442 (38.69%), Query Frame = 0
Query:  708 GDCINTP-GSFYCECHPGF----------ELMEDSCMDI---NECTNSTLCGSGSC--NNLEGTYECKCDSGYIFHNSTCLDINECIRNPCG-HGECINESPG-YSCSCHSGYVD--VDNVCRDYDECLHDNPCGVGGKCNNKPGS--FDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVN--NDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQD-PRLCVDKNECTINNGGCQHACINKLGGHT--CSCHLGFKPD--EKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNG 1120
            G C + P G + CEC  G+           L+    +     N C +      G C   ++E    C C  G  F  S C +I  C    C  H EC++ + G Y C C  G+      + C  + +C    PC  GG C N+ G+  F C C  G  F    C  + +  L  +PC     C N     S  C C QGF  D        D +EC  +PC H  C+N  GGF+C CE G+      P    +INEC+ N       C +      C C  GY      +    DEC  +   NGG    C +  G   CEC P ++  + D P     +N C  N   C+     +  G+   C C  GF+    E N ++C +A+        C       +    + C CP GF        C      C S+P  +NG
Sbjct:  332 GTCFHLPSGGYVCECTNGYIGSDCETSVLPLLASRSLTTSSSNPCVSGFCLNGGECFYQSVEDMALCDCAEG--FSGSRC-EITPCDALECTEHSECVSNAGGQYRCQCVQGFSGDPPTSPCVAFQDCTTV-PCANGGVCTNQTGNGLFQCSCPSG--FGGQVCQTVVDDCLASNPCQNGATCRNLLEPQSVACDCAQGFTGDFCSQ----DINECGETPCSHGTCQNYPGGFKCNCEAGWT----GPVCDVNINECSSNPCLNGATCRDQSNGFLCVCPAGYTGAACESDI--DECLSAPCQNGG---SCSDGVGNFTCECAPAFMGATCDLPYDPCAENSCQ-NGAPCKKTKDFRDPGNDFYCECPEGFEGLRCENNIDECAEAQ--------CPPFKVCVDLVARYECQCPQGFA----GENCTQEIDDCLSSPCANNG 741          

HSP 7 Score: 70.8626 bits (172), Expect = 3.267e-12
Identity = 109/369 (29.54%), Postives = 152/369 (41.19%), Query Frame = 0
Query:  735 INECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINEC-IRNPCGH-GECIN-ESPGYSCSCHSGYVDVD-------NVCRDYDECLHDNPCGVGGKCNNKPGSF--------DCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNN-DGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGG--FECLCETGFA--LSEILPNTCEDINECALNNGDCSQVCVNIL--GSHYCRCYEGYKKDERGNCFLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPD--EKNPEKCVKAKACSVNNGGCS 1075
            I+ C  +   G G C+ + G   C C       +   ++ N C   +PC + G C +  S GY C C +GY+  D        +          NPC V G C N    F         CDCA G  F    C      +LE   C  H +CV+N  G + C C QGF  D   S  C+ F +C + PC +   C N  G   F+C C +GF   + + + + C   N C   NG     C N+L   S  C C +G+  D        +EC  +   +G CQ    N PGG KC C  G+      P   V+ NEC+ N       C ++  G  C C  G+     E + ++C+ A     N G CS
Sbjct:  280 IDSCEENPCQGGGMCSIVTGEVRCNCAGTGRSGHFCQMETNPCTTSSPCQNDGTCFHLPSGGYVCECTNGYIGSDCETSVLPLLASRSLTTSSSNPC-VSGFCLNGGECFYQSVEDMALCDCAEG--FSGSRCEITPCDALE---CTEHSECVSNAGGQYRCQCVQGFSGDPPTSP-CVAFQDCTTVPCANGGVCTNQTGNGLFQCSCPSGFGGQVCQTVVDDCLASNPC--QNG---ATCRNLLEPQSVACDCAQGFTGDFCSQDI--NECGETPCSHGTCQ----NYPGGFKCNCEAGWT----GPVCDVNINECSSNPCLNGATCRDQSNGFLCVCPAGYTGAACESDIDECLSAPC--QNGGSCS 624          

HSP 8 Score: 69.3218 bits (168), Expect = 1.026e-11
Identity = 84/289 (29.07%), Postives = 126/289 (43.60%), Query Frame = 0
Query:  555 QIF-CLCPDGYELDEDWKTCVDINECVTGDIQCLN-KCMNVPGSAYCKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDET-ECFDKDECEMD---NGG-CEQVCNNLEGT---FQCGCKPGFH---LNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCM-DINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECL-HDNPCGVGGKC 827
            +IF C CP G+E  + W    +I+EC      CLN  C++   +  C C+ G+ G  C  D +EC  +       C  T    + TC+   + + +  E      CE     NGG C    +   G+   + C C PGF           C + ++  +  A C      +N    + C C PGF    D+C  DINEC        G C NL   ++C C++      +   +INEC+ NPC +G+C +    Y C C+ GY  ++  C+  + CL  D  C  GG C
Sbjct: 1990 EIFECSCPVGFE--DSW-CFTNIDECAQNG--CLNGACIDGVANYTCSCNPGWTGWLCDVDFDECTNEPCQNGGVCSQTILPGNYTCECSDEYIGKNCEELKIKTCEQQPCQNGGTCRPGASYYSGSNNQYTCDCNPGFKGEDCERKKDFCEEFHQPCVNGATCLSLHSTLN----YKCNCMPGF--AGDTCEEDINECEAEPCQNGGKCTNLVNAFQCDCNATGFTGKTCSQNINECLENPCVYGDCQDTLGAYECRCNPGYCGIN--CQRSNPCLGSDEMCMNGGIC 2265          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold581_size130326-snap-gene-0.15 (protein:Tk05328 transcript:maker-scaffold581_size130326-snap-gene-0.15-mRNA-1 annotation:"PREDICTED: uncharacterized protein LOC100879487")

HSP 1 Score: 111.309 bits (277), Expect = 2.166e-24
Identity = 152/551 (27.59%), Postives = 221/551 (40.11%), Query Frame = 0
Query:  431 PTCECHDGFFLNDDGECE-DVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNV--DGGYQCECGGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCIN-----TEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGF---HLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGF-----ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGH-GECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFH-SECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRC 962
            P C C  GF       CE +VDEC  +P   +  C + P  Y CDC  G++  G  C+   E   ++   P +  CKN    G + C C      +  D+    C ++  C+ N G C         +  C CP+G+   E     V+I++C          C ++     C C  G+ G  C      E  DL  +H C+N           C C  G+    E    + D+C  D       C +    F C C+PGF           C  E         C   G C NT  SF C+C PGF     E   D C   N+C  +   G+  C +L+  +EC+C  G  F    C ++IN+C+ NPC + G C +E  GY CSC SG+   D   +D   C    PC    +C N    F C C  G + K   C    E  +   PC   G C +      C C   F           +FD C ++ C + + C +    ++C+C  G+       N  E+IN+C       +  C+++  + YCRC
Sbjct: 2065 PKCFCPAGF---SGARCEVNVDECASNPCYNEGECVDLPQGYRCDCTPGYS--GLQCIQ-EESSCDSNPCPERAMCKNEPGPGNFTCLCRSGYEGESCDETVDPC-ANNPCE-NEGECES---FQQGRYVCKCPNGW---EGIHCEVNIDDCAENPCLLGANCTDLIHDFACDCPQGFSGKHCQ-----EKVDLCAEHECLNGFCVDKLFKYECICNPGW--TGEMCEVNIDDCINDPCANNGQCIDEIDDFNCVCEPGFVGKRCQHRIDFCASE--------PCQNAGTCSNTEESFLCDCRPGFVGLACEAAIDECAS-NQCDPT---GTAKCLDLDNKFECECREG--FKGDMCEVNINDCVSNPCMNGGSCRDEVGGYVCSCPSGWSG-DRCEQDIGYC-DSEPCENNAECINLFQDFFCVCPKGTDGKR--CETAPERCI-GSPCMNGGFCRDYGSDLNCTCSDDF----TGVGCQFEFDACAANVCRNGATCMDNGPSYQCVCPPGYTGD----NCEENINDCRPGTCPPASTCIDLTDNFYCRC 2567          

HSP 2 Score: 109.383 bits (272), Expect = 7.524e-24
Identity = 135/526 (25.67%), Postives = 219/526 (41.63%), Query Frame = 0
Query:  543 GGCSHE--CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDC-SDINECETQDLICDHNCINTEGSAH--CTCKAGFDLMDETECFD---KDECEMDNGGCEQVCNNLEGTFQCGCKPGFH-----LNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGH-GECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHG--DCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRCYEG--------------------------YKKDERGNC----------FLKDECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDS 1013
            G C H   C+   ++  C CP G+      +  V+++EC +       +C+++P    C C  GY G  C  + + C++        C N  G  +  C C++G++     E  D    + CE + G CE      +G + C C  G+      +N D+     EN C +G        +C +    F C+C  GF      C +  +      C +G C +    YEC C+ G+      C ++I++CI +PC + G+CI+E   ++C C  G+V     C+   +     PC   G C+N   SF CDC PG+    G   +        + C P G   C++ D  FEC C +GF  D  + NI    ++C+S+PC +   C++ +GG+ C C +G++      + CE DI  C     + +  C+N+    +C C +G                          Y  D    C          F  D C  +   NG     C++     +C C PGY  D+
Sbjct: 2050 GICEHGGLCVAVNHKPKCFCPAGFS---GARCEVNVDECASNPCYNEGECVDLPQGYRCDCTPGYSGLQCIQEESSCDSNPCPERAMCKNEPGPGNFTCLCRSGYEGESCDETVDPCANNPCE-NEGECESF---QQGRYVCKCPNGWEGIHCEVNIDDCA---ENPCLLG-------ANCTDLIHDFACDCPQGFS--GKHCQEKVDLCAEHECLNGFCVDKLFKYECICNPGWT--GEMCEVNIDDCINDPCANNGQCIDEIDDFNCVCEPGFVG--KRCQHRIDFCASEPCQNAGTCSNTEESFLCDCRPGFV---GLACEAAIDECASNQCDPTGTAKCLDLDNKFECECREGFKGDMCEVNI----NDCVSNPCMNGGSCRDEVGGYVCSCPSGWS-----GDRCEQDIGYCDSEPCENNAECINLFQDFFCVCPKGTDGKRCETAPERCIGSPCMNGGFCRDYGSDLNCTCSDDFTGVGCQFEFDACAANVCRNGA---TCMDNGPSYQCVCPPGYTGDN 2537          

HSP 3 Score: 105.531 bits (262), Expect = 1.169e-22
Identity = 141/473 (29.81%), Postives = 206/473 (43.55%), Query Frame = 0
Query:  608 DDCSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETEC-FDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPG--SFYCECHPGFELMEDSCMD-INECTNSTLCGSGSCNNLE-GTYECKCDSGYIFHNSTC-LDINECIRNPCGHGE-CINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHS-ECKNTLGGFECLCETGFALSEILPNTCE-DINECALNNGDCSQV--CVNILGSHYCRCYEGYKKDERGNCFLK-DECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVD--SQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF--KPDEKNPEKCV 1062
            D+C D++  E    IC+H   C+       C C AGF       C  + DEC  +    E  C +L   ++C C PG+      L C  E E +     C     C N PG  +F C C  G+E   +SC + ++ C N+     G C + + G Y CKC +G+      C ++I++C  NPC  G  C +    ++C C  G+      C++  +   ++ C + G C +K   ++C C PG+    G   ++N      DPC  +G C++    F CVC  GF+  +    I    D C S PC ++  C NT   F C C  GF     +   CE  I+ECA N  D +    C+++     C C EG+K D    C +  ++C  +   NGG    C +  GG  C C  G+  D   QD   C D   C  N       CIN      C C  G   K  E  PE+C+
Sbjct: 2040 DECQDVDCPEG---ICEHGGLCVAVNHKPKCFCPAGFS---GARCEVNVDECASNPCYNEGECVDLPQGYRCDCTPGYS----GLQCIQE-ESSCDSNPCPERAMCKNEPGPGNFTCLCRSGYE--GESCDETVDPCANNPCENEGECESFQQGRYVCKCPNGW--EGIHCEVNIDDCAENPCLLGANCTDLIHDFACDCPQGFSG--KHCQEKVDLCAEHEC-LNGFCVDKLFKYECICNPGW---TGEMCEVNIDDCINDPCANNGQCIDEIDDFNCVCEPGFVGKRCQHRI----DFCASEPCQNAGTCSNTEESFLCDCRPGF-----VGLACEAAIDECASNQCDPTGTAKCLDLDNKFECECREGFKGDM---CEVNINDCVSNPCMNGGS---CRDEVGGYVCSCPSGWSGDRCEQDIGYC-DSEPCENN-----AECINLFQDFFCVCPKGTDGKRCETAPERCI 2470          

HSP 4 Score: 101.679 bits (252), Expect = 1.784e-21
Identity = 154/572 (26.92%), Postives = 240/572 (41.96%), Query Frame = 0
Query:  434 ECHD-----GFFLNDDGECEDVDECVDDPE-LCDH--ICTNKPGTYMCDCRLGFTSQGTAC-VDINECLLNNGHGPC--QDECKNVDGGYQCECG-GLPGTQLSDKDNHTCISDEA-CQVN----NGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAY-CKCDSGYEGDDCS-DINECETQDLICDHNCINTEGSAHCTCKAGF---------DLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMD-INECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRN---PCGHGECINESPGYSCSCHSGYVDVDNVCR-DYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDE-CLSSPCFHSE-CKNTLGGFECLCETGFALSEILPNTCE-DINECALNNGDCSQVCVNILGSHYCRCYEGYKKD 969
            ECH      G   +   EC+DVD C   PE +C+H  +C        C C  GF+  G  C V+++EC  N    PC  + EC ++  GY+C+C  G  G Q        CI +E+ C  N       C +E         CLC  GYE +   +T   ++ C     +   +C +     Y CKC +G+EG  C  +I++C     +   NC +      C C  GF         DL  E EC +              C +    ++C C PG+   T  +   + ++C      C   G CI+    F C C PGF  +   C   I+ C +     +G+C+N E ++ C C  G++        I+EC  N   P G  +C++    + C C  G+    ++C  + ++C+  NPC  GG C ++ G + C C  G+   +G   + +    + +PC  + +C+N    F CVC +G      D   C    E C+ SPC +   C++      C C   F         C+ + + CA N       C++   S+ C C  GY  D
Sbjct: 2024 ECHTTEETLGMGTSSKDECQDVD-C---PEGICEHGGLCVAVNHKPKCFCPAGFS--GARCEVNVDECASN----PCYNEGECVDLPQGYRCDCTPGYSGLQ--------CIQEESSCDSNPCPERAMCKNE--PGPGNFTCLCRSGYEGESCDET---VDPCANNPCENEGECESFQQGRYVCKCPNGWEGIHCEVNIDDCAENPCLLGANCTDLIHDFACDCPQGFSGKHCQEKVDLCAEHECLNG------------FCVDKLFKYECICNPGW---TGEMCEVNIDDCIND--PCANNGQCIDEIDDFNCVCEPGF--VGKRCQHRIDFCASEPCQNAGTCSNTEESFLCDCRPGFVGLACEAA-IDECASNQCDPTGTAKCLDLDNKFECECREGFKG--DMCEVNINDCVS-NPCMNGGSCRDEVGGYVCSCPSGW---SGDRCEQDIGYCDSEPCENNAECINLFQDFFCVCPKG-----TDGKRCETAPERCIGSPCMNGGFCRDYGSDLNCTCSDDFTGV-----GCQFEFDACAANVCRNGATCMDNGPSYQCVCPPGYTGD 2536          

HSP 5 Score: 55.4546 bits (132), Expect = 1.751e-7
Identity = 64/263 (24.33%), Postives = 97/263 (36.88%), Query Frame = 0
Query: 1317 CQMLIHVKDVIPPTVQNCPKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVM--ASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPFLVFVPKNGHKVSSSEEGLSYYNYHKLPSDHGLFKCDKVPSLENGKFNCKNLGPGQEGIKCIPECDSGYQFYQKFSSRPPSYICNAQRV--------DWELKRFIPDCSPVHKSQ--LKSNCDAGWEYRSDEGICVACPPGMYRDSNISVLCQLCPKSYYSS 1567
            C++L   KD I PTV+ CP   I +++       ++W+EP F DN+++  V+      PG     G + + Y   D  GN  +C+F I +         N F                                  C  +     G  +C++ GPG     C   CD G +F    +S P  Y C A+          D       P CS    +Q   K   D    Y +D  +C     G+ R+  I+ L +L  +  YSS
Sbjct: 2815 CELL--EKDKIAPTVEYCPPGDI-WVATSNGSAFVNWDEPIFADNVRVDKVINKGGLKPGQALQWGTYDVAYVGYDEAGNTAQCDFKIYVL--------NSF----------------------------------CPPLDPPAGGSQSCEDWGPGGRFKVCRITCDDGLRFS---ASVPQFYTCGAEGFWRPNSNTNDNNSPFVYPACSKTKPAQKIFKIRLD----YMTDV-LCNDAGKGVLRERIIAALQELNKEWSYSS 3024          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold212_size255419-snap-gene-0.10 (protein:Tk00543 transcript:maker-scaffold212_size255419-snap-gene-0.10-mRNA-1 annotation:"hypothetical protein BRAFLDRAFT_103549")

HSP 1 Score: 88.1965 bits (217), Expect = 1.316e-17
Identity = 96/348 (27.59%), Postives = 135/348 (38.79%), Query Frame = 0
Query: 1091 CPSGFKLK-TDARTC-----------KPIGGICSSAPRPSNGYYRCNKKKVSGYFVK-----GTKCKLKCRKGFMPTGHITRKCINNGTWTGDEDHACEVMNCPPLPPLHNGNISPETCMTDSSPRGSKCLFTCNNGYQITGVKKTRCTRLSEWKRIRVNPPKCNPTFNRPQIHCPPDM-IEPLP-RDSKSVYVFIPKPRTNVNWERYVDSDPVWAVHLEGEMIRGK-HVVTFRARSPVNPKESATCQMLIHVKDVIPPTVQNC--PKSFIDYLSPGQVMKRISWNEPNFKDNIKIQHVMASFLPGHYFSEGAHKIVYHASDMDGNHGRCEFTITLKRLDSQSSENPF 1416
            C SGF+L  +  RTC           + I   C S   P NG   C+    S   ++      T+C   C++G+   G   R C+ N  WTG   + C+ + CP L   ++G++ P  C       G +C F+C  G+Q+ G     C     W    V   +C      P+I CP D+  E  P R    V + +P    N      V S PV    L  E ++ K  V T    +       A C   + V+D   P V  C  P  F+     G     I W+EP F DN     V+        F  G   + Y A D  GN   C   IT++    QS  +P 
Sbjct:  411 CNSGFELHGSGLRTCTREGNWTGMEARCIAKSCRSLSAPRNGNILCSTLTNSKEVIRHGHQVDTECLCSCQEGYRLVGSRKRSCLPNALWTGLPGY-CKPITCPLLRRPNHGDVYPLQCGQHKMRFGQRCGFSCQPGFQLQGPALRECVMPGLWSG-SVQITRCVDN-TPPEIECPRDLEFEAAPDRHFAVVDLPLPTATDNSGISPTVISLPV----LTSEAMKLKIGVSTILISASDLSGNRAKCVFNVTVRDTQAPIVDFCRSPPPFLAQPGLGHA-DDIEWDEPIFHDNSLSLIVVTQSAEFGRFPLGTTLVEYKAKDEAGNVASCSMDITVQEDFCQSPPDPI 750          
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold451_size166902-snap-gene-0.17 (protein:Tk01628 transcript:maker-scaffold451_size166902-snap-gene-0.17-mRNA-1 annotation:"neurogenic locus protein delta")

HSP 1 Score: 70.8626 bits (172), Expect = 2.337e-12
Identity = 69/227 (30.40%), Postives = 97/227 (42.73%), Query Frame = 0
Query:  716 SFYCECHPGF-----ELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTC-LDINECIRNPCGHGEC--INESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSE--ILPN 932
            ++ C C  GF     ++   +C D   C N    G+   N  +G Y+CKC     F    C + I+ C   PC +G    +     Y C C +G+    N   + DEC   NPC  GG C +    + C C PG+  +N  C   N      +PC   G C ++   F C C  GF        +    +EC SSPC H  C + L  FEC C  G++     ILP+
Sbjct:   17 NYTCVCPLGFHGHHCQMRAQTCAD-RPCKN----GASCYNTRDGGYQCKCPPE--FQGVNCDVKIDHCRATPCLNGGTCSLTSQDTYQCKCPTGFSG-KNCEVNVDECA-GNPCRNGGTCFDFVNDYKCYCHPGFVGRN--CQR-NVDDCTTNPCANGGTCHDSINDFICTCKPGFTGKDCSQEV----NECSSSPCLHGFCVDKLNDFECKCLPGYSGKHCNILPD 227          

HSP 2 Score: 56.9954 bits (136), Expect = 4.237e-8
Identity = 49/186 (26.34%), Postives = 87/186 (46.77%), Query Frame = 0
Query:  668 NNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIY-----GDC-INTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHG-ECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKN 846
            N  +G +QC C P F              C + I +C        G C + +  ++ C+C  GF   ++  ++++EC  +     G+C +    Y+C C  G++  N    ++++C  NPC +G  C +    + C+C  G+   D   ++ +EC   +PC + G C +K   F+C C PGY  K+
Sbjct:   51 NTRDGGYQCKCPPEFQ----------GVNCDVKIDHCRATPCLNGGTCSLTSQDTYQCKCPTGFS-GKNCEVNVDECAGNPCRNGGTCFDFVNDYKCYCHPGFVGRNCQ-RNVDDCTTNPCANGGTCHDSINDFICTCKPGFTGKD-CSQEVNEC-SSSPC-LHGFCVDKLNDFECKCLPGYSGKH 221          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000097 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-5.182e-11940.31symbol:DDB_G0295485 "EGF-like domain-containing pr... [more]
-3.482e-7833.71symbol:frac "faulty attraction" species:7227 "Dros... [more]
-2.163e-7134.34symbol:FBN3 "Uncharacterized protein" species:9031... [more]
-6.552e-7134.70symbol:fbn2b "fibrillin 2b" species:7955 "Danio re... [more]
-8.120e-7134.59symbol:si:ch73-105b23.1 "si:ch73-105b23.1" species... [more]
-3.004e-7032.84symbol:FBN3 "Uncharacterized protein" species:9913... [more]
-3.256e-7033.85symbol:FBN1 "Fibrillin-1" species:9606 "Homo sapie... [more]
-7.928e-6934.18symbol:FBN3 "Fibrillin-3" species:9606 "Homo sapie... [more]
-9.708e-6933.66symbol:FBN1 "Uncharacterized protein" species:9615... [more]
-1.499e-6833.90symbol:Fbn1 "Fibrillin 1, isoform CRA_a" species:1... [more]

Pages

back to top
BLAST of EMLSAG00000000097 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592792679|gb|GAXK01161889.1|1.125e-17545.48TSA: Calanus finmarchicus comp34802_c1_seq1 transc... [more]
gi|592792678|gb|GAXK01161890.1|2.411e-17345.73TSA: Calanus finmarchicus comp34802_c1_seq2 transc... [more]
gi|592792677|gb|GAXK01161891.1|1.279e-17042.92TSA: Calanus finmarchicus comp34802_c1_seq3 transc... [more]
gi|592792676|gb|GAXK01161892.1|3.463e-15842.52TSA: Calanus finmarchicus comp34802_c1_seq4 transc... [more]
gi|592792675|gb|GAXK01161893.1|9.608e-14550.00TSA: Calanus finmarchicus comp34802_c1_seq5 transc... [more]
gi|592792674|gb|GAXK01161894.1|1.417e-14250.58TSA: Calanus finmarchicus comp34802_c1_seq6 transc... [more]
gi|592952813|gb|GAXK01005740.1|2.668e-8931.83TSA: Calanus finmarchicus comp235550_c0_seq4 trans... [more]
gi|592952815|gb|GAXK01005738.1|2.775e-8931.60TSA: Calanus finmarchicus comp235550_c0_seq2 trans... [more]
gi|592952812|gb|GAXK01005741.1|2.805e-8931.83TSA: Calanus finmarchicus comp235550_c0_seq5 trans... [more]
gi|592952816|gb|GAXK01005737.1|3.596e-8931.60TSA: Calanus finmarchicus comp235550_c0_seq1 trans... [more]

Pages

back to top
BLAST of EMLSAG00000000097 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 18
Match NameE-valueIdentityDescription
EMLSAP000000000970.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1016:5422... [more]
EMLSAP000000003375.332e-10734.49pep:novel supercontig:LSalAtl2s:LSalAtl2s104:50094... [more]
EMLSAP000000024463.334e-4632.34pep:novel supercontig:LSalAtl2s:LSalAtl2s146:20179... [more]
EMLSAP000000034351.665e-2427.65pep:novel supercontig:LSalAtl2s:LSalAtl2s188:58119... [more]
EMLSAP000000087321.118e-2328.09pep:novel supercontig:LSalAtl2s:LSalAtl2s542:45923... [more]
EMLSAP000000044411.981e-2028.44pep:novel supercontig:LSalAtl2s:LSalAtl2s231:58210... [more]
EMLSAP000000098733.367e-1824.84pep:novel supercontig:LSalAtl2s:LSalAtl2s641:17556... [more]
EMLSAP000000116642.789e-1632.44pep:novel supercontig:LSalAtl2s:LSalAtl2s80:828712... [more]
EMLSAP000000034348.392e-1532.82pep:novel supercontig:LSalAtl2s:LSalAtl2s188:57795... [more]
EMLSAP000000086507.294e-1430.15pep:novel supercontig:LSalAtl2s:LSalAtl2s534:33016... [more]

Pages

back to top
BLAST of EMLSAG00000000097 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|296439346|sp|Q75N90.3|FBN3_HUMAN6.168e-6934.18RecName: Full=Fibrillin-3; Contains: RecName: Full... [more]
gi|1042782301|sp|Q61554.2|FBN1_MOUSE9.842e-6933.62RecName: Full=Fibrillin-1; Contains: RecName: Full... [more]
gi|13626617|sp|Q9TV36.1|FBN1_PIG1.238e-6833.76RecName: Full=Fibrillin-1; Contains: RecName: Full... [more]
gi|1042782300|sp|P98133.2|FBN1_BOVIN1.928e-6833.76RecName: Full=Fibrillin-1; AltName: Full=MP340; Co... [more]
gi|311033452|sp|P35555.3|FBN1_HUMAN1.904e-6733.85RecName: Full=Fibrillin-1; Contains: RecName: Full... [more]
gi|341940922|sp|Q8K4G1.2|LTBP4_MOUSE2.424e-6535.21RecName: Full=Latent-transforming growth factor be... [more]
gi|160410003|sp|Q8N2S1.2|LTBP4_HUMAN9.038e-6533.59RecName: Full=Latent-transforming growth factor be... [more]
gi|341940690|sp|Q61555.2|FBN2_MOUSE1.048e-6333.95RecName: Full=Fibrillin-2; Contains: RecName: Full... [more]
gi|238054385|sp|P35556.3|FBN2_HUMAN1.104e-6334.41RecName: Full=Fibrillin-2; Contains: RecName: Full... [more]
gi|296439311|sp|Q14767.3|LTBP2_HUMAN1.462e-6235.31RecName: Full=Latent-transforming growth factor be... [more]

Pages

back to top
BLAST of EMLSAG00000000097 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EFX89291.11.527e-17536.02hypothetical protein DAPPUDRAFT_303147 [Daphnia pu... [more]
XP_016768134.11.451e-12932.20PREDICTED: fibrillin-2 isoform X2 [Apis mellifera][more]
XP_016768135.11.799e-12932.20PREDICTED: fibrillin-2 isoform X3 [Apis mellifera][more]
XP_006561358.11.924e-12932.20PREDICTED: fibrillin-2 isoform X1 [Apis mellifera][more]
XP_016768136.12.895e-12932.20PREDICTED: fibrillin-2 isoform X4 [Apis mellifera][more]
EAA10730.52.881e-12533.92AGAP005714-PA [Anopheles gambiae str. PEST][more]
XP_006561359.15.715e-11033.52PREDICTED: fibrillin-2 isoform X5 [Apis mellifera][more]
gb|EFA01239.2|8.747e-10630.87Fibrillin-1-like Protein [Tribolium castaneum][more]
EEB16551.11.041e-9236.79Fibrillin-3 precursor, putative [Pediculus humanus... [more]
EFX89796.11.593e-8041.65hypothetical protein DAPPUDRAFT_40767, partial [Da... [more]

Pages

back to top
BLAST of EMLSAG00000000097 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|942300243|gb|JAN32054.1|0.000e+031.93Fibulin 1 and [Daphnia magna][more]
gi|942297235|gb|JAN30550.1|0.000e+031.93Fibulin 1 and [Daphnia magna][more]
gi|942326625|gb|JAN45245.1|0.000e+031.79Fibulin 1 and [Daphnia magna][more]
gi|942334123|gb|JAN48994.1|2.593e-17636.90putative Fibrillin-2 [Daphnia magna][more]
gi|942317435|gb|JAN40650.1|3.411e-17636.90putative Fibrillin-2 [Daphnia magna][more]
gi|942327517|gb|JAN45691.1|3.670e-17636.90putative Fibrillin-2 [Daphnia magna][more]
gi|942327515|gb|JAN45690.1|3.719e-17636.90putative Fibrillin-2 [Daphnia magna][more]
gi|942327519|gb|JAN45692.1|4.034e-17636.90putative Fibrillin-2 [Daphnia magna][more]
gi|942368319|gb|JAN66089.1|4.770e-17637.50putative Fibrillin-2 [Daphnia magna][more]
gi|942363719|gb|JAN63789.1|6.193e-17636.90putative Fibrillin-2 [Daphnia magna][more]

Pages

back to top
BLAST of EMLSAG00000000097 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 23