EMLSAG00000000129, EMLSAG00000000129-682895 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592913790|gb|GAXK01044585.1| (TSA: Calanus finmarchicus comp242954_c1_seq1 transcribed RNA sequence) HSP 1 Score: 42.3578 bits (98), Expect = 4.855e-5 Identity = 18/53 (33.96%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 5 DPMFNETLNFEVPPSHLDSSTFVILINQKVNSIEMRELDSIAEDTFENIHEEE 57 DP+FNETLNFEV P LD+S F++ + + ++M ++ + + + ++E Sbjct: 397 DPVFNETLNFEVAPGQLDNSRFLVTLWNRRQVMDMAVMEDMKDAVNHDSSDQE 555
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592913788|gb|GAXK01044587.1| (TSA: Calanus finmarchicus comp242954_c1_seq3 transcribed RNA sequence) HSP 1 Score: 41.9726 bits (97), Expect = 5.684e-5 Identity = 18/53 (33.96%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 5 DPMFNETLNFEVPPSHLDSSTFVILINQKVNSIEMRELDSIAEDTFENIHEEE 57 DP+FNETLNFEV P LD+S F++ + + ++M ++ + + + ++E Sbjct: 355 DPVFNETLNFEVAPGQLDNSRFLVTLWNRRQVMDMTIMEDMKDAVNHDSSDQE 513
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592913789|gb|GAXK01044586.1| (TSA: Calanus finmarchicus comp242954_c1_seq2 transcribed RNA sequence) HSP 1 Score: 39.2762 bits (90), Expect = 4.365e-4 Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 0 Query: 5 DPMFNETLNFEVPPSHLDSSTFVI-LINQK 33 DP+FNETLNFEV P L+ S F++ L N+K Sbjct: 457 DPVFNETLNFEVAPGQLEVSRFLVTLCNRK 546
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592913787|gb|GAXK01044588.1| (TSA: Calanus finmarchicus comp242954_c1_seq4 transcribed RNA sequence) HSP 1 Score: 37.7354 bits (86), Expect = 1.434e-3 Identity = 19/52 (36.54%), Postives = 30/52 (57.69%), Query Frame = 0 Query: 5 DPMFNETLNFEVPPSHLDSSTFVILINQKVNSIEMRELDSIAEDTFENIHEE 56 DP+FNETLNFEV P L+ S F++ + + ++ I ED E +++ Sbjct: 12 DPVFNETLNFEVAPGQLEVSRFLVTLCNRRQVVDTM----IMEDGMEGTNQD 155
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592922741|gb|GAXK01035648.1| (TSA: Calanus finmarchicus comp1372655_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 6.050e+0 Identity = 14/26 (53.85%), Postives = 15/26 (57.69%), Query Frame = 0 Query: 25 TFVILINQKVNSIEMRELDSIAEDTF 50 T IL N VNS+ R DSI DTF Sbjct: 117 TLAILSNYSVNSL*FRLTDSIYVDTF 194
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592922742|gb|GAXK01035647.1| (TSA: Calanus finmarchicus comp1372655_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 6.231e+0 Identity = 14/26 (53.85%), Postives = 15/26 (57.69%), Query Frame = 0 Query: 25 TFVILINQKVNSIEMRELDSIAEDTF 50 T IL N VNS+ R DSI DTF Sbjct: 117 TLAILSNYSVNSL*FRLTDSIYVDTF 194
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592899736|gb|GAXK01058639.1| (TSA: Calanus finmarchicus comp589864_c1_seq6 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.899e+0 Identity = 11/34 (32.35%), Postives = 23/34 (67.65%), Query Frame = 0 Query: 21 LDSSTFVILINQKVNSIEMRELDSIAEDTFENIH 54 +DS +FV + N K ++E ++ + ++TF+N+H Sbjct: 216 MDSRSFVEMRNLKCLTLEGNKISKLEDETFQNLH 317
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592899739|gb|GAXK01058636.1| (TSA: Calanus finmarchicus comp589864_c1_seq3 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.179e+0 Identity = 11/34 (32.35%), Postives = 23/34 (67.65%), Query Frame = 0 Query: 21 LDSSTFVILINQKVNSIEMRELDSIAEDTFENIH 54 +DS +FV + N K ++E ++ + ++TF+N+H Sbjct: 301 MDSRSFVEMRNLKCLTLEGNKISKLEDETFQNLH 402
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Match: gi|592899737|gb|GAXK01058638.1| (TSA: Calanus finmarchicus comp589864_c1_seq5 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.692e+0 Identity = 11/34 (32.35%), Postives = 23/34 (67.65%), Query Frame = 0 Query: 21 LDSSTFVILINQKVNSIEMRELDSIAEDTFENIH 54 +DS +FV + N K ++E ++ + ++TF+N+H Sbjct: 243 MDSRSFVEMRNLKCLTLEGNKISKLEDETFQNLH 344
BLAST of EMLSAG00000000129 vs. L. salmonis peptides
Match: EMLSAP00000000129 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1020:59122:59626:-1 gene:EMLSAG00000000129 transcript:EMLSAT00000000129 description:"maker-LSalAtl2s1020-snap-gene-0.23") HSP 1 Score: 129.413 bits (324), Expect = 1.214e-40 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0 Query: 1 MGKRDPMFNETLNFEVPPSHLDSSTFVILINQKVNSIEMRELDSIAEDTFENIHEEERGSKDT 63 MGKRDPMFNETLNFEVPPSHLDSSTFVILINQKVNSIEMRELDSIAEDTFENIHEEERGSKDT Sbjct: 1 MGKRDPMFNETLNFEVPPSHLDSSTFVILINQKVNSIEMRELDSIAEDTFENIHEEERGSKDT 63 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000129 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000129 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 9
BLAST of EMLSAG00000000129 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000129 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000129 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000129 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000129 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1020:59122..59626- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000129-682895 ID=EMLSAG00000000129-682895|Name=EMLSAG00000000129|organism=Lepeophtheirus salmonis|type=gene|length=505bp|location=Sequence derived from alignment at LSalAtl2s1020:59122..59626- (Lepeophtheirus salmonis)back to top Add to Basket
|