EMLSAG00000000212, EMLSAG00000000212-682978 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000212 vs. GO
Match: - (symbol:GPX7 "AT4G31870" species:3702 "Arabidopsis thaliana" [GO:0004602 "glutathione peroxidase activity" evidence=ISS] [GO:0009507 "chloroplast" evidence=ISM;ISS] [GO:0080167 "response to karrikin" evidence=IEP] [GO:0009407 "toxin catabolic process" evidence=RCA] InterPro:IPR000889 Pfam:PF00255 PIRSF:PIRSF000303 PRINTS:PR01011 PROSITE:PS00460 PROSITE:PS00763 PROSITE:PS51355 GO:GO:0009507 EMBL:CP002687 GO:GO:0006979 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0080167 eggNOG:COG0386 KO:K00432 GO:GO:0004602 PANTHER:PTHR11592 EMBL:AL161579 HOGENOM:HOG000277054 EMBL:AL049607 PIR:T06309 RefSeq:NP_194915.2 UniGene:At.54571 ProteinModelPortal:Q9SZ54 SMR:Q9SZ54 STRING:3702.AT4G31870.1-P PeroxiBase:2250 PaxDb:Q9SZ54 PRIDE:Q9SZ54 EnsemblPlants:AT4G31870.1 GeneID:829316 KEGG:ath:AT4G31870 GeneFarm:2057 TAIR:AT4G31870 InParanoid:Q9SZ54 OMA:VERYQPT BioCyc:ARA:AT4G31870-MONOMER Genevestigator:Q9SZ54 Uniprot:Q9SZ54) HSP 1 Score: 42.743 bits (99), Expect = 3.487e-4 Identity = 21/43 (48.84%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 67 GGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 GG LG+ IKWNF KF+V+K+ V R+ PT S ++E++I+K Sbjct: 188 GGFLGDIIKWNFEKFLVDKKGKVVERYPPTT-SPFQIEKDIQK 229
BLAST of EMLSAG00000000212 vs. GO
Match: - (symbol:GPX4 "Glutathione peroxidase" species:9606 "Homo sapiens" [GO:0004602 "glutathione peroxidase activity" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] InterPro:IPR000889 Pfam:PF00255 PIRSF:PIRSF000303 PRINTS:PR01011 PROSITE:PS00460 PROSITE:PS00763 PROSITE:PS51355 GO:GO:0006979 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0004602 PANTHER:PTHR11592 EMBL:AC004151 HGNC:HGNC:4556 Ensembl:ENST00000587648 Uniprot:K7ERP4) HSP 1 Score: 41.2022 bits (95), Expect = 7.196e-4 Identity = 19/40 (47.50%), Postives = 29/40 (72.50%), Query Frame = 0 Query: 68 GILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEI 107 GILGN IKWNFTKF+++K V R+ P ++ L +E+++ Sbjct: 115 GILGNAIKWNFTKFLIDKNGCVVKRYGP-MEEPLVIEKDL 153
BLAST of EMLSAG00000000212 vs. GO
Match: - (symbol:GPX1 "AT2G25080" species:3702 "Arabidopsis thaliana" [GO:0004602 "glutathione peroxidase activity" evidence=ISS] [GO:0009507 "chloroplast" evidence=ISM;ISS;IDA] [GO:0009941 "chloroplast envelope" evidence=IDA] [GO:0009535 "chloroplast thylakoid membrane" evidence=IDA] [GO:0009570 "chloroplast stroma" evidence=IDA] [GO:0009407 "toxin catabolic process" evidence=RCA] InterPro:IPR000889 Pfam:PF00255 PIRSF:PIRSF000303 PRINTS:PR01011 PROSITE:PS00460 PROSITE:PS00763 PROSITE:PS51355 GO:GO:0009570 EMBL:CP002685 GO:GO:0006979 GO:GO:0009941 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0009535 eggNOG:COG0386 KO:K00432 GO:GO:0004602 PANTHER:PTHR11592 EMBL:X89866 EMBL:AJ000469 EMBL:AY035153 EMBL:AY063024 PIR:A84644 PIR:S71250 RefSeq:NP_180080.1 UniGene:At.24670 ProteinModelPortal:P52032 SMR:P52032 PeroxiBase:2499 PaxDb:P52032 PRIDE:P52032 EnsemblPlants:AT2G25080.1 GeneID:817046 KEGG:ath:AT2G25080 GeneFarm:2047 TAIR:AT2G25080 HOGENOM:HOG000277054 InParanoid:P52032 OMA:EINEFCQ PhylomeDB:P52032 ProtClustDB:PLN02399 BioCyc:ARA:AT2G25080-MONOMER Genevestigator:P52032 GO:GO:0047066 Uniprot:P52032) HSP 1 Score: 41.2022 bits (95), Expect = 9.988e-4 Identity = 20/43 (46.51%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 67 GGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 GG LG IKWNF KF+++K+ V R+ PT S ++E++I+K Sbjct: 191 GGFLGGLIKWNFEKFLIDKKGKVVERYPPTT-SPFQIEKDIQK 232
BLAST of EMLSAG00000000212 vs. C. finmarchicus
Match: gi|592788208|gb|GAXK01166360.1| (TSA: Calanus finmarchicus comp1874_c0_seq1 transcribed RNA sequence) HSP 1 Score: 60.077 bits (144), Expect = 7.486e-11 Identity = 30/46 (65.22%), Postives = 33/46 (71.74%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 +GG L N IKWNFTKFVV+K PV RF PT D I KVE+E KK F Sbjct: 406 QGGFLMNAIKWNFTKFVVDKNGQPVARFGPTDDPIPKVEDECKKYF 543
BLAST of EMLSAG00000000212 vs. C. finmarchicus
Match: gi|592767108|gb|GAXK01187460.1| (TSA: Calanus finmarchicus comp10997_c0_seq1 transcribed RNA sequence) HSP 1 Score: 60.077 bits (144), Expect = 1.082e-10 Identity = 29/42 (69.05%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEI 107 EGG+LG+ IKWNFTKFVV+KE PV RF P D I KVE+EI Sbjct: 502 EGGLLGSAIKWNFTKFVVDKEGKPVARFGPMDDPIPKVEKEI 627
BLAST of EMLSAG00000000212 vs. C. finmarchicus
Match: gi|592776079|gb|GAXK01178489.1| (TSA: Calanus finmarchicus comp14152_c1_seq1 transcribed RNA sequence) HSP 1 Score: 53.5286 bits (127), Expect = 6.800e-9 Identity = 29/48 (60.42%), Postives = 31/48 (64.58%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAFEE 113 + G L N IKWNFTKFVV+K PV RF P D I VE EIKK F E Sbjct: 148 QSGFLINAIKWNFTKFVVDKTGRPVARFGPMDDPIPAVENEIKKHF*E 291
BLAST of EMLSAG00000000212 vs. C. finmarchicus
Match: gi|592840363|gb|GAXK01117181.1| (TSA: Calanus finmarchicus comp303918_c3_seq1 transcribed RNA sequence) HSP 1 Score: 35.039 bits (79), Expect = 5.470e-2 Identity = 21/51 (41.18%), Postives = 29/51 (56.86%), Query Frame = 0 Query: 68 GILGN-FIKWNFTKFVVNKEEVPVFRFAP------TLDSILKVEEEIKKAF 111 GI G +IKW+FTKF+V+++ R AP L VE+E+KK F Sbjct: 415 GIFGTKYIKWSFTKFIVDRKGKVQVRLAPFVYPQQPLSGFPSVEDELKKYF 567
BLAST of EMLSAG00000000212 vs. C. finmarchicus
Match: gi|592922064|gb|GAXK01036325.1| (TSA: Calanus finmarchicus comp3639924_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 1.665e+0 Identity = 26/87 (29.89%), Postives = 43/87 (49.43%), Query Frame = 0 Query: 1 MTYIAIKNKQEICYHVSGFSKCCDISKYWKLNEIGLTLKIPLSIEDQCTQRI-FEFSLRRPENGA-------IEGGILG-NFIKWNF 78 M+ I++ + + + + FS DIS + + LTL++ LS+E C I F F + + NG I+ +L FIK+NF Sbjct: 288 MSTISVFSSNSLFFTLLRFSNWLDISSFCLVTSSILTLRLSLSLEMDCMSFISFLFLIVQILNGVFKYLICLIQTFMLTFYFIKFNF 548
BLAST of EMLSAG00000000212 vs. L. salmonis peptides
Match: EMLSAP00000000212 (pep:novel supercontig:LSalAtl2s:LSalAtl2s102:916783:945859:-1 gene:EMLSAG00000000212 transcript:EMLSAT00000000212 description:"snap_masked-LSalAtl2s102-processed-gene-9.2") HSP 1 Score: 301.597 bits (771), Expect = 7.414e-106 Identity = 147/147 (100.00%), Postives = 147/147 (100.00%), Query Frame = 0 Query: 1 MTYIAIKNKQEICYHVSGFSKCCDISKYWKLNEIGLTLKIPLSIEDQCTQRIFEFSLRRPENGAIEGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAFEEKLPKFLMTSSTTSFVFKVVANGTTQWYIKRWTLL 147 MTYIAIKNKQEICYHVSGFSKCCDISKYWKLNEIGLTLKIPLSIEDQCTQRIFEFSLRRPENGAIEGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAFEEKLPKFLMTSSTTSFVFKVVANGTTQWYIKRWTLL Sbjct: 1 MTYIAIKNKQEICYHVSGFSKCCDISKYWKLNEIGLTLKIPLSIEDQCTQRIFEFSLRRPENGAIEGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAFEEKLPKFLMTSSTTSFVFKVVANGTTQWYIKRWTLL 147
BLAST of EMLSAG00000000212 vs. L. salmonis peptides
Match: EMLSAP00000012945 (pep:novel supercontig:LSalAtl2s:LSalAtl2s988:134097:136027:1 gene:EMLSAG00000012945 transcript:EMLSAT00000012945 description:"snap-LSalAtl2s988-processed-gene-1.74") HSP 1 Score: 69.3218 bits (168), Expect = 3.513e-16 Identity = 32/43 (74.42%), Postives = 37/43 (86.05%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIK 108 +GG LGNFIKWNFTKFVV+K+ VPV RFAPT D + KVEEEI+ Sbjct: 23 QGGTLGNFIKWNFTKFVVDKKGVPVARFAPTQDPLPKVEEEIR 65
BLAST of EMLSAG00000000212 vs. SwissProt
Match: gi|544437|sp|Q06652.1|GPX4_CITSI (RecName: Full=Probable phospholipid hydroperoxide glutathione peroxidase; Short=PHGPx; AltName: Full=Salt-associated protein) HSP 1 Score: 50.447 bits (119), Expect = 2.496e-7 Identity = 25/47 (53.19%), Postives = 35/47 (74.47%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAFE 112 +GG+ G+ IKWNF+KF+V+KE V R+APT S L +E++IKK E Sbjct: 120 KGGLFGDSIKWNFSKFLVDKEGNVVERYAPTT-SPLSIEKDIKKLLE 165
BLAST of EMLSAG00000000212 vs. SwissProt
Match: gi|3913793|sp|O23968.1|GPX4_HELAN (RecName: Full=Probable phospholipid hydroperoxide glutathione peroxidase; Short=PHGPx; AltName: Full=Glutathione peroxidase 2) HSP 1 Score: 49.6766 bits (117), Expect = 5.930e-7 Identity = 25/44 (56.82%), Postives = 34/44 (77.27%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 +GG LG+ IKWNFTKF+V++E V R+APT S L +E++IKK Sbjct: 133 KGGFLGDSIKWNFTKFLVDREGKVVDRYAPTT-SPLSIEKDIKK 175
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: AAN11562.1 (PHGPx, isoform D [Drosophila melanogaster]) HSP 1 Score: 54.6842 bits (130), Expect = 7.608e-9 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 64 AIEGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 A + G LG+ IKWNFTKF+VNKE VP+ R+APT D + + ++I+K Sbjct: 192 AKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDP-MDIAKDIEK 236
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: AAF47761.1 (PHGPx, isoform A [Drosophila melanogaster]) HSP 1 Score: 53.5286 bits (127), Expect = 9.924e-9 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 64 AIEGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 A + G LG+ IKWNFTKF+VNKE VP+ R+APT D + + ++I+K Sbjct: 123 AKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDP-MDIAKDIEK 167
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: AAN11561.1 (PHGPx, isoform C [Drosophila melanogaster]) HSP 1 Score: 53.5286 bits (127), Expect = 1.349e-8 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 64 AIEGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 A + G LG+ IKWNFTKF+VNKE VP+ R+APT D + + ++I+K Sbjct: 152 AKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDP-MDIAKDIEK 196
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: EAA08535.3 (AGAP004247-PB [Anopheles gambiae str. PEST]) HSP 1 Score: 52.373 bits (124), Expect = 2.472e-8 Identity = 21/31 (67.74%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPT 96 +GGILG+ IKWNF+KF+VNK+ PV R+APT Sbjct: 122 QGGILGDSIKWNFSKFLVNKDGQPVDRYAPT 152
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: gb|EFA01370.1| (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial-like Protein [Tribolium castaneum]) HSP 1 Score: 50.447 bits (119), Expect = 1.073e-7 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLD 98 +GG LGNFIKWNFTKF+V+KE PV R P+ + Sbjct: 124 QGGTLGNFIKWNFTKFIVDKEGQPVERHGPSTN 156
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: EAA44749.3 (AGAP004247-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 50.0618 bits (118), Expect = 1.998e-7 Identity = 20/31 (64.52%), Postives = 25/31 (80.65%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPT 96 +GG LG+ IKWNF KF+VNK+ PV R+APT Sbjct: 122 QGGTLGDSIKWNFAKFLVNKDGQPVDRYAPT 152
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: EGK97029.1 (AGAP004247-PC [Anopheles gambiae str. PEST]) HSP 1 Score: 49.6766 bits (117), Expect = 3.216e-7 Identity = 20/31 (64.52%), Postives = 25/31 (80.65%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPT 96 +GG LG+ IKWNF KF+VNK+ PV R+APT Sbjct: 157 QGGTLGDSIKWNFAKFLVNKDGQPVDRYAPT 187
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: NP_001171493.1 (glutathione peroxidase-like 1 [Apis mellifera]) HSP 1 Score: 48.1358 bits (113), Expect = 8.272e-7 Identity = 21/32 (65.62%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTL 97 +GGILG+FIKWNFTKF+VNKE V R P + Sbjct: 124 QGGILGDFIKWNFTKFIVNKEGKVVERHGPNV 155
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Match: NP_001171492.1 (glutathione peroxidase-like 1 [Apis mellifera]) HSP 1 Score: 48.1358 bits (113), Expect = 8.272e-7 Identity = 21/32 (65.62%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTL 97 +GGILG+FIKWNFTKF+VNKE V R P + Sbjct: 124 QGGILGDFIKWNFTKFIVNKEGKVVERHGPNV 155
BLAST of EMLSAG00000000212 vs. nr
Match: gi|669193605|gb|AII16508.1| (phospholipid-hydroperoxide glutathione peroxidase, partial [Paracyclopina nana]) HSP 1 Score: 70.4774 bits (171), Expect = 6.098e-13 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 +GG LGNFIKWNFTKFVV+KE PV RFAPT D I KVEE IKK F Sbjct: 81 QGGTLGNFIKWNFTKFVVDKEGKPVGRFAPTDDPIPKVEEAIKKLF 126
BLAST of EMLSAG00000000212 vs. nr
Match: gi|319738717|gb|ADV59549.1| (phospholipid-hydroperoxide glutathione peroxidase [Paracyclopina nana]) HSP 1 Score: 72.0182 bits (175), Expect = 8.355e-13 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 +GG LGNFIKWNFTKFVV+KE PV RFAPT D I KVEE IKK F Sbjct: 155 QGGTLGNFIKWNFTKFVVDKEGKPVGRFAPTDDPIPKVEEAIKKLF 200
BLAST of EMLSAG00000000212 vs. nr
Match: gi|961375902|gb|ALS04695.1| (phospholipid-hydroperoxide glutathione peroxidase [Pseudodiaptomus poplesia]) HSP 1 Score: 62.3882 bits (150), Expect = 1.961e-9 Identity = 32/46 (69.57%), Postives = 34/46 (73.91%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 + G L N IKWNFTKFV+NKE V RFAPT D I KVEEEIKK F Sbjct: 116 QAGFLVNAIKWNFTKFVINKEGQAVARFAPTDDPIPKVEEEIKKHF 161
BLAST of EMLSAG00000000212 vs. nr
Match: gi|1067068062|ref|XP_018024412.1| (PREDICTED: phospholipid hydroperoxide glutathione peroxidase, mitochondrial-like isoform X2 [Hyalella azteca] >gi|1067068064|ref|XP_018024420.1| PREDICTED: phospholipid hydroperoxide glutathione peroxidase, mitochondrial-like isoform X2 [Hyalella azteca] >gi|1067068066|ref|XP_018024428.1| PREDICTED: phospholipid hydroperoxide glutathione peroxidase, mitochondrial-like isoform X2 [Hyalella azteca]) HSP 1 Score: 60.4622 bits (145), Expect = 1.025e-8 Identity = 27/44 (61.36%), Postives = 35/44 (79.55%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 +GG+LG+FIKWNFTKFVV+K VPV R +P + I VE++IKK Sbjct: 117 QGGLLGDFIKWNFTKFVVDKNGVPVSRHSPKTNPIPDVEKDIKK 160
BLAST of EMLSAG00000000212 vs. nr
Match: gi|1067068060|ref|XP_018024407.1| (PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase isoform X1 [Hyalella azteca]) HSP 1 Score: 60.4622 bits (145), Expect = 1.388e-8 Identity = 27/44 (61.36%), Postives = 35/44 (79.55%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 +GG+LG+FIKWNFTKFVV+K VPV R +P + I VE++IKK Sbjct: 146 QGGLLGDFIKWNFTKFVVDKNGVPVSRHSPKTNPIPDVEKDIKK 189
BLAST of EMLSAG00000000212 vs. nr
Match: gi|155966312|gb|ABU41109.1| (phospholipid-hydroperoxide glutathione peroxidase [Lepeophtheirus salmonis]) HSP 1 Score: 60.077 bits (144), Expect = 1.963e-8 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 +GG G+FIKW+FTKFV++K+ VPV RF+ D I VEEEIKK F Sbjct: 139 QGGTFGDFIKWSFTKFVIDKDGVPVARFSTAQDPIPIVEEEIKKYF 184
BLAST of EMLSAG00000000212 vs. nr
Match: gi|155966240|gb|ABU41074.1| (phospholipid-hydroperoxide glutathione peroxidase, partial [Lepeophtheirus salmonis]) HSP 1 Score: 58.5362 bits (140), Expect = 8.825e-8 Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 +GG G+FIKW+FTKFV++K+ VPV RF+ D I VE+EIKK F Sbjct: 150 QGGTFGDFIKWSFTKFVIDKDGVPVARFSTAQDPIPIVEKEIKKYF 195
BLAST of EMLSAG00000000212 vs. nr
Match: gi|1121791156|gb|APP91324.1| (phospholipid-hydroperoxide glutathione peroxidase [Penaeus monodon]) HSP 1 Score: 57.7658 bits (138), Expect = 9.252e-8 Identity = 24/44 (54.55%), Postives = 35/44 (79.55%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKK 109 +GG LGNFIKWNFTKF+V+KE PV R++P + I +E++++K Sbjct: 117 QGGTLGNFIKWNFTKFLVDKEGNPVARYSPQTNPIPAIEKDLQK 160
BLAST of EMLSAG00000000212 vs. nr
Match: gi|1005952894|ref|XP_015784829.1| (PREDICTED: glutathione peroxidase 1-like [Tetranychus urticae]) HSP 1 Score: 56.6102 bits (135), Expect = 3.395e-7 Identity = 27/49 (55.10%), Postives = 38/49 (77.55%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAFEEK 114 +GG+LG+FIKWNFTKF+ NKE VPV R++PT + ++E++I EEK Sbjct: 127 QGGMLGDFIKWNFTKFLCNKEGVPVKRYSPTTEPN-QIEKDIVGLLEEK 174
BLAST of EMLSAG00000000212 vs. nr
Match: gi|239938981|gb|ACS36133.1| (PH glutathione peroxidase, partial [Tigriopus japonicus]) HSP 1 Score: 53.9138 bits (128), Expect = 4.356e-7 Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 + G + N IKWNF+KFV+NKE V RF+PT D I KVEE++K+ F Sbjct: 24 QSGFMINAIKWNFSKFVINKEGKAVARFSPTDDPIPKVEEKVKELF 69
BLAST of EMLSAG00000000212 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold375_size191602-snap-gene-0.36 (protein:Tk05044 transcript:maker-scaffold375_size191602-snap-gene-0.36-mRNA-1 annotation:"glutathione peroxidase") HSP 1 Score: 53.9138 bits (128), Expect = 1.655e-10 Identity = 26/46 (56.52%), Postives = 33/46 (71.74%), Query Frame = 0 Query: 66 EGGILGNFIKWNFTKFVVNKEEVPVFRFAPTLDSILKVEEEIKKAF 111 + G + N IKWNFTKFV+NKE V RF PT D I KVE+++K+ F Sbjct: 69 QSGFMINAIKWNFTKFVINKEGKAVVRFGPTDDPIPKVEDKVKELF 114 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000212 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 13
Pagesback to top
BLAST of EMLSAG00000000212 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 5
BLAST of EMLSAG00000000212 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000000212 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 2
BLAST of EMLSAG00000000212 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 9
BLAST of EMLSAG00000000212 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 14
Pagesback to top
BLAST of EMLSAG00000000212 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s102:916783..945859- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000212-682978 ID=EMLSAG00000000212-682978|Name=EMLSAG00000000212|organism=Lepeophtheirus salmonis|type=gene|length=29077bp|location=Sequence derived from alignment at LSalAtl2s102:916783..945859- (Lepeophtheirus salmonis)back to top Add to Basket
|