EMLSAG00000000359, EMLSAG00000000359-683125 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592852220|gb|GAXK01105324.1| (TSA: Calanus finmarchicus comp185913_c1_seq3 transcribed RNA sequence) HSP 1 Score: 46.9802 bits (110), Expect = 3.282e-6 Identity = 33/108 (30.56%), Postives = 58/108 (53.70%), Query Frame = 0 Query: 1 MEVSNNSQLLKRVRSDRCL--CPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVXXXXXXXXXXXXYQTIREKLSESNEYFILSENKRLVELRIRYLKEIIAE 106 ++ + NS++ K + + CL CPLC + R+ FYC C+ GDF HS+ E +EK ++L + ++ I + S + L E+ +L +I+YLK +I + Sbjct: 177 LQRNGNSKICKPM-TQSCLPQCPLCSSKRSNFYCATCVISGDFVHSSTKLFERFSEKNLRLFALQREINESKSAIELRTSRNWTAQQLKEDIKLSRTKIKYLKHVIKQ 497
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592852221|gb|GAXK01105323.1| (TSA: Calanus finmarchicus comp185913_c1_seq2 transcribed RNA sequence) HSP 1 Score: 46.9802 bits (110), Expect = 3.282e-6 Identity = 33/108 (30.56%), Postives = 58/108 (53.70%), Query Frame = 0 Query: 1 MEVSNNSQLLKRVRSDRCL--CPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVXXXXXXXXXXXXYQTIREKLSESNEYFILSENKRLVELRIRYLKEIIAE 106 ++ + NS++ K + + CL CPLC + R+ FYC C+ GDF HS+ E +EK ++L + ++ I + S + L E+ +L +I+YLK +I + Sbjct: 177 LQRNGNSKICKPM-TQSCLPQCPLCSSKRSNFYCATCVISGDFVHSSTKLFERFSEKNLRLFALQREINESKSAIELRTSRNWTAQQLKEDIKLSRTKIKYLKHVIKQ 497
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592852222|gb|GAXK01105322.1| (TSA: Calanus finmarchicus comp185913_c1_seq1 transcribed RNA sequence) HSP 1 Score: 46.9802 bits (110), Expect = 3.392e-6 Identity = 33/108 (30.56%), Postives = 58/108 (53.70%), Query Frame = 0 Query: 1 MEVSNNSQLLKRVRSDRCL--CPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVXXXXXXXXXXXXYQTIREKLSESNEYFILSENKRLVELRIRYLKEIIAE 106 ++ + NS++ K + + CL CPLC + R+ FYC C+ GDF HS+ E +EK ++L + ++ I + S + L E+ +L +I+YLK +I + Sbjct: 177 LQRNGNSKICKPM-TQSCLPQCPLCSSKRSNFYCATCVISGDFVHSSTKLFERFSEKNLRLFALQREINESKSAIELRTSRNWTAQQLKEDIKLSRTKIKYLKHVIKQ 497
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592831516|gb|GAXK01126028.1| (TSA: Calanus finmarchicus comp605470_c0_seq3 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 3.546e-1 Identity = 14/36 (38.89%), Postives = 20/36 (55.56%), Query Frame = 0 Query: 13 VRSDRCLCPLCYNPRATFYCYECIKFGDF--SHSNP 46 R++ CPLC + FYC +C+ G F S S+P Sbjct: 58 ARANLVHCPLCSLRMSKFYCVDCVISGHFIPSRSDP 165
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592831515|gb|GAXK01126029.1| (TSA: Calanus finmarchicus comp605470_c0_seq4 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 3.618e-1 Identity = 14/36 (38.89%), Postives = 20/36 (55.56%), Query Frame = 0 Query: 13 VRSDRCLCPLCYNPRATFYCYECIKFGDF--SHSNP 46 R++ CPLC + FYC +C+ G F S S+P Sbjct: 58 ARANLVHCPLCSLRMSKFYCVDCVISGHFIPSRSDP 165
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592831517|gb|GAXK01126027.1| (TSA: Calanus finmarchicus comp605470_c0_seq2 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 3.780e-1 Identity = 14/36 (38.89%), Postives = 20/36 (55.56%), Query Frame = 0 Query: 13 VRSDRCLCPLCYNPRATFYCYECIKFGDF--SHSNP 46 R++ CPLC + FYC +C+ G F S S+P Sbjct: 58 ARANLVHCPLCSLRMSKFYCVDCVISGHFIPSRSDP 165
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592831518|gb|GAXK01126026.1| (TSA: Calanus finmarchicus comp605470_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 3.892e-1 Identity = 14/36 (38.89%), Postives = 20/36 (55.56%), Query Frame = 0 Query: 13 VRSDRCLCPLCYNPRATFYCYECIKFGDF--SHSNP 46 R++ CPLC + FYC +C+ G F S S+P Sbjct: 58 ARANLVHCPLCSLRMSKFYCVDCVISGHFIPSRSDP 165
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592791044|gb|GAXK01163524.1| (TSA: Calanus finmarchicus comp1918931_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 3.462e+0 Identity = 14/26 (53.85%), Postives = 19/26 (73.08%), Query Frame = 0 Query: 73 IREKLSESNEYFILSENKRLVELRIR 98 I K+ ESN ++ILSEN VE++IR Sbjct: 812 IVRKIKESNLHYILSENAFSVEIKIR 889
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592791043|gb|GAXK01163525.1| (TSA: Calanus finmarchicus comp1918931_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 3.591e+0 Identity = 14/26 (53.85%), Postives = 19/26 (73.08%), Query Frame = 0 Query: 73 IREKLSESNEYFILSENKRLVELRIR 98 I K+ ESN ++ILSEN VE++IR Sbjct: 796 IVRKIKESNLHYILSENAFSVEIKIR 873
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Match: gi|592831513|gb|GAXK01126031.1| (TSA: Calanus finmarchicus comp605470_c0_seq6 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 7.295e+0 Identity = 22/77 (28.57%), Postives = 36/77 (46.75%), Query Frame = 0 Query: 30 FYCYECIKFGDFSH--SNPLKNEILAEKRVXXXXXXXXXXXXYQTIREKLSESNEYFILSENKRLVELRIRYLKEII 104 FYC +C+ G F H S+ L E +EK ++L + I +K I+ E L ++R +YL+E + Sbjct: 2 FYCVDCVTNGHFIHSRSDLLCYETFSEKSIRLFALQKDILETKNEIEDKNKIVWRTEIIREEIELSKIRAKYLREAV 232
BLAST of EMLSAG00000000359 vs. L. salmonis peptides
Match: EMLSAP00000000359 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1053:121750:122179:-1 gene:EMLSAG00000000359 transcript:EMLSAT00000000359 description:"snap_masked-LSalAtl2s1053-processed-gene-0.16") HSP 1 Score: 218.779 bits (556), Expect = 1.918e-74 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 0 Query: 1 MEVSNNSQLLKRVRSDRCLCPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVKLKGFSLKSSKFYQTIREKLSESNEYFILSENKRLVELRIRYLKEIIAEKSN 109 MEVSNNSQLLKRVRSDRCLCPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVKLKGFSLKSSKFYQTIREKLSESNEYFILSENKRLVELRIRYLKEIIAEKSN Sbjct: 1 MEVSNNSQLLKRVRSDRCLCPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVKLKGFSLKSSKFYQTIREKLSESNEYFILSENKRLVELRIRYLKEIIAEKSN 109
BLAST of EMLSAG00000000359 vs. Select Arthropod Genomes
Match: XP_396142.4 (PREDICTED: beclin 1-associated autophagy-related key regulator [Apis mellifera]) HSP 1 Score: 50.8322 bits (120), Expect = 7.544e-8 Identity = 20/40 (50.00%), Postives = 29/40 (72.50%), Query Frame = 0 Query: 20 CPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVKL 59 CPLC+N R FYC +CI+ GDF HS + +E A+K+++L Sbjct: 36 CPLCHNSRRIFYCRQCIQNGDFIHSTSVYSERFADKQLRL 75
BLAST of EMLSAG00000000359 vs. nr
Match: gi|926645239|ref|XP_013788913.1| (PREDICTED: beclin 1-associated autophagy-related key regulator-like [Limulus polyphemus]) HSP 1 Score: 55.4546 bits (132), Expect = 9.266e-7 Identity = 34/97 (35.05%), Postives = 57/97 (58.76%), Query Frame = 0 Query: 20 CPLCYNPRATFYCYECIKFGDFSHSNPLKNEILAEKRVKLKGFSLKSSKFYQTIREKLSESNEYFILSENKR-------LVELRIRYLKEII-AEKS 108 CPLC++ + F+C +CI+ GDF+HS E AEK++KL S + S ++ +++ S + + L+ K+ L+EL ++ KEI+ AEKS Sbjct: 38 CPLCFHSKRAFFCQDCIRNGDFTHSKSRYPERYAEKKLKLFKGSQEKSVLLESCKDRFSSQSRFRHLASKKQQILRRIELLELSLKENKEILQAEKS 134 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000359 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000359 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 11
Pagesback to top
BLAST of EMLSAG00000000359 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000359 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000359 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 1
BLAST of EMLSAG00000000359 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 1
BLAST of EMLSAG00000000359 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1053:121750..122179- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000359-683125 ID=EMLSAG00000000359-683125|Name=EMLSAG00000000359|organism=Lepeophtheirus salmonis|type=gene|length=430bp|location=Sequence derived from alignment at LSalAtl2s1053:121750..122179- (Lepeophtheirus salmonis)back to top Add to Basket
|