EMLSAG00000000372, EMLSAG00000000372-683138 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000372 vs. C. finmarchicus
Match: gi|592779407|gb|GAXK01175161.1| (TSA: Calanus finmarchicus comp3849_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.431e+0 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 0 Query: 24 SRYALLIVKCFDKN 37 SR ALL+VKCFD N Sbjct: 813 SRAALLVVKCFDTN 854
BLAST of EMLSAG00000000372 vs. C. finmarchicus
Match: gi|592829921|gb|GAXK01127623.1| (TSA: Calanus finmarchicus comp170923_c2_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.621e+0 Identity = 16/54 (29.63%), Postives = 28/54 (51.85%), Query Frame = 0 Query: 17 FSMLVLQSRYALLIVKCFDKNCCEPLRTNWN----RVFPYRFFPTPLVYKYGTS 66 F ++ LQS L+I+ N + ++ +N VFP+R FPT + G++ Sbjct: 484 FKLMNLQSVSGLIILITNIANMFKSIKMGFNVRL*LVFPFRLFPTLPTFPQGST 645
BLAST of EMLSAG00000000372 vs. C. finmarchicus
Match: gi|592753767|gb|GAXK01200646.1| (TSA: Calanus finmarchicus comp365683_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.506e+0 Identity = 14/32 (43.75%), Postives = 16/32 (50.00%), Query Frame = 0 Query: 33 CFDKNCCEPLRTNWNR-VFPYRFFPTPLVYKY 63 C NC L W++ FP FP PL YKY Sbjct: 375 CLPDNCL--LTEKWHKGCFPLTLFPAPLGYKY 464
BLAST of EMLSAG00000000372 vs. L. salmonis peptides
Match: EMLSAP00000000372 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1056:392725:394192:1 gene:EMLSAG00000000372 transcript:EMLSAT00000000372 description:"maker-LSalAtl2s1056-snap-gene-2.22") HSP 1 Score: 143.665 bits (361), Expect = 3.882e-46 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0 Query: 1 MLKDCRETFEEPSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSGL 68 MLKDCRETFEEPSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSGL Sbjct: 1 MLKDCRETFEEPSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSGL 68
BLAST of EMLSAG00000000372 vs. Select Arthropod Genomes
Match: EFX81466.1 (hypothetical protein DAPPUDRAFT_317650 [Daphnia pulex]) HSP 1 Score: 50.447 bits (119), Expect = 3.066e-8 Identity = 24/62 (38.71%), Postives = 30/62 (48.39%), Query Frame = 0 Query: 7 ETFEEPSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSGL 68 E +KWFS V S+Y IVKC D CC R+++ V P RF P P+ GL Sbjct: 568 ENLVTKDSKWFSQHVRTSQYFTQIVKCLDVTCCAKPRSSYFTVVPGRFIPPPIPIYQSADGL 629
BLAST of EMLSAG00000000372 vs. nr
Match: gi|828225853|ref|XP_012563449.1| (PREDICTED: uncharacterized protein LOC105848061 [Hydra vulgaris]) HSP 1 Score: 63.5438 bits (153), Expect = 2.722e-10 Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 0 Query: 12 PSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSG 67 P W QSRY+L IVKC +++CC P TNW + FP RF P P +Y+Y +G Sbjct: 360 PDPVWVDKHCQQSRYSLQIVKCQEESCCTPFETNWLKNFPQRFIPFPAIYEYCENG 415
BLAST of EMLSAG00000000372 vs. nr
Match: gi|828227748|ref|XP_012564059.1| (PREDICTED: uncharacterized protein LOC105848481, partial [Hydra vulgaris]) HSP 1 Score: 60.8474 bits (146), Expect = 2.913e-9 Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 0 Query: 12 PSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSG 67 P W QSRY+L IVKC +++CC P TNW + FP RF P P +Y+Y +G Sbjct: 408 PDPVWVDKHCQQSRYSLQIVKCQEESCCTPFETNWLKNFPQRFIPFPAIYEYCENG 463
BLAST of EMLSAG00000000372 vs. nr
Match: gi|675864614|ref|XP_009017867.1| (hypothetical protein HELRODRAFT_172961 [Helobdella robusta] >gi|555700698|gb|ESO03931.1| hypothetical protein HELRODRAFT_172961 [Helobdella robusta]) HSP 1 Score: 57.7658 bits (138), Expect = 3.025e-8 Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = 0 Query: 9 FEEPSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSGL 68 + P WF+ V QS+Y L I+KC + CC R+++N +FP+RF P P+ Y +G+ Sbjct: 374 LQAPPNDWFASHVRQSQYCLHIIKCNTEACCGLKRSHFNEIFPHRFLPPPIPYIITKTGI 433
BLAST of EMLSAG00000000372 vs. nr
Match: gi|170067470|ref|XP_001868493.1| (conserved hypothetical protein [Culex quinquefasciatus] >gi|167863617|gb|EDS27000.1| conserved hypothetical protein [Culex quinquefasciatus]) HSP 1 Score: 57.7658 bits (138), Expect = 3.155e-8 Identity = 26/62 (41.94%), Postives = 37/62 (59.68%), Query Frame = 0 Query: 7 ETFEEPSAKWFSMLVLQSRYALLIVKCFDKNCCEPLRTNWNRVFPYRFFPTPLVYKYGTSGL 68 E+ E WFS V S+Y L IVKC +++CC PLR++ + V P RF P P+ + + GL Sbjct: 660 ESLECRDQCWFSNHVRTSQYMLQIVKCDNRSCCSPLRSSLSTVLPGRFLPPPIPLIHSSDGL 721 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000372 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000372 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 13
Pagesback to top
BLAST of EMLSAG00000000372 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000372 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000372 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 1
BLAST of EMLSAG00000000372 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 4
BLAST of EMLSAG00000000372 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1056:392725..394192+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000372-683138 ID=EMLSAG00000000372-683138|Name=EMLSAG00000000372|organism=Lepeophtheirus salmonis|type=gene|length=1468bp|location=Sequence derived from alignment at LSalAtl2s1056:392725..394192+ (Lepeophtheirus salmonis)back to top Add to Basket
|