EMLSAG00000000493, EMLSAG00000000493-683259 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938392|gb|GAXK01020161.1| (TSA: Calanus finmarchicus comp13458_c2_seq10 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.866e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 2853 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 2948
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938393|gb|GAXK01020160.1| (TSA: Calanus finmarchicus comp13458_c2_seq9 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.869e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 2918 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3013
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938394|gb|GAXK01020159.1| (TSA: Calanus finmarchicus comp13458_c2_seq8 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.872e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 2997 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3092
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938395|gb|GAXK01020158.1| (TSA: Calanus finmarchicus comp13458_c2_seq7 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.873e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 3013 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3108
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938396|gb|GAXK01020157.1| (TSA: Calanus finmarchicus comp13458_c2_seq6 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.874e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 3036 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3131
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938397|gb|GAXK01020156.1| (TSA: Calanus finmarchicus comp13458_c2_seq5 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.874e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 3052 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3147
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938398|gb|GAXK01020155.1| (TSA: Calanus finmarchicus comp13458_c2_seq4 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.874e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 3062 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3157
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938399|gb|GAXK01020154.1| (TSA: Calanus finmarchicus comp13458_c2_seq3 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.875e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 3078 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3173
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938400|gb|GAXK01020153.1| (TSA: Calanus finmarchicus comp13458_c2_seq2 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.876e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 3101 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3196
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Match: gi|592938401|gb|GAXK01020152.1| (TSA: Calanus finmarchicus comp13458_c2_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.876e+0 Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 12 PCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGF 43 P VL+ + +VL R +I V+P LQ C F Sbjct: 3117 PVHQVLQPVALQEVLERFLIVLVVPKLQGCAF 3212
BLAST of EMLSAG00000000493 vs. L. salmonis peptides
Match: EMLSAP00000000493 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1076:398335:400148:1 gene:EMLSAG00000000493 transcript:EMLSAT00000000493 description:"snap_masked-LSalAtl2s1076-processed-gene-3.3") HSP 1 Score: 140.198 bits (352), Expect = 8.065e-45 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0 Query: 1 MEESQKWNTQSPCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGFVGNHCVMALSAKVILRISDMVSKF 67 MEESQKWNTQSPCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGFVGNHCVMALSAKVILRISDMVSKF Sbjct: 1 MEESQKWNTQSPCWTVLKNLVNYDVLIRMMIQFVIPVLQNCGFVGNHCVMALSAKVILRISDMVSKF 67 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000493 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000493 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 13
Pagesback to top
BLAST of EMLSAG00000000493 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000493 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000493 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000493 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000493 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1076:398335..400148+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000493-683259 ID=EMLSAG00000000493-683259|Name=EMLSAG00000000493|organism=Lepeophtheirus salmonis|type=gene|length=1814bp|location=Sequence derived from alignment at LSalAtl2s1076:398335..400148+ (Lepeophtheirus salmonis)back to top Add to Basket
|