EMLSAG00000000549, EMLSAG00000000549-683315 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801224|gb|GAXK01153344.1| (TSA: Calanus finmarchicus comp545310_c0_seq29 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.983e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 2689 NQWPLHMKTKDLFLFIELRCPYFTLST 2769
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801225|gb|GAXK01153343.1| (TSA: Calanus finmarchicus comp545310_c0_seq28 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.984e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 2689 NQWPLHMKTKDLFLFIELRCPYFTLST 2769
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801226|gb|GAXK01153342.1| (TSA: Calanus finmarchicus comp545310_c0_seq27 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.985e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 2689 NQWPLHMKTKDLFLFIELRCPYFTLST 2769
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801227|gb|GAXK01153341.1| (TSA: Calanus finmarchicus comp545310_c0_seq26 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.999e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 2689 NQWPLHMKTKDLFLFIELRCPYFTLST 2769
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801228|gb|GAXK01153340.1| (TSA: Calanus finmarchicus comp545310_c0_seq25 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.008e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 2689 NQWPLHMKTKDLFLFIELRCPYFTLST 2769
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801229|gb|GAXK01153339.1| (TSA: Calanus finmarchicus comp545310_c0_seq24 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.008e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 2689 NQWPLHMKTKDLFLFIELRCPYFTLST 2769
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801230|gb|GAXK01153338.1| (TSA: Calanus finmarchicus comp545310_c0_seq23 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.008e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 2689 NQWPLHMKTKDLFLFIELRCPYFTLST 2769
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801231|gb|GAXK01153337.1| (TSA: Calanus finmarchicus comp545310_c0_seq22 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.016e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 3531 NQWPLHMKTKDLFLFIELRCPYFTLST 3611
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801232|gb|GAXK01153336.1| (TSA: Calanus finmarchicus comp545310_c0_seq21 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.016e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 3531 NQWPLHMKTKDLFLFIELRCPYFTLST 3611
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Match: gi|592801233|gb|GAXK01153335.1| (TSA: Calanus finmarchicus comp545310_c0_seq20 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.017e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 34 NDVPIHLHKVNLFFNVVLFCPYYMLSV 60 N P+H+ +LF + L CPY+ LS Sbjct: 3531 NQWPLHMKTKDLFLFIELRCPYFTLST 3611
BLAST of EMLSAG00000000549 vs. L. salmonis peptides
Match: EMLSAP00000000549 (pep:novel supercontig:LSalAtl2s:LSalAtl2s108:35759:35988:-1 gene:EMLSAG00000000549 transcript:EMLSAT00000000549 description:"maker-LSalAtl2s108-snap-gene-0.11") HSP 1 Score: 119.398 bits (298), Expect = 8.496e-37 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0 Query: 1 MIDFVHFAKKKSIIIFNLITYDNNTILFLKTSFNDVPIHLHKVNLFFNVVLFCPYYMLSVI 61 MIDFVHFAKKKSIIIFNLITYDNNTILFLKTSFNDVPIHLHKVNLFFNVVLFCPYYMLSVI Sbjct: 1 MIDFVHFAKKKSIIIFNLITYDNNTILFLKTSFNDVPIHLHKVNLFFNVVLFCPYYMLSVI 61 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000549 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000549 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000549 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000549 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000549 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000549 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000549 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s108:35759..35988- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000549-683315 ID=EMLSAG00000000549-683315|Name=EMLSAG00000000549|organism=Lepeophtheirus salmonis|type=gene|length=230bp|location=Sequence derived from alignment at LSalAtl2s108:35759..35988- (Lepeophtheirus salmonis)back to top Add to Basket
|