EMLSAG00000000788, EMLSAG00000000788-683554 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592895157|gb|GAXK01063218.1| (TSA: Calanus finmarchicus comp5292901_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.063e-1 Identity = 15/26 (57.69%), Postives = 17/26 (65.38%), Query Frame = 0 Query: 26 KKDFKCDTCLFVMEQF-DKYVYTEET 50 KK FKCDTC FV + F D V+ ET Sbjct: 289 KKGFKCDTCAFVCDTFCDLNVHVRET 366
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592950142|gb|GAXK01008411.1| (TSA: Calanus finmarchicus comp647655_c0_seq6 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.420e+0 Identity = 12/35 (34.29%), Postives = 19/35 (54.29%), Query Frame = 0 Query: 23 DLIKKDFKCDTCLFVMEQFD--------KYVYTEE 49 D IK+ F CD CL++ + D K+ +T+E Sbjct: 505 DHIKQQFPCDNCLYITNRNDSLLRHKRSKHSFTDE 609
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592950143|gb|GAXK01008410.1| (TSA: Calanus finmarchicus comp647655_c0_seq5 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.424e+0 Identity = 12/35 (34.29%), Postives = 19/35 (54.29%), Query Frame = 0 Query: 23 DLIKKDFKCDTCLFVMEQFD--------KYVYTEE 49 D IK+ F CD CL++ + D K+ +T+E Sbjct: 505 DHIKQQFPCDNCLYITNRNDSLLRHKRSKHSFTDE 609
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592844248|gb|GAXK01113296.1| (TSA: Calanus finmarchicus comp95294_c5_seq2 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.525e+0 Identity = 9/23 (39.13%), Postives = 16/23 (69.57%), Query Frame = 0 Query: 22 SDLIKKDFKCDTCLFVMEQFDKY 44 SDL +K+F+ TC+ ++ FD + Sbjct: 3377 SDLQRKEFRFRTCILTIKTFDTF 3445
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592844249|gb|GAXK01113295.1| (TSA: Calanus finmarchicus comp95294_c5_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.526e+0 Identity = 9/23 (39.13%), Postives = 16/23 (69.57%), Query Frame = 0 Query: 22 SDLIKKDFKCDTCLFVMEQFDKY 44 SDL +K+F+ TC+ ++ FD + Sbjct: 3395 SDLQRKEFRFRTCILTIKTFDTF 3463
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592942048|gb|GAXK01016505.1| (TSA: Calanus finmarchicus comp3355310_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 6.702e+0 Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 0 Query: 22 SDLIKKDFKCDTCLFV 37 SD++K KCDTC FV Sbjct: 112 SDIVKAKLKCDTCKFV 159
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592844239|gb|GAXK01113305.1| (TSA: Calanus finmarchicus comp95294_c5_seq11 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 7.026e+0 Identity = 13/33 (39.39%), Postives = 20/33 (60.61%), Query Frame = 0 Query: 13 VFASAAQIKSDLIKKD-FKCDTCLFVMEQFDKY 44 + S ++ + +IKK FKC+TCL E+ KY Sbjct: 204 ISNSNLKVATKIIKKAAFKCNTCLLSFEEKQKY 302
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Match: gi|592816823|gb|GAXK01137745.1| (TSA: Calanus finmarchicus comp424996_c0_seq1 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 8.899e+0 Identity = 9/16 (56.25%), Postives = 13/16 (81.25%), Query Frame = 0 Query: 19 QIKSDLIKKDFKCDTC 34 QIK D++++D KCD C Sbjct: 354 QIKFDILRRDKKCDKC 401
BLAST of EMLSAG00000000788 vs. L. salmonis peptides
Match: EMLSAP00000000788 (pep:novel supercontig:LSalAtl2s:LSalAtl2s112:485647:492825:1 gene:EMLSAG00000000788 transcript:EMLSAT00000000788 description:"maker-LSalAtl2s112-snap-gene-5.11") HSP 1 Score: 119.013 bits (297), Expect = 1.067e-36 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0 Query: 1 MKVFLLLLLPILVFASAAQIKSDLIKKDFKCDTCLFVMEQFDKYVYTEETVLKLLFGMKKF 61 MKVFLLLLLPILVFASAAQIKSDLIKKDFKCDTCLFVMEQFDKYVYTEETVLKLLFGMKKF Sbjct: 1 MKVFLLLLLPILVFASAAQIKSDLIKKDFKCDTCLFVMEQFDKYVYTEETVLKLLFGMKKF 61 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000788 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000788 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 8
BLAST of EMLSAG00000000788 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000788 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000788 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000788 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000788 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s112:485647..492825+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000788-683554 ID=EMLSAG00000000788-683554|Name=EMLSAG00000000788|organism=Lepeophtheirus salmonis|type=gene|length=7179bp|location=Sequence derived from alignment at LSalAtl2s112:485647..492825+ (Lepeophtheirus salmonis)back to top Add to Basket
|