EMLSAG00000000799, EMLSAG00000000799-683565 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592812205|gb|GAXK01142363.1| (TSA: Calanus finmarchicus comp101591_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 3.149e-1 Identity = 14/32 (43.75%), Postives = 16/32 (50.00%), Query Frame = 0 Query: 2 FLIAVLAFCNLPMERYHLGDSGTKNHKKQTGN 33 F I A LP HLGDSG+ N +Q N Sbjct: 1277 FSIIFFASSCLPFAISHLGDSGSTNQTRQASN 1372
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592805408|gb|GAXK01149160.1| (TSA: Calanus finmarchicus comp96011_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.0314 bits (66), Expect = 5.860e-1 Identity = 17/44 (38.64%), Postives = 25/44 (56.82%), Query Frame = 0 Query: 6 VLAFCNLPMERYHLGDSGTKN-HKKQTGNADAPIMYSAVIILGM 48 V A P+ HLGDSG +N +++ G D P+ S ++LGM Sbjct: 733 VTALVTFPLASSHLGDSG*QNTRRRRRGEEDRPMKTSICLMLGM 864
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592816947|gb|GAXK01137621.1| (TSA: Calanus finmarchicus comp165632_c1_seq1 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 6.566e-1 Identity = 16/32 (50.00%), Postives = 19/32 (59.38%), Query Frame = 0 Query: 1 MFLIAVLAFCNLPMERYHLGDSGTKNHKKQTG 32 + +I LA P+ R HLGDSG KN QTG Sbjct: 938 ILIIRALASSVFPLLRSHLGDSGRKN---QTG 1024
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592908448|gb|GAXK01049927.1| (TSA: Calanus finmarchicus comp30306_c1_seq1 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 7.076e-1 Identity = 14/29 (48.28%), Postives = 15/29 (51.72%), Query Frame = 0 Query: 2 FLIAVLAFCNLPMERYHLGDSGTKNHKKQ 30 F I LA P+ HLGDSG KN Q Sbjct: 898 FSIIFLASSYFPLAINHLGDSGNKNQTTQ 984
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592842000|gb|GAXK01115544.1| (TSA: Calanus finmarchicus comp1060426_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.752e+0 Identity = 12/21 (57.14%), Postives = 14/21 (66.67%), Query Frame = 0 Query: 7 LAFCNLPMERYHLGDSGTKNH 27 +AF NL + HLGDSG K H Sbjct: 1003 VAFSNLFFAKSHLGDSGVKTH 1065
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592921676|gb|GAXK01036699.1| (TSA: Calanus finmarchicus comp407208_c1_seq9 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.091e+0 Identity = 14/39 (35.90%), Postives = 21/39 (53.85%), Query Frame = 0 Query: 14 MERYHLGDSGTKNHKKQTGNADAPIMYSAVIILGMSISE 52 + RYH+ S + GNAD+ YSA + MS++E Sbjct: 326 ITRYHMFLSNLARTSTELGNADSSADYSAALDAIMSVTE 442
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592935715|gb|GAXK01022838.1| (TSA: Calanus finmarchicus comp946630_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.167e+0 Identity = 14/26 (53.85%), Postives = 15/26 (57.69%), Query Frame = 0 Query: 2 FLIAVLAFCNLPMERYHLGDSGTKNH 27 FL + A NLP HLGDSG NH Sbjct: 902 FLTSSWASLNLP*AISHLGDSGRTNH 979
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592921678|gb|GAXK01036697.1| (TSA: Calanus finmarchicus comp407208_c1_seq7 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.419e+0 Identity = 14/37 (37.84%), Postives = 20/37 (54.05%), Query Frame = 0 Query: 16 RYHLGDSGTKNHKKQTGNADAPIMYSAVIILGMSISE 52 RYH+ S + GNAD+ YSA + MS++E Sbjct: 498 RYHMFLSNLARTSTELGNADSSADYSAALDAIMSVTE 608
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592921683|gb|GAXK01036692.1| (TSA: Calanus finmarchicus comp407208_c1_seq2 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.747e+0 Identity = 14/37 (37.84%), Postives = 20/37 (54.05%), Query Frame = 0 Query: 16 RYHLGDSGTKNHKKQTGNADAPIMYSAVIILGMSISE 52 RYH+ S + GNAD+ YSA + MS++E Sbjct: 326 RYHMFLSNLARTSTELGNADSSADYSAALDAIMSVTE 436
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Match: gi|592921679|gb|GAXK01036696.1| (TSA: Calanus finmarchicus comp407208_c1_seq6 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.810e+0 Identity = 14/37 (37.84%), Postives = 20/37 (54.05%), Query Frame = 0 Query: 16 RYHLGDSGTKNHKKQTGNADAPIMYSAVIILGMSISE 52 RYH+ S + GNAD+ YSA + MS++E Sbjct: 326 RYHMFLSNLARTSTELGNADSSADYSAALDAIMSVTE 436
BLAST of EMLSAG00000000799 vs. L. salmonis peptides
Match: EMLSAP00000000799 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1136:164884:166084:-1 gene:EMLSAG00000000799 transcript:EMLSAT00000000799 description:"maker-LSalAtl2s1136-snap-gene-1.94") HSP 1 Score: 146.362 bits (368), Expect = 3.707e-47 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0 Query: 1 MFLIAVLAFCNLPMERYHLGDSGTKNHKKQTGNADAPIMYSAVIILGMSISEVSTLQTVQKRLKMSHRE 69 MFLIAVLAFCNLPMERYHLGDSGTKNHKKQTGNADAPIMYSAVIILGMSISEVSTLQTVQKRLKMSHRE Sbjct: 1 MFLIAVLAFCNLPMERYHLGDSGTKNHKKQTGNADAPIMYSAVIILGMSISEVSTLQTVQKRLKMSHRE 69 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000799 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000799 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 15
Pagesback to top
BLAST of EMLSAG00000000799 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000799 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000799 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000799 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000799 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1136:164884..166084- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000799-683565 ID=EMLSAG00000000799-683565|Name=EMLSAG00000000799|organism=Lepeophtheirus salmonis|type=gene|length=1201bp|location=Sequence derived from alignment at LSalAtl2s1136:164884..166084- (Lepeophtheirus salmonis)back to top Add to Basket
|