EMLSAG00000000875, EMLSAG00000000875-683641 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592777732|gb|GAXK01176836.1| (TSA: Calanus finmarchicus comp140245_c8_seq6 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.027e+0 Identity = 16/55 (29.09%), Postives = 26/55 (47.27%), Query Frame = 0 Query: 22 VLYKIVGKFLSVTQFCLLHWLLVLFPCEDITLEKDSILLQFRTHRFLDINQLLIK 76 + ++ + FLS + CL H + P + I L+K + HRF NQ+ K Sbjct: 120 IFHQPLKAFLSHSMDCLTHQV----PHQSIALQKKDSRIALFKHRFSHSNQISFK 272
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592909055|gb|GAXK01049320.1| (TSA: Calanus finmarchicus comp1376774_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.220e+0 Identity = 12/32 (37.50%), Postives = 19/32 (59.38%), Query Frame = 0 Query: 5 YFRLGHLLLSVQEKFQLVLYKIVGKFLSVTQF 36 Y GH L+ V++ QL +YK+ G SV ++ Sbjct: 229 YCNCGHNLIKVKKVPQLSVYKLYGNIYSVRKY 324
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783074|gb|GAXK01171494.1| (TSA: Calanus finmarchicus comp63695_c0_seq12 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.947e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 917 KIVNKFASVALFCVLASILCIF 982
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783075|gb|GAXK01171493.1| (TSA: Calanus finmarchicus comp63695_c0_seq11 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.971e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 917 KIVNKFASVALFCVLASILCIF 982
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783076|gb|GAXK01171492.1| (TSA: Calanus finmarchicus comp63695_c0_seq10 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.972e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 917 KIVNKFASVALFCVLASILCIF 982
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783077|gb|GAXK01171491.1| (TSA: Calanus finmarchicus comp63695_c0_seq9 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.972e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 917 KIVNKFASVALFCVLASILCIF 982
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783078|gb|GAXK01171490.1| (TSA: Calanus finmarchicus comp63695_c0_seq8 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.973e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 917 KIVNKFASVALFCVLASILCIF 982
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783079|gb|GAXK01171489.1| (TSA: Calanus finmarchicus comp63695_c0_seq7 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.973e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 917 KIVNKFASVALFCVLASILCIF 982
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783080|gb|GAXK01171488.1| (TSA: Calanus finmarchicus comp63695_c0_seq6 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.984e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 1553 KIVNKFASVALFCVLASILCIF 1618
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Match: gi|592783081|gb|GAXK01171487.1| (TSA: Calanus finmarchicus comp63695_c0_seq5 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.984e+0 Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 25 KIVGKFLSVTQFCLLHWLLVLF 46 KIV KF SV FC+L +L +F Sbjct: 1553 KIVNKFASVALFCVLASILCIF 1618
BLAST of EMLSAG00000000875 vs. L. salmonis peptides
Match: EMLSAP00000000875 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1152:52583:52964:-1 gene:EMLSAG00000000875 transcript:EMLSAT00000000875 description:"maker-LSalAtl2s1152-snap-gene-0.22") HSP 1 Score: 154.451 bits (389), Expect = 4.694e-50 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MIKLYFRLGHLLLSVQEKFQLVLYKIVGKFLSVTQFCLLHWLLVLFPCEDITLEKDSILLQFRTHRFLDINQLLIKGT 78 MIKLYFRLGHLLLSVQEKFQLVLYKIVGKFLSVTQFCLLHWLLVLFPCEDITLEKDSILLQFRTHRFLDINQLLIKGT Sbjct: 1 MIKLYFRLGHLLLSVQEKFQLVLYKIVGKFLSVTQFCLLHWLLVLFPCEDITLEKDSILLQFRTHRFLDINQLLIKGT 78 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000875 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000875 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 14
Pagesback to top
BLAST of EMLSAG00000000875 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000875 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000875 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000875 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000875 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1152:52583..52964- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000875-683641 ID=EMLSAG00000000875-683641|Name=EMLSAG00000000875|organism=Lepeophtheirus salmonis|type=gene|length=382bp|location=Sequence derived from alignment at LSalAtl2s1152:52583..52964- (Lepeophtheirus salmonis)back to top Add to Basket
|