EMLSAG00000001069, EMLSAG00000001069-683835 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000001069
Unique NameEMLSAG00000001069-683835
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
F159 both
  1. Nauplius1
  2. Copepodid
Slow movement
-Missing-
10.10.2013 - 11:17
17.10.2013 (All day)
F159 Peroxidase both
  1. PreAdult1 female, PreAdult2 male
Reduced survival
-Missing-
30.12.2013 - 11:03
10.06.2014 - 12:07
Homology
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:CG5873 species:7227 "Drosophila melanogaster" [GO:0004601 "peroxidase activity" evidence=ISS] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 EMBL:AE014297 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 FlyBase:FBgn0038511 EMBL:BT021336 RefSeq:NP_650627.1 UniGene:Dm.31258 SMR:Q9VEJ9 MINT:MINT-1693729 EnsemblMetazoa:FBtr0083442 GeneID:42100 KEGG:dme:Dmel_CG5873 UCSC:CG5873-RA InParanoid:Q9VEJ9 OMA:WYELPNQ GenomeRNAi:42100 NextBio:827170 Uniprot:Q9VEJ9)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 363/720 (50.42%), Postives = 495/720 (68.75%), Query Frame = 0
Query:   24 SFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQ-GSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPK-CCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYS 741
             FG Q  ++  S CAL++ GPGRSS +D+   +F G+   Y  G  TCITY+A+NAA+  A +R+ +   +  +  +++  +G ++ + S  LA+ YGLS + I  GLP IDT+KT+I   CPPF    +C   +YR  +G+CNN+EHP WGAA     R + P ++DGI+APR S TG  LP +R+VS  MH D+GFHDHA T++++AWGQF+DHD TL+    DP     P+ CC+      HP C  I IP  D F+     +C++FVR     R  C+LG R  FN ++ ++DA TVY   +     LR    GL++M PVF E+ +K+LLPLKL+ PDEGC RP++ +YCF  G+  VNEQ VL  +HTL AREHNR+A  L ++N HW+DET+FQE R I  A++ H+ +NEFLP++LGKEVM++  L+L K+GY + YD+  NP     F  AAFRFGHSLLP+ +ERWSK H++I S+RLS+++++PYDLY+AG  D Y MGL+NQVAQA+DDS++QEVTNHLF++ G +FG+DL + N+QR RE G+PGY  +R++ GLP  + W ++ G M N +V  Y SI+E P DID+WS G++EK LPGSM+GPT AC+I  Q   LR GDR+WYE    PSSFT EQL+EIRK K SR++CDN+D I+ +Q+Y MVLPDHEINPRVPCKSG++P ID +KW D   H    S Y+
Sbjct:   20 QFGEQLQTAHGSDCALLLAGPGRSSVYDYNVNLFRGTLNPYNNGPGTCITYDAINAAYLDARKRIHVAQPKSDWKPEELATVGELLLDISIQLARTYGLSYEEIEKGLPTIDTSKTLIREVCPPFFAGVECRPGKYRRFDGLCNNIEHPTWGAANAPFQRLIGPLYSDGINAPRISVTGRDLPFSRVVSRTMHPDDGFHDHAGTVMVIAWGQFMDHDFTLTGTPLDPINRNDPEECCKRPLHLKHPYCNEIRIPDDDYFYRLFNVKCIDFVRGFPSPRPGCKLGSRQQFNTLTGVIDANTVYGVKESFARKLRTGYGGLMRMNPVFQEYGLKDLLPLKLDIPDEGCTRPNKSMYCFEGGEIRVNEQLVLTCMHTLMAREHNRLATALAQINKHWDDETLFQEARRINIAIVQHVTFNEFLPILLGKEVMEKFGLVLQKDGYWDGYDSTVNPGIIDSFAGAAFRFGHSLLPTAVERWSKAHKFIASKRLSDLIRRPYDLYRAGVLDEYFMGLMNQVAQAMDDSITQEVTNHLFKKEGARFGMDLVSFNMQRGREFGIPGYMEFRKFCGLPTSNTWDEMYGSMPNETVLRYGSIFEHPADIDLWSGGVSEKSLPGSMLGPTFACVIATQMSYLRRGDRFWYELPNQPSSFTPEQLQEIRKAKLSRLICDNTDLIDTVQIYPMVLPDHEINPRVPCKSGIIPSIDLTKWADFGGHGVDPSLYN 739          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:CG42331 species:7227 "Drosophila melanogaster" [GO:0004601 "peroxidase activity" evidence=ISS] [GO:0020037 "heme binding" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 EMBL:AE014297 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 UCSC:CG42331-RB FlyBase:FBgn0259233 ChiTaRS:CG42331 UniGene:Dm.16527 GeneID:42948 KEGG:dme:Dmel_CG42331 GenomeRNAi:42948 NextBio:831467 RefSeq:NP_001189281.1 RefSeq:NP_651282.2 IntAct:Q9VC42 MINT:MINT-923007 EnsemblMetazoa:FBtr0299842 EnsemblMetazoa:FBtr0304106 InParanoid:Q9VC42 OMA:YEIEINI PhylomeDB:Q9VC42 Bgee:Q9VC42 Uniprot:Q9VC42)

HSP 1 Score: 422.165 bits (1084), Expect = 1.237e-127
Identity = 240/600 (40.00%), Postives = 344/600 (57.33%), Query Frame = 0
Query:  133 IDTTKTIIEGYCPPFLMTPKCTV-ERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMH-RDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRT--GKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ-RLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKW 727
            I   +T +EG CPP    P     ERYR+ +G CNN   P WGAA    +RFL P + DG+   R+S  G+ L S+R VS  +H   EG  +  +T+++  WGQ +DHD+T +A+   PR+  G  P CC  G    HP C PI++P  D + +  K RC+ F+RS    R +C L  R+  N+V+S +DA  +YSNS ++ ++ R+++ GLL    V+   +  E +          C R +    C  +GD    EQ  L  +H ++  EHNRIA EL ++NPHW+DE ++QETR I+ A+  HI + EFLP++LG+EV++  DL L+ +GY   Y +  NP+ +  F +AAFRFGHSL+ ++  R  + H  I +   L E  Q+  D+  AG     L GL +Q A   D+ ++ E+TNHLFQ PG  FGLDLAA+NIQR R+HG+  Y+ WR   GL  I  W D   ++   S       Y S  DID++  GI E+P+ G ++GPT ACII +QF N R GDR+WYENGG+ SSFT  QL  +R++  +++LC        +Q +  +  + E N R  C  G L  ID S W
Sbjct:  157 ISLRRTALEGLCPPRDPPPCMPASERYRTHDGTCNNKRRPRWGAAQMPFNRFLPPEYGDGVDTVRSSADGSTLSSSRFVSLLVHGAREG--EAPLTLMIAQWGQMLDHDMTSTAQ---PRSINGSIPSCC--GGKDFHPACFPIKVPLDDPWLAPLKVRCLEFLRSAPAQRRDCVLSWREQTNQVTSYIDASPIYSNSAKSSDNARVFRHGLL----VYGRGDPAEDV----------CQRGAIATKCIRSGDGRSGEQPGLLAMHHVWVGEHNRIAMELSELNPHWSDEKVYQETRRIVGAMFQHITFREFLPVILGREVVKLFDLELMPSGYYERYSSKVNPTVANAFAAAAFRFGHSLVQNSYTRCDRHHNVINNNVSLHEEFQR-GDIGSAGSLHRLLRGLASQRALKRDEFITPELTNHLFQTPGFPFGLDLAAINIQRGRDHGIAPYSAWRVPCGLSPILSWDDFANVVGPESAKRIGHAYRSVHDIDLFVGGIAERPVVGGLVGPTFACIIAQQFSNSRRGDRFWYENGGFESSFTPAQLHSLRRVSLAQVLCRTVGG-GTLQPHIFIPAEFEDNERQTCGVGSLSPIDLSPW 733          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:C46A5.4 species:6239 "Caenorhabditis elegans" [GO:0040035 "hermaphrodite genitalia development" evidence=IMP] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 EMBL:FO080769 Gene3D:1.10.640.10 eggNOG:NOG262194 GeneTree:ENSGT00550000074325 OrthoDB:EOG7B5WV5 RefSeq:NP_501272.2 UniGene:Cel.38014 STRING:6239.C46A5.4 PeroxiBase:4143 PaxDb:Q18647 PRIDE:Q18647 EnsemblMetazoa:C46A5.4 GeneID:177558 KEGG:cel:CELE_C46A5.4 UCSC:C46A5.4 CTD:177558 WormBase:C46A5.4 HOGENOM:HOG000016822 InParanoid:Q18647 OMA:GDERSNE Uniprot:Q18647)

HSP 1 Score: 400.979 bits (1029), Expect = 2.008e-120
Identity = 251/667 (37.63%), Postives = 357/667 (53.52%), Query Frame = 0
Query:  100 DVGNLGTVIHETSRYLAKQYGLSKD---------AISNGLPLIDTTKTIIEGYCPPFLMT---PK--CTVE--------RYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPR-TGKTPKCCEEGQT-AVHPNCLPIEIPSHDTFF-SKH---KQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPV-FNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ-RLSEMLQQPYDLY--KAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASY 732
            D+    +V+ E +  L    GL KD          +   LP ID    I  G   PFL     PK  C  E        +YR+ +G CNN+++P +G A     R L P + DG   PR  S  G+ LPSAR +S+ +H D        T +L+ +GQ +DHD+  S  ++ P+ T      C+  QT ++H  C PI+I ++D FF SKH   + RCM F RS   L     LG R+  N+++S LDA T+Y ++      LRL+ DG L    + FN    KE LP   +  D   +  +    CF+AGD   NEQ  L  IH +F REHNRIA  LK++N  W+DE +FQE+R I  A + HI Y E+LP+VLG + M++  L+    GY   YD   + + S    ++AFRFGHSL+     R +   + + +   L+E    P  +Y   +G  ++ LMGL+   + A D  +   V NHLF +PG    GLDL A+NIQR R+HGV GYN +R+  GL K   +SDLR +M++ +V    + Y   DDID++   ++E P  GS++GPTLAC+IG+Q   L+  DR++YE       FT +QL EIRK   SRI+CDNS+   N+Q    ++PD   N  + C    L  ID +KW +  Y
Sbjct:  816 DIARTASVLREATNILISGNGLDKDERLPDLDIGTLQKILPQIDVGSVI--GNFTPFLARDPLPKEQCLPEPLPCDHTSKYRTYSGWCNNLKNPKFGNAFTQMRRLLDPAYDDGFDTPRTRSVLGSELPSARKISNIVHSDAPKFHVKFTHMLMQFGQILDHDMMHSPISRGPKNTILNCSSCDSAQTLSIH--CFPIKIEANDPFFPSKHSDGRPRCMPFARS---LLAQVSLGFRNQLNQLTSFLDASTIYGSTQCEANKLRLFSDGKLNFTDLGFN----KEALPQGNQERDCRSVLQNRQRRCFVAGDERSNEQPGLTAIHNIFLREHNRIARYLKQINNFWSDEKLFQESRRINIAQLQHIIYKEWLPVVLGCQNMEKWGLMPQTAGYFEGYDDQCDATISQEMSTSAFRFGHSLIRGVFTRMNDNFQNMTNHVNLTETFSNPSPVYDKNSGHMESILMGLIGANSMAFDRHIVTAVRNHLFAKPGGPLTGLDLPAVNIQRGRDHGVQGYNAYRKHCGLRKASAFSDLRDVMNSEAVTALETAYAHVDDIDLFPGIMSESPTRGSLVGPTLACLIGEQMQRLKKCDRFYYETSDSMVRFTPDQLVEIRKASLSRIICDNSEYAANIQPNVFLMPDDLTNSPMTCSE--LSEIDLNKWVERDY 1469          

HSP 2 Score: 347.436 bits (890), Expect = 1.369e-101
Identity = 208/616 (33.77%), Postives = 324/616 (52.60%), Query Frame = 0
Query:  122 SKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTG------KTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNS-SVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKS-GVLPRIDFSKWRD 729
            S   + + +  + T  T ++  CP      +C + +YRS  G CNNV++P  GA+     RFL  +++DGISAPR+SK+G PLPS+R +S+        H    ++L+  +  FI  DI      +  +          P  C  G  + HP C  I +P  DT  SK+  +C+ + RS       C  G R   N V+S LD   +Y +++  ++ +RL+K+G L +  V        + P  L   D    R S    C LAG+  +N       I+T++ R+HN IA +L  VNPHW+D+ +F+E R I  A   HI +NE +P+++GKE ++   + L KNGY + YD   + SAS VF SAA +F  +LLPS      K      S+ L +    P  +Y+ G  D  L  L+N   +      S  +    FQ+      +D+ A+ IQ  R+HG+P Y  WR +  L     +  L+ +   S ++  +  +YESP+DID++  G++E+P  GS++GPT AC+   Q    + GDR+WYEN   PS+FT++Q++EIRK   +RI+CDN+DT+ ++Q +A  LPD   N  + C S G++   D   ++D
Sbjct:  147 SPKTLKSMIQFLPTENTKMKEICP-VNQIEECVIGKYRSYTGHCNNVKNPLNGASYERLKRFLPADYSDGISAPRSSKSGQPLPSSRALSALFTPSPSGH-ATCSLLIAPFLSFIYDDIVHVPSNRIFKRDFYGNDKAMPLPCCRGDNS-HPECFEIPVPEDDTLQSKNV-KCLPYSRSLPVPNPKCSFGQRQQANMVTSYLDLSQIYGSTEGIVKKMRLHKNGKLALRAVGGFNNQLGVPPANL---DSSICRSSTGKPCLLAGNNKINFLPTSGAIYTIWMRQHNVIADKLASVNPHWDDQKVFEEARRITIAQFQHITFNEMVPVLVGKEQLRVMGIKLQKNGYDSGYDINIDSSASNVFASAAGQFFLTLLPSQFNIEDKRFS-TKSESLLKHFNDPALIYEKGRIDGMLKFLLNAPIEK-PGLHSSPLLRTAFQKKDIADSVDIIAMVIQMGRDHGLPSYLQWRTFCKLDDFSSFLALQTIFKPSVNISDFERLYESPEDIDVFVGGLSEQPTKGSLLGPTFACLFAHQMAQTKRGDRFWYENFVSPSAFTVDQIDEIRKTTMARIICDNTDTVTHVQHHAFSLPDDYGNCPLSCNSTGIIQVFDPKAFKD 753          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:C46A5.4 "Protein C46A5.4" species:6239 "Caenorhabditis elegans" [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 EMBL:FO080769 Gene3D:1.10.640.10 eggNOG:NOG262194 GeneTree:ENSGT00550000074325 OrthoDB:EOG7B5WV5 RefSeq:NP_501272.2 UniGene:Cel.38014 STRING:6239.C46A5.4 PeroxiBase:4143 PaxDb:Q18647 PRIDE:Q18647 EnsemblMetazoa:C46A5.4 GeneID:177558 KEGG:cel:CELE_C46A5.4 UCSC:C46A5.4 CTD:177558 WormBase:C46A5.4 HOGENOM:HOG000016822 InParanoid:Q18647 OMA:GDERSNE Uniprot:Q18647)

HSP 1 Score: 400.979 bits (1029), Expect = 2.008e-120
Identity = 251/667 (37.63%), Postives = 357/667 (53.52%), Query Frame = 0
Query:  100 DVGNLGTVIHETSRYLAKQYGLSKD---------AISNGLPLIDTTKTIIEGYCPPFLMT---PK--CTVE--------RYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPR-TGKTPKCCEEGQT-AVHPNCLPIEIPSHDTFF-SKH---KQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPV-FNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ-RLSEMLQQPYDLY--KAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASY 732
            D+    +V+ E +  L    GL KD          +   LP ID    I  G   PFL     PK  C  E        +YR+ +G CNN+++P +G A     R L P + DG   PR  S  G+ LPSAR +S+ +H D        T +L+ +GQ +DHD+  S  ++ P+ T      C+  QT ++H  C PI+I ++D FF SKH   + RCM F RS   L     LG R+  N+++S LDA T+Y ++      LRL+ DG L    + FN    KE LP   +  D   +  +    CF+AGD   NEQ  L  IH +F REHNRIA  LK++N  W+DE +FQE+R I  A + HI Y E+LP+VLG + M++  L+    GY   YD   + + S    ++AFRFGHSL+     R +   + + +   L+E    P  +Y   +G  ++ LMGL+   + A D  +   V NHLF +PG    GLDL A+NIQR R+HGV GYN +R+  GL K   +SDLR +M++ +V    + Y   DDID++   ++E P  GS++GPTLAC+IG+Q   L+  DR++YE       FT +QL EIRK   SRI+CDNS+   N+Q    ++PD   N  + C    L  ID +KW +  Y
Sbjct:  816 DIARTASVLREATNILISGNGLDKDERLPDLDIGTLQKILPQIDVGSVI--GNFTPFLARDPLPKEQCLPEPLPCDHTSKYRTYSGWCNNLKNPKFGNAFTQMRRLLDPAYDDGFDTPRTRSVLGSELPSARKISNIVHSDAPKFHVKFTHMLMQFGQILDHDMMHSPISRGPKNTILNCSSCDSAQTLSIH--CFPIKIEANDPFFPSKHSDGRPRCMPFARS---LLAQVSLGFRNQLNQLTSFLDASTIYGSTQCEANKLRLFSDGKLNFTDLGFN----KEALPQGNQERDCRSVLQNRQRRCFVAGDERSNEQPGLTAIHNIFLREHNRIARYLKQINNFWSDEKLFQESRRINIAQLQHIIYKEWLPVVLGCQNMEKWGLMPQTAGYFEGYDDQCDATISQEMSTSAFRFGHSLIRGVFTRMNDNFQNMTNHVNLTETFSNPSPVYDKNSGHMESILMGLIGANSMAFDRHIVTAVRNHLFAKPGGPLTGLDLPAVNIQRGRDHGVQGYNAYRKHCGLRKASAFSDLRDVMNSEAVTALETAYAHVDDIDLFPGIMSESPTRGSLVGPTLACLIGEQMQRLKKCDRFYYETSDSMVRFTPDQLVEIRKASLSRIICDNSEYAANIQPNVFLMPDDLTNSPMTCSE--LSEIDLNKWVERDY 1469          

HSP 2 Score: 347.436 bits (890), Expect = 1.369e-101
Identity = 208/616 (33.77%), Postives = 324/616 (52.60%), Query Frame = 0
Query:  122 SKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTG------KTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNS-SVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKS-GVLPRIDFSKWRD 729
            S   + + +  + T  T ++  CP      +C + +YRS  G CNNV++P  GA+     RFL  +++DGISAPR+SK+G PLPS+R +S+        H    ++L+  +  FI  DI      +  +          P  C  G  + HP C  I +P  DT  SK+  +C+ + RS       C  G R   N V+S LD   +Y +++  ++ +RL+K+G L +  V        + P  L   D    R S    C LAG+  +N       I+T++ R+HN IA +L  VNPHW+D+ +F+E R I  A   HI +NE +P+++GKE ++   + L KNGY + YD   + SAS VF SAA +F  +LLPS      K      S+ L +    P  +Y+ G  D  L  L+N   +      S  +    FQ+      +D+ A+ IQ  R+HG+P Y  WR +  L     +  L+ +   S ++  +  +YESP+DID++  G++E+P  GS++GPT AC+   Q    + GDR+WYEN   PS+FT++Q++EIRK   +RI+CDN+DT+ ++Q +A  LPD   N  + C S G++   D   ++D
Sbjct:  147 SPKTLKSMIQFLPTENTKMKEICP-VNQIEECVIGKYRSYTGHCNNVKNPLNGASYERLKRFLPADYSDGISAPRSSKSGQPLPSSRALSALFTPSPSGH-ATCSLLIAPFLSFIYDDIVHVPSNRIFKRDFYGNDKAMPLPCCRGDNS-HPECFEIPVPEDDTLQSKNV-KCLPYSRSLPVPNPKCSFGQRQQANMVTSYLDLSQIYGSTEGIVKKMRLHKNGKLALRAVGGFNNQLGVPPANL---DSSICRSSTGKPCLLAGNNKINFLPTSGAIYTIWMRQHNVIADKLASVNPHWDDQKVFEEARRITIAQFQHITFNEMVPVLVGKEQLRVMGIKLQKNGYDSGYDINIDSSASNVFASAAGQFFLTLLPSQFNIEDKRFS-TKSESLLKHFNDPALIYEKGRIDGMLKFLLNAPIEK-PGLHSSPLLRTAFQKKDIADSVDIIAMVIQMGRDHGLPSYLQWRTFCKLDDFSSFLALQTIFKPSVNISDFERLYESPEDIDVFVGGLSEQPTKGSLLGPTFACLFAHQMAQTKRGDRFWYENFVSPSAFTVDQIDEIRKTTMARIICDNTDTVTHVQHHAFSLPDDYGNCPLSCNSTGIIQVFDPKAFKD 753          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:CG10211 species:7227 "Drosophila melanogaster" [GO:0004601 "peroxidase activity" evidence=ISS] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 EMBL:AE014134 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 Gene3D:1.10.640.10 eggNOG:NOG262194 GeneTree:ENSGT00550000074325 OrthoDB:EOG7B5WV5 OMA:GSTKCEA EMBL:AY051952 RefSeq:NP_609883.1 UniGene:Dm.455 SMR:Q9VJ80 IntAct:Q9VJ80 MINT:MINT-974149 EnsemblMetazoa:FBtr0081069 GeneID:35106 KEGG:dme:Dmel_CG10211 UCSC:CG10211-RA FlyBase:FBgn0032685 InParanoid:Q9VJ80 GenomeRNAi:35106 NextBio:791894 Uniprot:Q9VJ80)

HSP 1 Score: 397.512 bits (1020), Expect = 1.109e-119
Identity = 228/589 (38.71%), Postives = 321/589 (54.50%), Query Frame = 0
Query:  158 YRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASK-TGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKC--CEEGQTAVHPNCLPIEIPSHDTFF-----SKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYI--------GSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            +R+++G CNN+ +P+WG ++    R L   + DGISAPR +  TG  LP+ R +S+ +H D        +++++ + QF+DHD+TL+   K       P C  C   QT VHP C P  +P+ D ++     +  ++ C   +RS  G +    LGPRD  N+ +  LD   VY  +      LR +   +        +   KELLPL    P   C   S +  CFL GD   +EQ  L  IHT F REHNRI   L+ VNPHWN E +F   R I++A + HI +NEFLP +L    +  + L LL  GY   Y+   +P     F +AAFR GHSLL   I R S  H+ +        G  R+  +LQ        G  D  L GLV    + LD  ++ EVTNHLF++    F G+DL ALNIQRAR+HG+P YN +R    L +   W+DL   +    ++ +  IY S DDID++   +TE+PL G ++GPTLACIIG QF  LR  DR+WYEN      FT  QL E+RK+  ++I+C+N +   +MQ  A  LP + +NPRVPC S  +P+ID + WR+
Sbjct:  719 FRTLSGRCNNLRNPNWGKSLTTFSRLLPAQYEDGISAPRLTGVTGTALPNPRTISTTIHPDISNLHTRYSLMVMQFAQFVDHDLTLTPIHKGFHES-IPSCRPCNSRQT-VHPECNPFPVPAGDFYYPEVNVTSGERFCFPSMRSLPGQQ---SLGPRDQINQNTHFLDGSMVYGETTCLSNKLRGFSGRMNS-----TQVRGKELLPL---GPHPEC--KSRNGLCFLGGDDRASEQPGLTAIHTAFLREHNRIVEGLRGVNPHWNGEQLFHHARKIVSAQVQHIVFNEFLPRILSWNAVNLYGLKLLPQGYYKDYNPSCSPIVFNEFAAAAFRIGHSLLRPHIPRLSVQHQPVEPPLLLRDGFFRMDALLQ-------PGIIDEILRGLVATPMETLDQFITGEVTNHLFEDRKIPFSGIDLIALNIQRARDHGIPSYNNYRALCNLKRATNWNDLSREIPTEVINRFQKIYASVDDIDLFPGAMTERPLQGGLVGPTLACIIGIQFRQLRKCDRFWYENQNPEVKFTEAQLAEVRKVTLAKIVCENLEITGDMQRAAFDLPSNFLNPRVPCAS--MPQIDLNAWRE 1283          

HSP 2 Score: 233.417 bits (594), Expect = 1.303e-62
Identity = 173/587 (29.47%), Postives = 254/587 (43.27%), Query Frame = 0
Query:  153 CTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRD-EGFHDHA-VTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYN-CRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYN-----GWREWXGLPKIHRWSDLRGLMSN---SSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWR 728
            C   +YR     CNNV H  WGA  +   R LA ++ADG+S PR SK  + LP A +V   + R  EG   HA +T +L AWGQ + +D+    +   P +GK   CCE       P+ L          F +    C  + RS  G     C+   R   N  S+ +D   +Y ++    + LR Y  G +K+                     E C       YC +AG            +H    ++HN I   L  +NP W++E +F E R II A I HI YNEFLP+VLG+E   +  L L    +S++Y +         F +AA     S+ P                   EML +    ++       L+ +      AL  SL    TN          G    AL + R R+HGV  Y        R +      +   D    +SN     +     IY++ +DID+    + E+P+ G++ GPT++C++  QF  L+  DR+WYEN   PSSFTL+QL+ IR+   S +LC  S  +   Q  A +L D+ +N  + C    LP+ D   W+
Sbjct:   64 CPPSKYRQPTAECNNVSHRKWGARGDIFQRLLAADYADGVSQPRTSKGTHALPDAEVVIEQLQRHVEGELRHAHITAMLPAWGQLLANDLVEVGQL--PISGK---CCERDSAVKDPSEL-------QHCFVRAGPDCKEYKRSAPGFDLEACQKHTRQQMNIASAYIDGSGLYGSTRHEFDQLRTYISGGVKV---------------------ESC------KYCQVAG--------ATGALHRALLQQHNNIGERLSHINPDWSEEDVFLEARRIITATIQHITYNEFLPLVLGQETTAKEGLRLTAEKHSSNYSSSVRGGIYNEFATAAMPAFWSMYP------------------PEMLAKKMSAHE-------LLSIA-----ALQKSLVPSQTN--------AEGWSELALAVHRGRDHGVASYVHALDLCERRFADQSAANVSFDTLAQVSNIPEEYITNLRDIYQNANDIDLLVGALLEEPVVGALFGPTISCLLSLQFEQLKQTDRFWYENEIPPSSFTLDQLKSIRQTTLSGLLC-GSHQVSTAQSKAFILEDNYLNSILDCDQ--LPKFDLKPWQ 562          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:Pxt "Peroxinectin-like" species:7227 "Drosophila melanogaster" [GO:0004601 "peroxidase activity" evidence=ISS;NAS] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0004666 "prostaglandin-endoperoxide synthase activity" evidence=ISM] [GO:0001516 "prostaglandin biosynthetic process" evidence=IMP] [GO:0030707 "ovarian follicle cell development" evidence=IMP] [GO:0005875 "microtubule associated complex" evidence=IDA] [GO:0007304 "chorion-containing eggshell formation" evidence=IMP] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 EMBL:AE014297 GO:GO:0005875 GO:GO:0005615 GO:GO:0046872 GO:GO:0020037 GO:GO:0004601 GO:GO:0042744 SUPFAM:SSF48113 GO:GO:0007306 GO:GO:0042743 Gene3D:1.10.640.10 GO:GO:0001516 eggNOG:NOG262194 GeneTree:ENSGT00550000074325 OrthoDB:EOG7B5WV5 EMBL:AF238306 EMBL:AY119616 RefSeq:NP_650648.3 UniGene:Dm.19352 ProteinModelPortal:Q9VEG6 SMR:Q9VEG6 BioGrid:67163 MINT:MINT-1547498 PeroxiBase:3552 PeroxiBase:3553 PaxDb:Q9VEG6 PRIDE:Q9VEG6 EnsemblMetazoa:FBtr0083508 GeneID:42131 KEGG:dme:Dmel_CG7660 UCSC:CG7660-RB CTD:42131 FlyBase:FBgn0261987 InParanoid:Q9VEG6 OMA:DGTCNNP PhylomeDB:Q9VEG6 GenomeRNAi:42131 NextBio:827323 Bgee:Q9VEG6 GO:GO:0004666 Uniprot:Q9VEG6)

HSP 1 Score: 384.415 bits (986), Expect = 2.363e-119
Identity = 232/638 (36.36%), Postives = 346/638 (54.23%), Query Frame = 0
Query:  108 IHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVER--YRSVNGMCNNVEHPH--WGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCE-EGQTAVHPN-----CLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDV--YCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYE--NGGWPSSFTLEQLEEIRKIKFSRILCDNSD--TIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWR 728
            +  T  +  K+    +D I+N +P I  T+T +  +C P    P C   R  YRS++G CNN E     WGAA     R L P + DGI  PRA S  G PL  AR +S  +  D         ++++ +GQ + HDI+ ++  +    G   +CC  EG+ A+ P      C+PI +   D FFS    RC+NFVR       +C+L       +V+  +DA  VY +SDE   SLR ++ G L+M+   N+F  ++LLPL  +   + C  PSE+    CF +GD   N+   L  +  L AREHNR+AG L ++NP  +DET+FQE R I+ A + HI YNEFLP+++G + M++  L+ L  GYS+ Y+   NP+ +  F  AA+R GHS +    +   +  R      + +++  P  + K  + D+ L  L +Q  Q +D S+SQ ++  LF+     FGLDLAA+NIQR R+ G+  YN + E  G PK+H +      ++       + +Y +PDDID+W  G+ EK + G ++G T A II  QF   + GDRY+YE  NG  P +F   QL+EIRK+  +R+LCDNSD  T++ + + A V  DH  N  + C    LP ++   WR
Sbjct:  189 VMTTQLFGKKEQVPVEDFITNNVP-IKFTETPLAHHCQP---PPVCGNIRSVYRSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGIWTPRAHSSDGTPLLGARKISRTLLSDVDRPHPKYNLMVMQFGQVLAHDISQTSSIR-LEDGSLVQCCSPEGKVALSPQQSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSSDEASRSLRAFRGGRLRMM---NDFG-RDLLPLTNDK--KAC--PSEEAGKSCFHSGDGRTNQIISLITLQILLAREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGPQQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSVDGKFQIRQEHGRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQPMQQVDSSISQGLSRFLFRG-DNPFGLDLAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQFPIEIAQK----LSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAEIIADQFARFKQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLLCDNSDRLTLQAVPLAAFVRADHPGNQMIGCDDPNLPSVNLEAWR 808          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:cd "cardinal" species:7227 "Drosophila melanogaster" [GO:0006727 "ommochrome biosynthetic process" evidence=IMP] [GO:0004601 "peroxidase activity" evidence=ISS] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0060967 "negative regulation of gene silencing by RNA" evidence=IMP] [GO:0005764 "lysosome" evidence=IDA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 EMBL:AE014297 GO:GO:0006979 GO:GO:0005764 GO:GO:0020037 GO:GO:0004601 GO:GO:0060967 GO:GO:0006727 SUPFAM:SSF48113 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 UniGene:Dm.16597 GeneID:42681 KEGG:dme:Dmel_CG6969 CTD:42681 FlyBase:FBgn0263986 GenomeRNAi:42681 NextBio:830032 RefSeq:NP_651081.1 ProteinModelPortal:Q9VCW2 SMR:Q9VCW2 PRIDE:Q9VCW2 EnsemblMetazoa:FBtr0084303 UCSC:CG6969-RA InParanoid:Q9VCW2 OMA:RANENLL PhylomeDB:Q9VCW2 Bgee:Q9VCW2 Uniprot:Q9VCW2)

HSP 1 Score: 382.874 bits (982), Expect = 1.414e-118
Identity = 221/597 (37.02%), Postives = 331/597 (55.44%), Query Frame = 0
Query:  146 PFLMTPKCTVE-RYRSVNGMCNNVEHPH-WGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSED---VYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYS--NSYDTFTNPSASTVFVSAAFRFGHSLLPS--TIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKK----FGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            P ++  +C    RYR   G+CNN +HP  +GA+M  + R ++P++ADGI+APR S  G  LP AR VS  +HR     D   T++L  +GQF+DHDIT ++ T   + G++  CC       HP C P++I   D ++ ++   CMNFVRS        R GPR   N+ ++ +DA  VY N ++    LR + +G L+M   F   + ++LLP+   +P +GC R        YCF +GD   NE  +L  +H L+AR HN +A +L++ NPHW DE ++QE R I+ A ++HI YNEFLP++LGK + +   L+  K+  +  ++YD   +PS +  F +AAFRF H+LLP    I R + T   I    L +ML  P+ L+     D+ LM   N     +D   S EVT  LF+   +      GLDL +LNIQR R+HG+P Y  +R    LP +  W ++   + N+++     IYESP D+D+++  ++E PL G++ GP L+C++  QF  L+ GD +WYE    P  FT  QL EI K   + I+C NSD I  ++ + M       NP V C+       +F  W +
Sbjct:  205 PTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHGR-LPPARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTS-QEGESIDCCVAATREQHPECYPVDILPDDPYYKQYNISCMNFVRSAPAP--TGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRM---FVTDDGRQLLPIS-SNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAI---ELHKMLFNPFSLWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPWSE 790          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:CELE_T06D8.10 "Protein T06D8.10" species:6239 "Caenorhabditis elegans" [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 EMBL:Z49130 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 OrthoDB:EOG7B5WV5 EMBL:Z49129 PIR:F88311 PIR:T24502 RefSeq:NP_496407.1 UniGene:Cel.14438 ProteinModelPortal:G5ECK5 SMR:G5ECK5 IntAct:G5ECK5 PRIDE:G5ECK5 EnsemblMetazoa:T06D8.10 GeneID:174717 KEGG:cel:CELE_T06D8.10 CTD:174717 WormBase:T06D8.10 OMA:GSTKCEA NextBio:885196 Uniprot:G5ECK5)

HSP 1 Score: 392.504 bits (1007), Expect = 1.444e-117
Identity = 230/673 (34.18%), Postives = 356/673 (52.90%), Query Frame = 0
Query:   92 VRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKD---------AISNGLPLIDTTKTIIEGY--------------CPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTG--KTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKH----KQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKEL-LPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ-RLSEMLQQPYDLYK--AGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            +R K     V  +  ++ ET++ L K  GL  D          +   LP ID T + +  Y              C P  M P     RYR+ NG CNN++ P +  +       L P + DG  APR  +K+G PLP+ R VS+ +  D+       T +++ +GQ +DH++T S   + P        KC    + +VH  C+PI +   D FF  +    + RC+ F RS  G      LG R+  N++++ +D   +Y ++    ++LRL+  GLL     F +F   ++ LP   +  D         + CF+AGD   + Q  L ++HT F REHNRIA +L  +NP WND+T+F+E R I+ A + HI + EFLP ++G +++   +L+  KNGY   YD   + S S  F +AAFRFGH+L+     R +  ++ +     L++       LY+   G  D+ LMGL+   + A D  ++  V NHLF   G+K  G+DL  LNI RAR+HGV  YN  RE+ GL +  +W DL+G M   +++   S+YES DD+D++   ++E+PL G+++G T++CII +QF  L+  DR++YEN    + FT  QL EIRK+K + I C NS  ++ +Q     + D   N +VPC    +P++D S WR+
Sbjct:  760 MRAKEGAKQVSQISALLLETTKLLIKGEGLDTDEQLPKLDTHTLQKILPDIDVT-SFVNNYTAFLSEDGQSSQEECSP-KMLPCDHTTRYRTFNGWCNNLKFPEYANSFAPLRHLLPPQYDDGFDAPRTRAKSGRPLPNPRRVSNLVCEDKDVSHVKFTHMVMQFGQLLDHELTHSPVARGPNDEILNCTKCDSPEKISVH--CMPIRVEKDDPFFPTNYPNGEPRCLPFARSLLG---QLNLGYRNQLNQLTAYVDGSAIYGSTKCEAKNLRLFTRGLLN----FTDFGHGQMMLPQGNQEKDCRSTLEKRHMPCFVAGDERNSHQPGLTIMHTFFVREHNRIAMQLSALNPQWNDDTVFEEARRIVTAEMQHITFAEFLPKIIGLDLLNAQNLVPKKNGYFGGYDNTCDASISQPFATAAFRFGHTLIRRMFPRMNYNYKNMSEPVDLAQHFGHVGPLYEQEKGGMDSMLMGLLGTPSMAFDRHITDAVRNHLFMRRGEKTSGMDLIVLNILRARDHGVQPYNDLREFCGLRRAVKWDDLKGEMDQDNINILQSLYESVDDVDLFPGLVSERPLRGALLGTTMSCIIAEQFGRLKKCDRFYYENDNSAAKFTPGQLNEIRKVKLASIFCSNSKYLKTIQPNVFDVTDELTNAQVPCTD--IPQVDLSLWRE 1419          

HSP 2 Score: 327.791 bits (839), Expect = 5.864e-95
Identity = 206/625 (32.96%), Postives = 306/625 (48.96%), Query Frame = 0
Query:  120 GLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDIT--LSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQ-------EVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGL-MSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHP 734
            GL +  +  G+P    + TI    CP       C    YRS +G+CNNV  P WGA+     R + P++ADG+S PRA+    PLPS R +S  +    G     VT ++  W Q I  D+   +  +  +  T     CC+ G    H  C  I+IP+ D  + + +  C+   RS    R  CRLGPR+  N  SS LDA  +Y ++ E  + LR +++G L+      E          L + D      +    C L+G   VN    +A +HT+F R HNRIA  L+ +N HW D+ +++E R I+AA + HI YNEFLP++LG+E M+ + L L   G+ ++Y+     +    F      +  +LLP              S++       P  LY+         G V  + Q L+ ++ Q       EV +   ++   +FGLDL ++ +++ R+HG+PGY   R   GL +I  ++DLR + +        +S Y   +D+D+    + EKPL GS++GPT+ACIIGKQ    R  DR+WYEN    S F   QL EIR  K + I+C N D I  +Q       D   N  + C S VL   DF++WRDA   P
Sbjct:  125 GLRERELKYGIPPNQISSTI--SNCP-IPTIDHCFATNYRSFSGICNNVARPEWGASHTPMARIVRPDYADGVSEPRAAAASKPLPSVRSLSLTIFTPRGEVHSDVTTMMGLWMQLIASDMVNIVPFQAVNEGTSSALPCCKRGFN--HSECDAIDIPAADPAY-RTRLNCIPHARSIIAPREACRLGPREQANFASSYLDASFIYGSNMEKAKQLRTFRNGQLRTAGSIGE----------LPATDGTLQCQATHSRCALSGTDEVNILPSVAALHTVFIRHHNRIADNLRSINRHWTDDKLYEEARKIVAAQVQHITYNEFLPVLLGRENMRNYGLNLHSAGFDSNYEMNLEGTTFNEFAVTITYYFWALLP--------------SEKSFVDFNNPSRLYE--------QGPVQIIRQVLNTNIYQPTLRANDEVKSGFLKD-NHEFGLDLISIALKQGRDHGIPGYTALRASCGLGRIASFNDLREIFLPEVKFEQVSSAYTRVEDVDLLVGVLAEKPLKGSLVGPTMACIIGKQMQRTRRADRFWYENYFAQSGFNEAQLSEIRNTKLAEIICSNID-IRRIQRNVFFREDVFDNMAISCNSTVLNSPDFNEWRDAEGKP 709          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:Pxd "Peroxidase" species:7227 "Drosophila melanogaster" [GO:0004601 "peroxidase activity" evidence=ISS;NAS] [GO:0005506 "iron ion binding" evidence=NAS] [GO:0005576 "extracellular region" evidence=NAS] [GO:0020037 "heme binding" evidence=IEA;NAS] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0007306 "eggshell chorion assembly" evidence=NAS] [GO:0042600 "chorion" evidence=IDA] [GO:0006909 "phagocytosis" evidence=IMP] [GO:0022008 "neurogenesis" evidence=IMP] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 EMBL:AE014297 GO:GO:0005576 GO:GO:0022008 GO:GO:0006909 GO:GO:0046872 GO:GO:0020037 GO:GO:0004601 GO:GO:0042744 SUPFAM:SSF48113 GO:GO:0042600 GO:GO:0007306 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 EMBL:X68131 EMBL:AY541497 EMBL:BK002598 PIR:S28222 RefSeq:NP_001163633.1 RefSeq:NP_996223.1 UniGene:Dm.31257 ProteinModelPortal:Q01603 SMR:Q01603 PeroxiBase:4118 PaxDb:Q01603 PRIDE:Q01603 EnsemblMetazoa:FBtr0089287 EnsemblMetazoa:FBtr0301526 GeneID:2768671 KEGG:dme:Dmel_CG3477 UCSC:CG3477-RA CTD:2768671 FlyBase:FBgn0004577 eggNOG:NOG271029 InParanoid:Q01603 OMA:LRKASMA OrthoDB:EOG7QK0BF PhylomeDB:Q01603 GenomeRNAi:2768671 NextBio:848013 Bgee:Q01603 Uniprot:Q01603)

HSP 1 Score: 353.599 bits (906), Expect = 6.059e-109
Identity = 204/586 (34.81%), Postives = 313/586 (53.41%), Query Frame = 0
Query:  153 CTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQ----TAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRL--GPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLE-SPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILL--KNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            C    YR+++G CN++E P  G A + + R L P +ADGISAP  S TG+ LPSAR+VS     ++   D   T+  + WGQ + HD+++ A     +   T  C ++G+       H  C  I +P HD  +S+    C+NFVR+      NC+   GP +    V+S LD   VY NS +    +R ++ G +    +  E    + LPL    + D   +  SE   C+ +GD  VN+   LA++ T+  REHNRIA  L  +NPH++D T+FQE R I  A    I+Y E+LP+ LG E M ++ LI       Y N +D   +PS      +AAFR+ HS +   ++  S+  + +GS  LS+   +P  +      D+   G   Q  +  D +  +++ + LF+     FG DL +L+IQR R+HG+  YN  RE+ GL + H W     L+S   +    S+Y S +D+D+      E  + G++ GPT  CI+ +QF+  R GDR+++ENG   + FT +QLEE+RK   +R+LCDN + I +MQ  A     H  NP +PC +  +P++D +KW D
Sbjct:  100 CEKTAYRTLDGSCNHLEQPGLGVANSKYGRLLTPKYADGISAPTRSVTGDELPSARLVSLVAFGEQDVPDPEFTLHNMQWGQIMTHDMSMQAGGTQSKKHPTRCCTDDGRLIGLDTAHKTCFAIIVPPHDPAYSQVGTECLNFVRTLTDRDSNCQYQGGPAEQLTVVTSYLDLSLVYGNSIQQNSDIREFQGGRM----IVEERNGAKWLPLSRNVTGDCDAVDASE--VCYRSGDVRVNQNPGLAILQTILLREHNRIADALSALNPHYDDRTLFQEARKINIAQYQQISYYEWLPIFLGGENMLKNRLIYKAPSGSYINDFDPNIDPSVLNEHATAAFRYFHSQIEGRLDLLSELRQVLGSLTLSDWFNRPGIIEVGDNFDSLTRGHATQPEELTDINFDRQIKHFLFRR-NMPFGSDLRSLDIQRNRDHGLASYNDMREFCGLRRAHSWEGYGDLISPPILEKLKSLYPSHEDVDLTVGASLEAHVAGALAGPTFLCILTEQFYRTRVGDRFFFENGDKLTGFTPDQLEELRKASMARLLCDNGNHISSMQPEAFRTVSHS-NPIIPCSN--IPQVDLTKWID 675          
BLAST of EMLSAG00000001069 vs. GO
Match: - (symbol:CELE_K10B4.1 "Protein K10B4.1" species:6239 "Caenorhabditis elegans" [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 Gene3D:1.10.640.10 EMBL:FO080912 GeneTree:ENSGT00550000074325 eggNOG:NOG39991 OrthoDB:EOG7B5WV5 PIR:D88013 RefSeq:NP_493669.1 UniGene:Cel.14767 ProteinModelPortal:O17241 SMR:O17241 STRING:6239.K10B4.1 PeroxiBase:4145 PaxDb:O17241 PRIDE:O17241 EnsemblMetazoa:K10B4.1 GeneID:187249 KEGG:cel:CELE_K10B4.1 UCSC:K10B4.1 CTD:187249 WormBase:K10B4.1 HOGENOM:HOG000018230 InParanoid:O17241 OMA:VFHREHE NextBio:934634 Uniprot:O17241)

HSP 1 Score: 343.969 bits (881), Expect = 2.680e-101
Identity = 204/601 (33.94%), Postives = 327/601 (54.41%), Query Frame = 0
Query:  102 GNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASK-TGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKC--CEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKEL-LPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTV--FVSAAFRFGHSLLPSTIERWSKTHRYIGSQR-----LSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKK-FGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNS 690
             N+  ++ E ++ L K   +  D+I +     D  K   +  C P  + P  +   YRS  G CNN+E P          R L P + DGI  PR+   TG+ LPS R++S+ +H  +       +  ++ +GQFIDHDIT S   ++   G    C  C+ G+  V P+C PI +P +D  F      C++FVRS    +    LG R+  N+VS+ LD   +Y ++    + LR ++DG +K            + L    ES  +GC+  + D  CF+AGD   ++QT+L  +H++F REH RI   LK++NP+W+DE I+QETR +I+A  +HI YNE+LP+++G++++  +DL   ++GY   YD + N  AS +  F +AAFRFGHS    T+ R++     +         L+        +Y     +  L G+  +     D  +   + N LF + G++  GLDL ++NIQR R+HG+P YN +R + GL ++  +  +   ++   +     +YESPDDID+++  ++EK +PG ++GPT ACII +QF  L+  DR++YENG   S F+  QL+E+RK   S ++C N+
Sbjct:  608 ANVSLILLEATKKLVKLKHIELDSIQSVNIGEDFGKKS-DSQCNPKNL-PCDSTNPYRSYTGWCNNLETPSLANTFRELRRLLPPAYEDGIDLPRSKTITGSRLPSPRVISNMVHHAKKIEHVKYSHFVMEFGQFIDHDITHSPVDQNS-DGTALNCSRCDSGR-FVSPSCFPIPVPVNDVHFEPFS--CLSFVRSLPAQK---TLGYRNQMNQVSAYLDGSVMYGSTKCEGDRLRTFQDGKMKTTQTSRAPRHYGITLSQSDESEQDGCV-SAPDAPCFIAGDDRNSQQTLLIAVHSVFHREHERITTTLKEINPNWDDEKIYQETRKLISAEFAHIVYNEYLPIIIGQKLIDDYDLRPRQDGY---YDGYENCDASILQPFATAAFRFGHS----TVTRFTPMQETVHDPATCVVDLASDFLNMSKIYDNEAVEQILGGMHGKHQMMTDRFVDDAIRNFLFSDRGRRGTGLDLISINIQRGRDHGIPPYNHYRSFCGLSRLTSFYSIFSDINQDGLTAIGKVYESPDDIDLFTGIVSEKTIPGGIVGPTAACIIAEQFRRLKKCDRFYYENGEDHSKFSASQLKEVRKTSMSALICANT 1191          

HSP 2 Score: 103.99 bits (258), Expect = 1.800e-21
Identity = 53/159 (33.33%), Postives = 83/159 (52.20%), Query Frame = 0
Query:  569 IQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKW 727
            I + R+HG+  Y+ WR+  G  ++  + DL  L+ ++ +     +Y    D+D+   GI E P+ GS++GPT  CI+  QF   + GD YWY N       T +QLEE++K   S ++C +  T   +Q       D+  N  + C S V  + DFSKW
Sbjct:  394 ISKGRDHGIATYSQWRKECGGGELKTYEDLIDLIDSNILKSLRDLYPDVLDVDLILLGIAENPVYGSLLGPTFGCIMALQFQKTKFGDTYWYTN-----KLTEDQLEEVKKTSISAMMCRHQKT-SIIQKDVFKAADNFQNIPIFCNSSVFAKPDFSKW 546          

HSP 3 Score: 95.5153 bits (236), Expect = 7.794e-19
Identity = 78/313 (24.92%), Postives = 127/313 (40.58%), Query Frame = 0
Query:  144 CPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPL-PSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDL 455
            CP  L    C   +YR  +G C N+     G+A +   R +  N+ D IS PR     N L P   +V   + R    +  ++T   + + +F+ +D+      +D        CC  G++     CL          F ++   C  ++RS    R +C LG R+  N  ++ LDAG +Y +                                  L    +G I  S  +           E T  + IH+L   EHN +  +++K  P    E IF+E R  + A + HI + +FLP++LG E M+++DL
Sbjct:   81 CP--LKKYNCLYGKYRHSDGRCTNIFFALSGSAYSSFSRRIPANYDDDISTPRLHGYRNGLLPPPAVVEKQIARTPAIYAISLTNTFLEFSEFLYNDLVKFVRLQDGLG-----CCGTGKSG---ECLN---------FGENFLDC--YIRSAPSPRAHCSLGRREQMNLATAFLDAGPIYQD----------------------------------LRDTSKGKISSSFTL-----------ESTTKSSIHSLLIDEHNWVVDQIQKKFPDMGLELIFEEARKFVIAELQHITFEQFLPILLGDETMKKYDL 327          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592832441|gb|GAXK01125103.1| (TSA: Calanus finmarchicus comp24549_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 1211.82 bits (3134), Expect = 0.000e+0
Identity = 555/695 (79.86%), Postives = 625/695 (89.93%), Query Frame = 0
Query:   36 GCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            GCALIIPGPG+SS FDH + VFGG    ++  NTCITYEAVNAAF +A +RVGLPPVRGKFTT DVGNLGTVIHE SRYLAKQY LSKDAI+NGLPLIDTTK+++EGYCPPFLMTPKC V+RYRSV G+CNN++HPHWGAAMNGHHRFL P++ADGISAPRAS +G PLPS R +SS++H+DEGFHDHAVTILLVAWGQFIDHDITL+AETKDPRTGKTPKCC+ G    HPNCLPIEIP+ D FF+ HK+RCMNFVRSQAGLRYNCRLGPR+ FNE+S++LDAGTVYSN  E LESLRLYK+G LK LPVF+EF M++LLPLKLE PDEGCIRPSEDVYCFLAGD  VNEQTVLAM+HTLF REHNRIA EL K+NPHW+DET+FQETRHI AALI HI YNEFLPMVLGKEVM QHDL+LLK+GY + YD +TNPSA++ F SAAFRFGHSLLPSTIERWSKTHRY+GSQ+LSEMLQQPYDLYKAGWAD YLMGL+NQVAQALDDS++QEVTNHLFQEPGKKFGLDLAALN+QR REHG+P YN WREW GL  +  W D+ G+M+N SV GY+S+YESP+DID+W+AG+TE+PLPGSM+GPT ACIIGKQFHN R+GDR+WYENGGWPSSFTLEQL EIR++K SR+LCDNSD IEN+QVYAMVLPDHEINPRVPCKSGVLPR+D SKWRDA
Sbjct:  145 GCALIIPGPGKSSLFDHTNNVFGGRPAPFEPQNTCITYEAVNAAFISARDRVGLPPVRGKFTTHDVGNLGTVIHEASRYLAKQYALSKDAIANGLPLIDTTKSLVEGYCPPFLMTPKCEVQRYRSVEGICNNLDHPHWGAAMNGHHRFLPPDYADGISAPRASISGYPLPSPRSISSHLHKDEGFHDHAVTILLVAWGQFIDHDITLTAETKDPRTGKTPKCCDGGFDGTHPNCLPIEIPADDHFFTLHKRRCMNFVRSQAGLRYNCRLGPREQFNEISAVLDAGTVYSNVPERLESLRLYKNGFLKTLPVFSEFNMRDLLPLKLEEPDEGCIRPSEDVYCFLAGDPRVNEQTVLAMVHTLFVREHNRIASELNKINPHWDDETVFQETRHINAALIQHITYNEFLPMVLGKEVMHQHDLVLLKDGYFDGYDQYTNPSAASGFTSAAFRFGHSLLPSTIERWSKTHRYVGSQKLSEMLQQPYDLYKAGWADAYLMGLINQVAQALDDSVTQEVTNHLFQEPGKKFGLDLAALNMQRGREHGIPSYNRWREWCGLSPMKNWDDMLGVMANHSVKGYSSLYESPEDIDLWTAGVTERPLPGSMVGPTFACIIGKQFHNFRYGDRFWYENGGWPSSFTLEQLAEIRRVKLSRVLCDNSDDIENVQVYAMVLPDHEINPRVPCKSGVLPRLDLSKWRDA 2229          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592862032|gb|GAXK01095530.1| (TSA: Calanus finmarchicus comp200197_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 409/668 (61.23%), Postives = 523/668 (78.29%), Query Frame = 0
Query:   67 SNTCITYEAVNAAFTTALERVG-LP---PVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            S  CI+YE V+AAF+ A   +  LP   P  G FT ++VGNLGTVIHET+R LAK+Y +    ++ G  LIDTTKT+I+ YCPP+L    C   RYR V G+CNN+++ HWGAA   HHRFL    ADGISAPR S TG  LPSAR+VS+++HRD+GFHDHA+T L+VAWGQF DHDITL+AE  D    +   CC  G    HP C PIEIP +D F+++H+QRCMNFVRS AGLR NCRLGPR++FN+++S+LD  TVYSN  ET+E LR ++ GL+K LPVF E  +++LLPL L+ PD+GCIRPSEDV+CF  GD  VNEQTVL ++HTL  R HNRIA EL ++NPHW DETIFQETRHI  ALI HI +NE+LPMV+GK+ + +HDLIL  +GY + YD   NPSA+  F +AA+RFGHSLLPST+ERW+  H+++G+Q+LSEMLQQPYDL+KAGW D Y++GL NQVAQA+DD+++ EVTNHLF+EPG  FGLDL +LN+QR REHG+P YN +RE+ G   I  W  LRG+M+N +V  Y+ +Y++PDD+++++AGI+E P+PG++IGPT +CIIG+QFHNLR GDR++YENGGWPSSFTLEQL EIRK   SR+LCDN+DTI+ +Q++A VLPDH++NPRVPC SGV+PRIDF+KW D+
Sbjct:  321 SGGCISYEDVDAAFSLAARNLDYLPLKFPAEGNFTNEEVGNLGTVIHETTRILAKEYQVDPGTVTEGFALIDTTKTLIKEYCPPYLAERTCEPHRYRDVEGICNNLKNSHWGAAQMAHHRFLPYAHADGISAPRMSVTGKDLPSARLVSAHVHRDDGFHDHAITFLMVAWGQFTDHDITLTAEI-DEVLEEDLNCCR-GPNVTHPMCFPIEIPENDHFYARHEQRCMNFVRSNAGLRENCRLGPRESFNQITSVLDGNTVYSNVPETIEDLRSFQGGLMKTLPVFRELGLQDLLPLSLDDPDKGCIRPSEDVFCFRTGDPRVNEQTVLCILHTLMIRNHNRIASELSRLNPHWGDETIFQETRHINVALIQHITFNEYLPMVMGKQGLHEHDLILYTDGYYDGYDPEINPSAANGFATAAYRFGHSLLPSTVERWTPNHKFLGTQKLSEMLQQPYDLFKAGWLDGYVLGLTNQVAQAMDDAVTGEVTNHLFEEPGDGFGLDLISLNLQRGREHGIPSYNKYREFCGFKPITSWHQLRGIMTNKTVAAYSRVYDTPDDLELFTAGISENPVPGALIGPTFSCIIGRQFHNLRKGDRFFYENGGWPSSFTLEQLHEIRKFTLSRLLCDNTDTIDTVQIHAFVLPDHKVNPRVPCNSGVIPRIDFTKWIDS 2318          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592819638|gb|GAXK01134930.1| (TSA: Calanus finmarchicus comp370050_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 538.495 bits (1386), Expect = 3.892e-177
Identity = 269/635 (42.36%), Postives = 392/635 (61.73%), Query Frame = 0
Query:  110 ETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVER-------YRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEG---QTA--VHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELL--PLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIG-SQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            + S  L+KQ+ L++  +  GL  ++   T I   CP  L +     E        +R+ +G CNN +HP WG+A     RFL P+++DGI   R S +  PLP+ R++SS +HRDE       T++++ WGQFIDHD+T +  T+  R    PKCC+E    QT   +HP+C PI+IP  D F+S++ + CM FVRS    R +C LGPRD  N+++S LDA  +Y ++ E    LRL + G LK    + +  +++ L  PL  E+  E C   + +++CF AGD  VNEQ  LA +HTL  REHNR+A EL  +NPHW+D+ +F ETR  I A++ HI +NE+LP++LG  V++  +L LL  GY + Y+   NP+ +  F S+AFRFGHSL+  +I R +K  R +  +  L + +  P +L+  G  D  L+GLV+Q     D+ ++ E+TNHLFQ P   FG+DLA+LNIQR R+HG+  YN WRE  GL +   W +L  +M  ++V    ++YE  DDID+++ G+ EKP+ G ++GPT ACIIG+QF NLR GDR+WYENG  P +FT EQL+EIRK   SR++CD  D ++ +Q +A + PD   N R  C+   +P  D +KWR+
Sbjct:  600 QASSLLSKQFMLTRQQVLYGLERVELRTTSIFDACP--LKSRDARQEECSGFSAMFRTPDGTCNNFKHPSWGSAFMPFLRFLPPDYSDGIEEFRRSISNGPLPNPRLISSMIHRDESHDTTQFTMMVMQWGQFIDHDLTSTPTTRGFR-ASIPKCCDETGRQQTGDLLHPDCKPIDIPVDDRFYSRYNKTCMEFVRSSPAPRLDCALGPRDQINQITSYLDASNIYGSTAEDQHDLRLMEKGKLK----YTDLHIRKPLLPPLSPEASAEECRIRTPNLHCFHAGDNRVNEQPGLATMHTLLLREHNRVALELGSINPHWSDDRVFLETRRFIGAVMQHITFNEWLPIILGSRVLEIFELKLLPRGYYSGYNDSVNPTIANAFASSAFRFGHSLVKKSINRCNKEFRQVPFNVELHKEMNNPSNLHNFGSVDRILLGLVSQKLARRDEFMTDELTNHLFQTPRSHFGMDLASLNIQRGRDHGLAPYNIWREQCGLKRFSDWEELEDVMDKTTVSRIENVYEDVDDIDLFTGGMAEKPVVGGIVGPTFACIIGQQFLNLRKGDRFWYENGNHPGAFTKEQLQEIRKTSLSRVVCDCMDDVKLLQPFAFLQPDQFANIRTECRGKDIPHTDLTKWRE 2483          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592871447|gb|GAXK01086115.1| (TSA: Calanus finmarchicus comp1343749_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 518.079 bits (1333), Expect = 6.851e-177
Identity = 226/391 (57.80%), Postives = 306/391 (78.26%), Query Frame = 0
Query:  270 LPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWY 660
             PIEIP +D FF++H+QRCMNFVRS AGLR +CRLGPR++   VS L+D   +YSN  E    +R ++DGL+K LPVF E  + +LLPL +E PDEGCIRPSEDV+CF  GD  VNEQTVLA++HT+  R HN IA EL K+NPHW+DET+FQE RHI  A+  HI +NE+LP++LGK+ + +++L+L  +GY + YD   +PS +  F +AA+RFGHSLLPST+ERW+  H ++G+Q+LSEMLQQPYDL+KAGW D Y++GLVNQVAQA+D+S++ EVTNHLF+ PG  FGLDLAALN+QR REHG+P YN +RE+ G      W  +RGL  N++V  Y+ +YE+P+D+++WSAG++E P+PG ++GPT+ C+IG+Q+HN+R GDR++Y
Sbjct:    2 FPIEIPENDHFFARHEQRCMNFVRSNAGLRPDCRLGPRESATRVSGLMDGSAIYSNEPEVNADIRAFEDGLMKTLPVFREQGLMDLLPLAIEEPDEGCIRPSEDVFCFRTGDPRVNEQTVLAIVHTVMIRNHNLIAKELGKINPHWSDETLFQEARHINIAIQQHITFNEYLPLLLGKDQIHKNELVLFTDGYFDGYDPDIDPSNANGFATAAYRFGHSLLPSTVERWTPKHEFLGTQKLSEMLQQPYDLFKAGWFDGYVLGLVNQVAQAMDESITAEVTNHLFEFPGDGFGLDLAALNLQRGREHGLPTYNKYREFCGFKPFTSWHQMRGLFPNNTVAAYSRLYETPEDLELWSAGVSENPVPGGLLGPTITCVIGRQWHNVRKGDRFFY 1174          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592862031|gb|GAXK01095531.1| (TSA: Calanus finmarchicus comp200197_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 521.546 bits (1342), Expect = 1.808e-171
Identity = 268/622 (43.09%), Postives = 384/622 (61.74%), Query Frame = 0
Query:  156 ERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRAS------------------KTGN------------------PLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPN---CLPIEIPSHDTFFSKH--KQRCMNFVRSQA------GLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            ++YRS+NG+CNN++ P  GA+ +   R +   + D    P+                    K  N                   LP+ R VSS  H D        +++++ +GQF+DHD+ L+ E ++        CC+      HP+   C PI I + D F+S     Q C  F RS+A      GL    R G R+ ++ V+S +D   +Y+ ++     +R ++ G LK     N    +E+LP    S               +AGD    +   LA IHTLF REHNR+A  +     H +DE I+Q+ R I+ A + +I Y E+LP++LGKE +++++L + +      Y    +PS    F +AA+RFGHSLLPST+ERW+  H+++G+Q+LSEMLQQPYDL+KAGW D Y++GL NQVAQA+DD+++ EVTNHLF+EPG  FGLDL +LN+QR REHG+P YN +RE+ G   I  W  LRG+M+N +V  Y+ +Y++PDD+++++AGI+E P+PG++IGPT +CIIG+QFHNLR GDR++YENGGWPSSFTLEQL EIRK   SR+LCDN+DTI+ +Q++A VLPDH++NPRVPC SGV+PRIDF+KW D+
Sbjct:  166 KKYRSINGVCNNLKSPFLGASNSILSRIIEAEYYDCKGIPKGGYKDEEKYQGGITVREGILKPANNTFEKGARWFFGCKGRHQQLPNVREVSSTFHPDMDLPQDHFSLMVMQFGQFLDHDMALTPEVEED------DCCK------HPDSEDCFPIYIHNEDPFYSTRVSPQTCQEFTRSEAFCSNGKGLGKGRRRGKREQYSIVTSFVDGSQIYAPNEVDSALIRSHQGGELKT----NIDYSREMLPAINGS--------------LMAGDIRALDMPGLATIHTLFMREHNRVARLIGY--KHTDDEEIYQQARRIVIAELQNIVYGEYLPVILGKEAVEKYELSVAE---PTEYKKKQDPSIMNSFTTAAYRFGHSLLPSTVERWTPNHKFLGTQKLSEMLQQPYDLFKAGWLDGYVLGLTNQVAQAMDDAVTGEVTNHLFEEPGDGFGLDLISLNLQRGREHGIPSYNKYREFCGFKPITSWHQLRGIMTNKTVAAYSRVYDTPDDLELFTAGISENPVPGALIGPTFSCIIGRQFHNLRKGDRFFYENGGWPSSFTLEQLHEIRKFTLSRLLCDNTDTIDTVQIHAFVLPDHKVNPRVPCNSGVIPRIDFTKWIDS 1926          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592955738|gb|GAXK01002818.1| (TSA: Calanus finmarchicus comp834324_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 478.019 bits (1229), Expect = 3.472e-155
Identity = 249/634 (39.27%), Postives = 363/634 (57.26%), Query Frame = 0
Query:  112 SRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCT-VERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEE--GQ---TAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGC-----IRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDL-ILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTI----ERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            S+ L+K + L+ D     L       TI    CP  +   KC   E+YRS +G CNN+    WGA      R   P ++DGI  PR SK+G  LPSAR+VS+++       D   T+ L+ +GQF+DHDIT +    +   G   KCC+E  GQ      HP C PIEIP  D F+ ++ Q CM+F+RS  G + +C  G  +  N++S   D   VY +S +  E LR  ++GLLK        + +++LP   E+  EGC     IR  E++ CF AGD  VNEQ  L + HT++ REHNR+A  LK +NPHW+ ET+FQE R I+ A + HI YNE+LP++LG + M   ++ +  + G+SN YD   NPS    F +AAFRFGH+L+   +    E         G+  L++    P  L+  G  D  LMGL  Q  Q  D+  S++V+NHLFQ   + FG+DL ALNIQR R+HG+PGYN +R   GLP+  +++DL  ++    +     +Y++ DDID++  G++E P+  S++GPT  C++G QF  LR GDR++Y++   P   ++EQL EI+K   +RI CDN D ++ MQ+ A + P  + NP   C S  +P +D S W++
Sbjct:  585 SQALSKMFDLTPDQAGLELKSFSLADTIASTKCPKEV---KCNPSEKYRSYDGTCNNLGKTQWGARNTAMQRLRLPKYSDGIIKPRISKSGTSLPSARLVSTSLTSTGETSDPTFTLNLMQYGQFLDHDITFTPLFNNAE-GSGIKCCDEKTGQPLKEVQHPACFPIEIPVGDPFYGQYNQTCMHFIRSLPGKQLDCSFGFGEQSNQISHFHDGSNVYGSSQQEAEELREGREGLLKT----ENRKGRQMLPYDRENA-EGCGIPEEIRTRENLGCFRAGDRRVNEQPGLTVYHTIWLREHNRLARLLKTINPHWDGETVFQEARRIVTAEMQHITYNEWLPIILGDDFMDNLEIQVDQEEGFSNKYDPKVNPSIVNAFATAAFRFGHTLIKGMMNMVKEEEQGKRVTTGTMNLADTFDNPQPLFPPGNIDRILMGLGTQGCQKFDNLFSKQVSNHLFQSKTESFGMDLVALNIQRGRDHGLPGYNAYRSLCGLPRAFKFADLADVIKQDIIEELTEVYDNVDDIDLFIGGVSESPVGTSLLGPTFRCLVGDQFKKLREGDRFFYDSFSNPGKLSVEQLSEIKKTTLARIHCDNGDNVQAMQMQAFIQPSTK-NPPEDCSSTSIPSLDISAWKE 2456          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592812399|gb|GAXK01142169.1| (TSA: Calanus finmarchicus comp101137_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 483.411 bits (1243), Expect = 1.797e-154
Identity = 250/633 (39.49%), Postives = 365/633 (57.66%), Query Frame = 0
Query:  112 SRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSA--ETKDPRTGKTPKCCEEG-----QTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPS----EDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTH---RYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            S+ L +++ L+ D  + GL      +T+I   CP     P      +R+ +  CNN+E P WG+A +   R L PN++DG+  P+  K+G  LPSAR+VS N+  D        T  ++ WGQF+DHD T +      +  +     C E+G     +  +HP C PIE+P +D FF KH QRCMNFVRS    +  C  G  +  N+++S+ D   VY + +E +E+LR +K GLLK      + E   L   + ES DE  I  +    E+  CF AGD+  NEQ  L + HT++ REHNR+A EL  +NPHW+DE ++QE R I  A + HI YNE+LP+VLG E M + D++ +  GY+N YD   NP+ + VF +AAFRFGH+L+   ++   + H   +      LS+    P  +Y  G  D +L+GL  Q +Q  D+  +++VTNHLFQ   K FG+DL ALN+QR R+HG+PGYN +RE  GL ++  +      +    V     I++  DD+D++  GI+E P+PG+++GPT  CIIG QF  L+HGDR++Y+N   P  FT EQL E+RK   +R+ CDN D I+ MQ      P  +INP VPC +  +P+I    W++ 
Sbjct:  622 SQDLGERFSLTADQAAFGLNDFSIKETLIADKCP--TGGPCDAYAPFRNPDATCNNLEMPLWGSANSAFQRTLLPNYSDGVWRPKVGKSGEALPSARLVSINIVPDVDAPSELDTHNVMQWGQFVDHDTTHTPLFRLTNADSNGIQCCLEDGSGPISKLVLHPECFPIELPENDPFFMKHGQRCMNFVRSMPAPQLGCNFGYGEQMNQITSMHDGSNVYGSDEEDVEALRSFKGGLLKSYKPEEDSERTLLPQEEGESKDECEIEETLQDLENRKCFRAGDSRANEQPGLTVFHTVWMREHNRVAKELNYLNPHWDDEKLYQEARKINIAQMQHITYNEWLPIVLGTEYMSELDILPVTYGYNNKYDAKVNPTITNVFAAAAFRFGHTLVQGLLDLVEEVHYERKKTSMIPLSDTFFNPELVYTPGELDKFLVGLATQPSQKFDNIFTEQVTNHLFQPKNKSFGMDLVALNLQRGRDHGLPGYNAFRELCGLKRVTDFDYFNDFIPIKIVERLKLIFDHVDDVDMFIGGISETPVPGALLGPTFQCIIGDQFKRLQHGDRFYYDNSANPGKFTEEQLVEVRKSNLARVHCDNGDNIKLMQPLVFRNPS-QINPLVPCDAITIPKISLYPWKEG 2511          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592803350|gb|GAXK01151218.1| (TSA: Calanus finmarchicus comp1014998_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 469.929 bits (1208), Expect = 2.404e-153
Identity = 234/509 (45.97%), Postives = 326/509 (64.05%), Query Frame = 0
Query:  228 LLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTA----VHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKE-LLP-LKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ-RLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            +++ WGQF DHDIT +  T+  R      C +EGQT     +HP+C PI IP+ D F+S +   CM FVRS    R++C LGPRD  N+++S +DA  +Y +S E   +LRL K G L+    + +  +++ LLP L  E   E C   + +++CF AGD  VNEQ  LA +HTL+ REHNR+A +  K+NPHW+D+ IF ETR +I A++ HI YNE+LP++LG  V+   +L LL  GY + Y+   NP+ +  F SAAFRFGHSL+ S+IER +K  R +     L + +  P +L+  G  D  L+GLVNQ     D+ +S+E+TNHLFQ P   FG+DLAA+NIQR R+HG+  YN WRE  GL ++  W +L   M   +     S+YE  DDID+++ G+ EKP+ G +IGPT ACI+G+QF NLR GDR+WYENG  P +FT EQL+EIRK   SRI+CD  D +E++Q +A + PD   N R  C+   +PRID  KW++
Sbjct:    2 MVMQWGQFTDHDITSTPTTRGFRDSILKCCSDEGQTVENALLHPDCKPILIPASDRFYSAYNVTCMEFVRSSPTPRHDCSLGPRDQINQITSYIDASNIYGSSAEEQHNLRLMKKGKLR----YTDLHIRKPLLPALSPELAVEECRTRTANLHCFQAGDDRVNEQPGLATLHTLWLREHNRVAVKFGKINPHWSDDRIFLETRKLIGAVMQHITYNEWLPIILGSRVLNIFELKLLPRGYYSGYNESVNPTIANSFASAAFRFGHSLVKSSIERCNKEFRKVPFHVDLHKEMNNPGNLHNFGSVDRILLGLVNQKLSRRDEFISKELTNHLFQTPRSHFGMDLAAINIQRGRDHGLAPYNIWREQCGLKRLQTWEELADAMDGDTAVRMKSVYEHVDDIDLFTGGMAEKPVVGGIIGPTFACILGQQFLNLRRGDRFWYENGNHPGAFTPEQLQEIRKTSLSRIICDCLDDVEDIQPFAFLQPDLSANKRTVCRGRGIPRIDLRKWKE 1516          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592812400|gb|GAXK01142168.1| (TSA: Calanus finmarchicus comp101137_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 483.411 bits (1243), Expect = 4.703e-153
Identity = 250/633 (39.49%), Postives = 365/633 (57.66%), Query Frame = 0
Query:  112 SRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSA--ETKDPRTGKTPKCCEEG-----QTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPS----EDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTH---RYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            S+ L +++ L+ D  + GL      +T+I   CP     P      +R+ +  CNN+E P WG+A +   R L PN++DG+  P+  K+G  LPSAR+VS N+  D        T  ++ WGQF+DHD T +      +  +     C E+G     +  +HP C PIE+P +D FF KH QRCMNFVRS    +  C  G  +  N+++S+ D   VY + +E +E+LR +K GLLK      + E   L   + ES DE  I  +    E+  CF AGD+  NEQ  L + HT++ REHNR+A EL  +NPHW+DE ++QE R I  A + HI YNE+LP+VLG E M + D++ +  GY+N YD   NP+ + VF +AAFRFGH+L+   ++   + H   +      LS+    P  +Y  G  D +L+GL  Q +Q  D+  +++VTNHLFQ   K FG+DL ALN+QR R+HG+PGYN +RE  GL ++  +      +    V     I++  DD+D++  GI+E P+PG+++GPT  CIIG QF  L+HGDR++Y+N   P  FT EQL E+RK   +R+ CDN D I+ MQ      P  +INP VPC +  +P+I    W++ 
Sbjct: 1074 SQDLGERFSLTADQAAFGLNDFSIKETLIADKCP--TGGPCDAYAPFRNPDATCNNLEMPLWGSANSAFQRTLLPNYSDGVWRPKVGKSGEALPSARLVSINIVPDVDAPSELDTHNVMQWGQFVDHDTTHTPLFRLTNADSNGIQCCLEDGSGPISKLVLHPECFPIELPENDPFFMKHGQRCMNFVRSMPAPQLGCNFGYGEQMNQITSMHDGSNVYGSDEEDVEALRSFKGGLLKSYKPEEDSERTLLPQEEGESKDECEIEETLQDLENRKCFRAGDSRANEQPGLTVFHTVWMREHNRVAKELNYLNPHWDDEKLYQEARKINIAQMQHITYNEWLPIVLGTEYMSELDILPVTYGYNNKYDAKVNPTITNVFAAAAFRFGHTLVQGLLDLVEEVHYERKKTSMIPLSDTFFNPELVYTPGELDKFLVGLATQPSQKFDNIFTEQVTNHLFQPKNKSFGMDLVALNLQRGRDHGLPGYNAFRELCGLKRVTDFDYFNDFIPIKIVERLKLIFDHVDDVDMFIGGISETPVPGALLGPTFQCIIGDQFKRLQHGDRFYYDNSANPGKFTEEQLVEVRKSNLARVHCDNGDNIKLMQPLVFRNPS-QINPLVPCDAITIPKISLYPWKEG 2963          
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Match: gi|592771644|gb|GAXK01182924.1| (TSA: Calanus finmarchicus comp288209_c2_seq3 transcribed RNA sequence)

HSP 1 Score: 472.241 bits (1214), Expect = 7.795e-152
Identity = 253/642 (39.41%), Postives = 367/642 (57.17%), Query Frame = 0
Query:  106 TVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTV-ERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETK-DPRTGKTPKCC-EEGQTAV-----HPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLK---LESPD---EGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTH---RYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            ++I   S+ LA+++ L+ +    GL    T  TI+   CP       C+  ++YRS +G CNN E+P WG + +   R L P ++DG+  PR  K G+ LPS R+VS N+  D        T  ++ WGQF+DHD+T +   + + +     +CC E+G + +     HP C PIEIP +D FF    QRCMNFVRS  G +  C  G  +  N+++ + DA  VY + +E    LR ++DGLLK          K LLP +   LE  +   +   + S D  CF AGD+  NEQ  L   HT++ REHNR+A ELK +NPHWNDE ++QE R I+ A + HI YNE+LP+VLG + M + D++ +  GYS  YD   NP+    F +AAFRFGH+L+   ++   + H   + +    LS+    P  +Y  G  D +L+GL  Q +Q  D+ ++ EVTNHLFQ   K FG+DL ALN+QR R+HG+PGYN +RE  G  ++  ++    L+    V     IY+  DD+D++  GI+E  LPG+++GPT  C++G QF  L+ GDR++Y++   P  FT  QL EIR    +RI CDN D I  MQ  A+  P H INP +PC +  +P ID   W++ 
Sbjct:  566 SMIIFASQSLAERFNLTPNQAGFGLNAFSTKNTILGPNCP---KGGSCSRNKKYRSYDGSCNNQENPLWGTSNSPFQRVLLPAYSDGVFKPRQGKAGDVLPSPRLVSINIVPDIDAPSDLDTHNVMQWGQFVDHDVTHTPLFRLNNKNSSGIQCCMEDGSSPISSLVLHPECFPIEIPENDPFFKSFDQRCMNFVRSMPGPQQTCTFGYGEQMNQITHVHDASNVYGSDEEDATDLREFRDGLLK---THKNTHPKGLLPQEEGDLEGEECQIDSATQDSLDRKCFKAGDSRSNEQPGLTAYHTVWLREHNRLAAELKYLNPHWNDEKLYQEARKILIAEMQHITYNEWLPIVLGTDYMDELDILPVTYGYSGRYDKTVNPTIINSFAAAAFRFGHTLIQGMLDMVREVHFDRQTVSRIPLSDTFFNPELVYVPGELDKFLVGLATQPSQKYDNIITDEVTNHLFQAKDKSFGMDLVALNLQRGRDHGLPGYNAFRELCGSKRVKNFNGFADLIPKQIVERLKLIYKDVDDVDLFIGGISESSLPGALLGPTFQCLVGDQFKRLQQGDRFFYDSEANPGKFTEAQLIEIRHASLARITCDNGDDIHQMQPLALKKPSH-INPLLPCDAITIPIIDLHPWQEG 2470          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000001069 (pep:novel supercontig:LSalAtl2s:LSalAtl2s117:1071016:1073247:1 gene:EMLSAG00000001069 transcript:EMLSAT00000001069 description:"augustus_masked-LSalAtl2s117-processed-gene-10.0")

HSP 1 Score: 1550.41 bits (4013), Expect = 0.000e+0
Identity = 743/743 (100.00%), Postives = 743/743 (100.00%), Query Frame = 0
Query:    1 MFHISMRFSSIILLLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYSPF 743
            MFHISMRFSSIILLLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYSPF
Sbjct:    1 MFHISMRFSSIILLLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYSPF 743          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000000648 (pep:novel supercontig:LSalAtl2s:LSalAtl2s10:912782:918417:-1 gene:EMLSAG00000000648 transcript:EMLSAT00000000648 description:"maker-LSalAtl2s10-augustus-gene-9.24")

HSP 1 Score: 456.062 bits (1172), Expect = 2.059e-142
Identity = 239/641 (37.29%), Postives = 363/641 (56.63%), Query Frame = 0
Query:   95 KFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGF---HDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCK-SGVLPRIDFSKWRDAS 731
            K  + ++  +  V  E ++++AK+Y LSK+ I+  LPL D   T +   C   +  P C   +YR+ NG CNNV++P+WG A   + R+L P++ADGI+                        +GF   H H + I  + WGQFI HD++ + +      G+  KCC+      HP C PI+I S+D F+SK   RC  + RS    R  C LGPR+  N+V+S +D  TVY +S E  E LR +  GLLK   V ++ +  +LL    E+  +        + CF +GD  VNE   L  +HTL+ R+HN++AG L  +NPHWNDE IFQETR II A I HI +NE+LP+VLGKE M +++L+  + G+ + YD  TNP  +    + AFRF  SL+PST +      + I  + LS     P+ LY+ G  DN + GL +  A+  D  +++E+TN +F +     GLD+ A  IQ+ R+HG+PGY  WR++  L  I  + +L  +M   +V+   S+Y S ++ID++  G+ E P  G+++GPT AC+IG+Q +  + GDRYWYEN   PSS + EQL +IRK   + I+C+N  +++ +Q    +  D  +N  +PC    ++PR+ ++ W  AS
Sbjct:  100 KIISKNISKVSLVAEEATKFIAKRYNLSKNDITFKLPLADVRGTALSELCHIKVDFP-CQPGKYRAYNGYCNNVQNPNWGVANRRYLRYLPPDYADGITV----------------------SQGFSEVHPHLMMITAI-WGQFIYHDVSHTPQMAG-YLGQRLKCCDIEFENFHPECYPIKISSNDPFYSKAGLRCQEYARSGTASRTGCTLGPREQINQVTSFIDGSTVYGSSKEEAEELRSFSGGLLK---VQHDKKGSDLLAKDTENSLDCKEDRKSGLKCFKSGDVRVNENLGLVTMHTLWVRQHNKVAGTLGTLNPHWNDEQIFQETRRIIGAQIQHITFNEYLPVVLGKEAMDRYNLLPQQMGFFSGYDINTNPGTANGVATTAFRFIMSLIPSTFKFIDPNGKTIKEEFLSSTFYNPFSLYEDGMIDNLIRGLTHSHAEKEDLVINEEMTNKMFMDSRTGLGLDILAQTIQQGRDHGIPGYTEWRKFCSLSPIRNFGELENIMGKKTVNILKSVYTSVEEIDLFIGGLAEVPSDGAVVGPTFACLIGRQMYYYKTGDRYWYENDIPPSSLSKEQLNQIRKTTLAHIICENIPSVQFIQPKVFIESDPFLNAFMPCHGDSIIPRVSYNGWVTAS 712          

HSP 2 Score: 373.629 bits (958), Expect = 1.647e-112
Identity = 215/582 (36.94%), Postives = 309/582 (53.09%), Query Frame = 0
Query:  157 RYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCE-EGQTAVHPNCLPIEIPSHDTFF-----SKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ-RLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            +YR++ G CNN+  P +G +     R LAP + DG+ +PR+ S TG+PLPS R+VS N+H D        +++++ WGQF+DHDIT +            +C + +  + +HP CLPI +P  D F+     +  K  C+ F RS  G      LG R+  N+++S  D   VY +    +  +R    G L           K+LLPL  E+ +  C   SE  YCF AGDA  +EQ +L  +HTLF REHNRIA EL ++NP W+D+ +F E R I +++  HI +NEFLP VLG   +  ++L LL  GY  SYD   NP+    F +AAFRFGHSL+    +R +  +   G   +L++M   P  L++ G  D+ + G+ +   + LD  ++ EVTNHLF++    + GLDLA+LNIQR R+HG                                                 G+ E  L G ++GPT ACIIG QF NLR  DR+WYE G   + FT  QL EIRK+  S++LCD +D I  +Q     +PD  +NPR+ C+S  LP +D   W++
Sbjct:  852 KYRTLTGWCNNLLFPEYGKSXRAFTRLLAPAYDDGLMSPRSRSVTGSPLPSPRLVSVNIHNDVSTPHVRYSLMMMQWGQFVDHDITHTP-VNSGFADSILECKDCDAASRIHPECLPIPVPKGDPFYPSINITTGKPFCLAFTRSMPG---QLTLGFREQMNQITSFADGSNVYGSDLCEMREIREMHGGRLNSTK--QRHGQKDLLPLTTENKE--C--KSESGYCFEAGDARNSEQPLLTSLHTLFMREHNRIADELIRLNPQWSDDKLFHEARRIASSIQQHITWNEFLPRVLGWNAVNLYELGLLPEGYYRSYDEKCNPTILNEFATAAFRFGHSLIKPKFKRMNNQYSEKGRPLKLADMFFNPDKLHEPGMMDDLIRGVSSTSMETLDQFITDEVTNHLFEDKNTPYSGLDLASLNIQRGRDHG-------------------------------------------------GLAETALHGGLVGPTFACIIGIQFRNLRKCDRFWYEGGNPLTRFTETQLAEIRKVTLSKVLCDTTDDITTIQRAIFDIPDPFLNPRISCQS--LPSLDLDLWKE 1372          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000003246 (pep:novel supercontig:LSalAtl2s:LSalAtl2s178:299489:302526:-1 gene:EMLSAG00000003246 transcript:EMLSAT00000003246 description:"maker-LSalAtl2s178-augustus-gene-3.11")

HSP 1 Score: 423.705 bits (1088), Expect = 9.640e-136
Identity = 214/539 (39.70%), Postives = 333/539 (61.78%), Query Frame = 0
Query:  201 GNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEG----QTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELL--PLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYI-GSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASY 732
            G  L   R+V    H+      +  T++++ WGQF+DHD+T + +T+         C  +G     + +HP+C+PI+IP  D F+S    RCM FVRS    R  C LGPR+  N+++S LD   VY +S++  +SLRLY  G L+    + +  +++ L  PL+    +E C   +++++CF AGD   NEQ  L  +HT++ R HN IA +L ++N HW DE I+QETR I+ AL+ HI YNE+LP++LG +V++  +L LL   Y   Y+   NP+ +  F +AAFRFGHSL+  +I R +K  + +    +L +    P +L+  G  D  L+GL+ + A   D+ +S+E+TN LFQ P   +G+DLA+LNIQR R+HG+P YN WRE  GL + +RWS+   +++ S++   + +YE  DD+D+++ G+ E  + G ++GPTLACI+G+QF NLR GDR+WYENG  P +F+ EQL+EIR++  S ++CD  D I+N+Q Y+ +  +   N R+PC    +PR+    W + S+
Sbjct:  164 GLYLVQERLVRQ-XHKKSSAETNQFTMMVMQWGQFLDHDLTSTPQTRGFNDSILQCCNGDGANLRDSDLHPDCMPIDIPHDDYFYSSFGARCMEFVRSSPSARLGCTLGPREQVNQITSFLDGSNVYGSSEDDEKSLRLYISGKLR----YTDLHIRKALLPPLESTVANEECHITTKNLHCFHAGDQRANEQPGLTGMHTIWLRFHNHIAQKLSRLNTHWEDEKIYQETRKIVGALLQHITYNEWLPVILGPKVLEIFELKLLTKEYYKQYNKSVNPTIANAFAAAAFRFGHSLVKGSISRCNKEFKTVPFFVKLHKEFNNPMNLHNFGSVDRILLGLLTEKAAKRDEFISEELTNRLFQIPLTHYGMDLASLNIQRGRDHGIPSYNVWREQCGLKRFNRWSEAFSVIAPSTIERLSGVYEDFDDVDLFTGGLAEHRVAGGLVGPTLACILGQQFLNLRQGDRFWYENGDHPGAFSKEQLQEIRRVTLSGVICDTLDDIDNIQPYSFLTNEALRNERIPCSK--IPRLRLDAWSETSF 695          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000009839 (pep:novel supercontig:LSalAtl2s:LSalAtl2s63:1106053:1116580:-1 gene:EMLSAG00000009839 transcript:EMLSAT00000009839 description:"maker-LSalAtl2s63-snap-gene-10.65")

HSP 1 Score: 421.779 bits (1083), Expect = 1.148e-129
Identity = 250/681 (36.71%), Postives = 373/681 (54.77%), Query Frame = 0
Query:   67 SNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEG----YCPPFLMTPKCT-VERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPR-ASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKD-PRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFF-----SKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKM-LPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIER----WSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            SNT +  E  +  F  +L+     P   +      GN  ++             ++ D  ++GL  ID T+ I        CP    +  C    +YR++NG CNN+ +P +G ++    RFL+  + D IS PR  S TG  LPS R+VS  +H D        T++L+ +GQF+DHDITL+   K  P +    + C+  +T VHP C PI +P +D +F     +  +  C+ F RS  G +   RLGPR+  N+ ++ +DA  +Y N       LR   DG L   LP  +    K L+P   +S ++ C   S   +CF  GDA  +EQ  LA +HT+F REHNR+  +LK+VNPHW+D+ ++ E RHI++A+  HI YNEFLP ++G   M  ++L +   GYS+ Y++  NP     F +AAFRFGHSL+   + R    W +  ++I   RL +    P  LY+    D  + GLV    +  D  +S E+TNHLF+E    F GLDLAALNIQR R+HG+  YN +R    L K   + DL   ++   +     +Y+S DD+D+++ G++E PL G+++GPT ACIIG QF  ++  DR+WYEN    + F+  QL EIRK+   +I+C+N D + ++Q      P   +NPRVPC+S  +P ID S W++
Sbjct:  773 SNTSLLLEYTSRVFINSLQE----PENNRIKRQVTGNSDSI------------DVNIDDFADGLTNIDVTRVIPTNAPLEVCPFDENSLPCDHTHKYRTMNGWCNNLNNPQYGKSVTPLVRFLSAKYDDAISRPRFRSATGKSLPSPRMVSIVVHADVSHLHGRYTLMLMQFGQFLDHDITLTPVNKGFPDSILDCRGCDSART-VHPECWPISVPKNDPYFPALNTTSGRAHCIAFTRSLPGQQ---RLGPREQVNQNTAFIDASMIYGNDKCDSIDLRQNIDGRLNTTLP--SHGRGKHLMPK--DSSNKECKAASG--FCFKGGDARASEQPGLAALHTIFLREHNRLVTKLKRVNPHWSDDELYYEGRHILSAVNQHITYNEFLPRIIGWNYMNLYNLRVQTQGYSSDYESTCNPGIFNEFATAAFRFGHSLIRPMLTRMSADWKEKKKHI---RLRDGFFNPDMLYQETMIDEVIRGLVATPMENQDQFISGEITNHLFEEKKIPFSGLDLAALNIQRGRDHGLRPYNEYRVACNLKKARTFEDLGREINADVIKRLKQVYDSVDDVDLFTGGLSENPLQGALVGPTFACIIGIQFQKIKKCDRFWYENNDANNRFSEAQLTEIRKMTLGKIICENCDIVGDIQKSIFDQPHEFLNPRVPCRS--VPDIDLSHWKE 1422          

HSP 2 Score: 331.257 bits (848), Expect = 1.202e-97
Identity = 203/634 (32.02%), Postives = 322/634 (50.79%), Query Frame = 0
Query:  111 TSRYLAKQ---YGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKT--GNPLPSARIVSSNM---HRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCE---EGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKM-LPVFNEFEMKELLPLKLESPDEGCIRPSEDVY-CFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDAS 731
            ++ +L +Q   Y L +  +S+ +  +    T++   CP  +    C  ++YR+ N  CNNV++P WG     + R + P + DG+  PR S       LP A  VSS +   H +   H+H +T +   WG+F+ HDI+ +     P +G   +CC+     + A+   C PI            +  C  +VRS  GL+  C LGPR+  N  ++ LD   +Y ++ ++ E  R  + GLLKM  P  N      +LPL   +P+    RP+ D + CF +GD  VN    LA++HTL A+EHNR+A  L+ VNPHW++ET++QE R I++A I HI YNE LP +LG+ +M+  DL    NGY+  YD     +      +A   F  SL P  +  ++   +  G    +     P+           L+GL    AQ  D  ++++   +L Q        DL A  I R R+HG+P Y   RE  GL  +  + +L   +    +    + YE   D+D++  G+ E+PL G ++GPT  C++G+QF  L+ GDR+WYEN   PS++  +QL E+RK+  + ++C N   I  +Q    +  D  +N  V C   + P+I+F +W+  S
Sbjct:  118 SNHFLRRQQGTYALGRGEVSSRVENVRIEDTMLSELCPD-VRASFCFPQKYRTPNAECNNVKNPMWGVTGAAYLRLVEPQYEDGVGXPRESSILEEKKLPDASTVSSKLVWTHNNP--HEH-ITAIAATWGEFVAHDISYTL----PLSG-FEQCCDSMFRKENAME--CFPI---------VNDQTVCQEYVRSAIGLKPGCVLGPREQMNFATAFLDGSGIYGSTPKSGEDRRKLEGGLLKMGDPEGN------VLPLDKNNPN---CRPNLDGHECFKSGDERVNHNAGLAVLHTLLAKEHNRVARSLEGVNPHWDEETLYQEARRIVSAEIQHITYNEXLPAILGEVLMKTFDLEPKSNGYNMEYDEXLPVTTLNSVGNAILPFVLSLFPPKLNFFNSKGKQTGQVPFNSTYWAPFHAKDKKLISEILLGLSRTPAQKADLVMARDTKIYLNQ--------DLVANIIHRGRDHGLPTYTQVRETCGLSPVRNFEELSNTVDKEVIGLLETTYEHVSDVDLFIGGLAERPLSGGVVGPTFGCLLGQQFQILKKGDRFWYENNIPPSAYGKDQLLELRKVTLASLICSNFKDIHEVQPEVFLNSDPYLNSPVHCD--IFPQINFQQWKTDS 712          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000001116 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1186:32429:36877:-1 gene:EMLSAG00000001116 transcript:EMLSAT00000001116 description:"maker-LSalAtl2s1186-snap-gene-0.11")

HSP 1 Score: 399.823 bits (1026), Expect = 7.604e-128
Identity = 221/602 (36.71%), Postives = 327/602 (54.32%), Query Frame = 0
Query:  128 NGLPLIDTTKTIIEGYCPPFLMTPKCT-VERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSK-THRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKW 727
            NG     T   + +  CP    +P+C   E+YR+  G+ NN   P +GA      R L   + DG   PR    G+PLPSAR+VS+++ R         T +L++ GQF+DHD+ +         G T  CC          C PI IP  D  F      C+NFVRS +    +C  GP +  N+++  +D   +Y ++ E    LR ++ G L+M       +   LLP   E  +E C+   ++  CFLAGD+ VNEQ  LA++HTL+ R+HN++A EL + NP WNDET+FQE + I++A   H+ +NE+LP+ LG  +M+   L  L+ G+S  Y    +P  +  F +A FR GH+L+PS ++ +S  + R     +L  +   P  L   G  D   +G+V Q  +  D+S ++E+T+HLF+  G   GLDL ALNIQRAR+HG+PGY  +RE  GL +   + DL   +S   +    SIY+S DDID++     E     + IG T  CII  QF  L+ GDRY+Y+      SFT  QL+EIRK   SR++CDN++ I+ +Q  A+  PD+  N   PC+S  +P+ +   W
Sbjct:  133 NGQCTTRTENIVFDQNCP---RSPRCNPNEKYRNPRGLXNNXRQPLFGAVFTPVQRILRNAYFDGFEIPRRDSNGSPLPSARLVSTSITRKNKNTASQYTNILMSMGQFLDHDL-VHVPVHRLDNGDTIDCCSTRFGNNSLQCFPISIPRGDISFGSRT--CINFVRSLSAPDLDCNPGPNEQLNQLTHWIDGSNIYGSTQEETNKLRSFRGGKLRM-------KRSSLLPEDNE--NEECV---DEFECFLAGDSRVNEQLTLAVMHTLWVRQHNKVADELSQFNPFWNDETLFQEAKRIVSAQWQHVIFNEWLPVXLGPTMMESFGLWTLRRGFSFDYRNDFDPRITNEFAAAGFRVGHTLIPSFLKAYSLISSRLTRRWQLRSIFNDPGVLETPGVFDEVALGMVIQNVEDFDNSFTEEITDHLFERNGD--GLDLIALNIQRARDHGIPGYVRYREICGLGRARTFEDLGSNISRRKIAQLKSIYKSVDDIDLFIGMTLEDKFRDAFIGRTFLCIISDQFARLKKGDRYFYDLSNQAGSFTSAQLDEIRKFSLSRLICDNTN-IKEIQPLALEQPDNIYNILTPCRSSAIPKTNLFPW 713          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000002939 (pep:novel supercontig:LSalAtl2s:LSalAtl2s168:430928:460867:-1 gene:EMLSAG00000002939 transcript:EMLSAT00000002939 description:"maker-LSalAtl2s168-snap-gene-4.8")

HSP 1 Score: 370.933 bits (951), Expect = 1.121e-116
Identity = 213/543 (39.23%), Postives = 306/543 (56.35%), Query Frame = 0
Query:  101 VGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEG-YCPPFLMTP-KC-TVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEG----QTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKN-GYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQ----QPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSS-VHGYASIYESPDDIDIWSAGITEK 630
            +G+    +   + +++ ++ L++D    GLP +D   + I    C      P  C T E YR ++G CNN  +P+WG A     R L   + DGIS PR   +   LPSAR VS  +  D        T+LL+ WGQF+DHDIT S   +     +   CCE+G    ++  HP C  IEI   DTF+S+  +RCM FVRS   LR  C LGPR+  N++++ +D   +Y +       LRL K G L++     ++  +ELLPL   +P+E C    E  YCF AGD  VNEQ  L ++HT++ REHNRIAGEL  +NP+WNDE IFQE R I+ A + HI YNE+LP++LG + + + DL  L+N  YS SYD   NPS + VF +AAFRFGH+L    ++ +  +HR  G  R + +L     +PY++Y     +N + G+  Q +Q  D S +QE+T  LFQ   +  G+DL ALNIQR R+HG+  Y  +R   GL +I  W D   ++S+   V     IY   DD+D++  G+ E+
Sbjct:  182 IGSSAQSVEFAALHISDEFRLTRDQKRFGLPNVDVNNSAIRNQICSSGDFRPLTCSTSEIYRRIDGSCNNFNNPNWGKANIPLERLLPATYDDGISIPRGENSD--LPSARKVSDVLIGDRDAPSPIYTLLLMQWGQFMDHDITHSPIVRGD-DDEELMCCEDGKILDESRRHPECFHIEITEDDTFYSRFGRRCMEFVRSSPSLRSECNLGPREQVNQITAFIDGSQLYGSEKAENIRLRLGKQGRLRV----TKYGHQELLPL---NPEE-CSDDDEQRYCFEAGDTRVNEQLHLTLMHTIWLREHNRIAGELAYLNPYWNDERIFQEARKIVGAQLQHITYNEWLPLILGDKFVNEEDLRPLENYEYSESYDPSVNPSITNVFSTAAFRFGHTL----VQGFLHSHRGDGFDRKTIVLHETNFEPYEMYLKNAINNLINGITTQRSQDFDASFTQEITRRLFQ-GNESVGMDLVALNIQRGRDHGIQSYVRYRRVCGLSEIRTWRDFSQVVSSPELVPRLQLIYNDVDDVDVFIGGVMER 708          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000005120 (pep:novel supercontig:LSalAtl2s:LSalAtl2s270:285700:294491:1 gene:EMLSAG00000005120 transcript:EMLSAT00000005120 description:"maker-LSalAtl2s270-augustus-gene-3.23")

HSP 1 Score: 370.933 bits (951), Expect = 6.448e-116
Identity = 218/614 (35.50%), Postives = 327/614 (53.26%), Query Frame = 0
Query:  145 PPFLMTPKCT-VERYRSVNGMCNNV-EHPHWGAAMNGHHRFLAPNFADGISAPR-ASKTGNPLPSARIVSSNMHRDEGF--HDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTA-VHPNCLPIEIPSHDTFF----SKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVY--CFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLK-NGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKK-------FGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSS 738
            P    T +C+  + Y  ++G CNN+ ++  WG+ +    R L   + D IS P+  S  G+ LP+AR+VS+  H+        H  T++L+ WGQF+DHDI+ +   +  R+G+   C     T  VHP C PI IP +D +F       K+RC+ F RS  G +    +G R   N+ S LLDA  VY +S  +  +LR +K G LK+     +   K L+P+K        I   E  +  CF +GD   NEQ  L  +HTLF REHN I  +L+  NP W+D+T+FQE R I+ A+   I YNEF+P +L  ++  +  LIL K N Y   Y++  +      F +AAFRFGH+L+   I   ++  R     RL      P  +    + D  + GL NQ  +  D  +  ++ N LF+E   +        GLDLAALNIQR R+HG+PGY  +R W     I  +++LR + + + +    S+Y++  DID+++ GI E+ + G ++G T  CIIG QF +LR+ DRYW+EN      FT  QL EI+K+  + I+C N D   N Q + M +P+ + N ++ C S   P ID   W D  +  S ++
Sbjct:   93 PSRCDTLRCSPSDSYSKLDGACNNLWKNRRWGSRLQPLRRILPSVYNDHISEPKIKSINGSYLPNARVVSNAFHQGNRITSRKHNYTLMLMQWGQFLDHDISFTPNVRALRSGEAFNCNSCDSTLFVHPACFPIMIPKNDPYFPAQAHDQKRRCLTFTRSMPGQK---NIGKRQQLNQNSGLLDASHVYGSSICSSNALRKFKYGHLKVTNHPYQSYFKPLMPMKQN------IFECESHFGMCFHSGDDRSNEQPGLTSLHTLFVREHNYICDQLRIYNPKWSDDTLFQEARRILRAINQQITYNEFIPRILNHQMRSKFGLILQKRNTYFPDYNSSCSADVFNEFSTAAFRFGHTLIAPMINMINQIQRIPKHVRLRHHFNNPDIMQSPKFIDYLVNGLSNQKIEEYDSFIESDLRNRLFEEIKSRNSSFVPHSGLDLAALNIQRGRDHGIPGYVKYRNWCKKENITSFNELRRVFNKTIIRKLKSVYKNVQDIDLFTGGILEESMKGGLVGETFGCIIGLQFKHLRYCDRYWFENPFPYMRFTRAQLREIKKVSLASIVCRNCDQPRNFQKFIMDMPNDQNNYKLKCSSH--PNIDLKHWIDQRHKNSSAN 695          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000006920 (pep:novel supercontig:LSalAtl2s:LSalAtl2s391:540984:570159:1 gene:EMLSAG00000006920 transcript:EMLSAT00000006920 description:"maker-LSalAtl2s391-augustus-gene-5.32")

HSP 1 Score: 347.821 bits (891), Expect = 2.862e-104
Identity = 204/537 (37.99%), Postives = 299/537 (55.68%), Query Frame = 0
Query:  193 SAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTH-RYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYE-NGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKW 727
            S PR +  G  LPSAR VS+    +    +   T LL+A GQFIDHD+ +         G+   CC          C PI IP +D  F  H + C+NFVRS      +CR GP +  N+++  LD+  +Y +++E L +LR ++ GLL + P        E LP  +   ++ C+ P+    CFLAGD+ VNEQT L  +HTL+AR+HN++A  L   N  W DE +FQ TR I+ A   H+ YNE+LP+VLG   MQ+  L  L+ G+S+ Y    +P  +  F +AAFR GH+L+PS +  ++  + +  GS  L      P  L   G+ D    G+V Q  +  D+ +S E  NHLF+   +  GLDL A+N+QR R+HG+PGY  + E  G  KI R+ DL+  M+  +++    IY +  DID++   + E     S+IG T  CII  QF  L+ GDR++Y+ +G    SFTLEQL EIRK  FSR++CDN++ I  +Q +A+   +H+ N    C S  +P   ++ W
Sbjct:  674 SMPRRANDGRDLPSARFVSTMSTNNLLRPNVRFTNLLMASGQFIDHDL-VHVPVFSKEDGEGFDCCSALLGNNTLECFPISIPPNDLEF--HPRTCLNFVRSLPAPDIDCRAGPNEQMNQITHWLDSSNIYGSTEEELIALRTFRKGLLTLDP------ENENLPPNIN--NDECLDPNN---CFLAGDSRVNEQTALTSVHTLWARQHNKVATVLNSQNSTWTDEELFQVTRQIVNAQWQHVVYNEWLPIVLGPTTMQEFGLWTLRKGFSHDYRDDFDPRITNEFAAAAFRVGHTLIPSALRSYNILNAKPTGSLLLRNNFNNPKQLQTPGFLDEITFGMVIQNIEDFDNRISDE--NHLFELNDE--GLDLIAVNLQRGRDHGIPGYIFYLEICGSRKIKRFEDLKYNMALENINLLKRIYNNVKDIDLFIGMLLEVRSKDSLIGRTFLCIITDQFARLKRGDRFFYDLDGKSTGSFTLEQLNEIRKFSFSRLICDNTN-IPRIQPFALENANHQYNIITSCDSPSIPSPQYTIW 1191          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000013035 (pep:novel supercontig:LSalAtl2s:LSalAtl2s99:469219:492645:-1 gene:EMLSAG00000013035 transcript:EMLSAT00000013035 description:"maker-LSalAtl2s99-augustus-gene-5.19")

HSP 1 Score: 339.347 bits (869), Expect = 8.837e-104
Identity = 207/557 (37.16%), Postives = 293/557 (52.60%), Query Frame = 0
Query:  153 CTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRAS----------KTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQ--------QPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSD 691
            C V++YR++ G CNN+++P WGA+     R +   + +  S P             K+G PLP+ R++S N  +D+       T +L  +GQF+DHD+TL+     P       CCE+        C PIE+   D FFSK KQ C+   RS+      C   PR  FN V+S +DA  VY + +E  + LR+    LL+          K LLPL ++               FLAGD   +E   LA +H LF REHNRIA  L + + H + E IFQE R I+ A + +I Y EFL  +LG      +DL L ++ +   YD F NPS S  F +AAFRFGHS++  +I+R     R I +  L    Q          Y        +  + GL  Q AQ+ D  +  +VT  LF+E   KFG DL A NIQR+R+HG+P Y  +R+ XGL  I  W      +S  + +     Y+SP+DID++ AG+ E PL GS++G T AC+IG+QF  LR GDR+++ + G   SFT EQ++ IRK   S+I+CDN+ 
Sbjct:  108 CQVKKYRTITGECNNLQNPKWGASFTPFARVIEARYGNDESNPTTVGQHYEKPGCLKSG-PLPNPRLLSVNFFKDKNRPLSRATHMLAQFGQFLDHDLTLT-----PEAHVDVPCCED---PSQEECNPIEVSRKDPFFSKFKQTCLELTRSEKF----CNSRPRQQFNAVTSFVDASNVYGSEEELAKELRVPNSYLLRTTRTKTG---KSLLPL-IDGE-------------FLAGDERSSEMPGLATMHNLFLREHNRIAKLLAEHHGHKSKEEIFQEARRIVGAEMQNIVYGEFLHGILGYRRFH-YDLNLKQSSF---YDPFMNPSTSNSFATAAFRFGHSMVEGSIQR-----RSISNNALIRTFQLKNNFNNLNEYTAKNGRGMEEIICGLFTQSAQSPDRFIIDDVTRFLFREKNSKFGQDLMARNIQRSRDHGLPPYGAFRQAXGLKPICNWKTRPSSISXQNWNLLKRWYKSPNDIDLFVAGVAETPLSGSVLGETFACLIGRQFRALRDGDRFFFTHYGQSGSFTFEQIKSIRKRTLSQIICDNTQ 625          
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Match: EMLSAP00000011219 (pep:novel supercontig:LSalAtl2s:LSalAtl2s769:20521:24395:-1 gene:EMLSAG00000011219 transcript:EMLSAT00000011219 description:"maker-LSalAtl2s769-snap-gene-0.9")

HSP 1 Score: 338.576 bits (867), Expect = 9.916e-104
Identity = 214/644 (33.23%), Postives = 329/644 (51.09%), Query Frame = 0
Query:   99 DDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDT-TKTIIEGYCPPFLMTPKCTVE-RYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADG-ISAPRASKTGN-PLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPN------CLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPS--TIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPS-SFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            ++V ++     +T+  + +   LS      GL   D  +   I   CP +   PKC    RYR  +G CNN+++P+ G A   + R L P +++G +  PR SK  N  LPSAR +S  + +     D   T+L++  GQFIDHD+T +     P  G   +CC  G     P+      C PI I  +D F+ K K+RC++  RS +     C L  R   N+++  LDA  +Y ++ E ++ LRL+K+G L +                                            +  +    ++ REHNRIA  L K+N  W++E +FQE+R I+ A   HI   E+LP +LG E M  + L  L+NG+S  Y    +   +  F +AAFRFGHSL+PS  +++ +S+      +  L ++  +P+ +  +   D  + G+V+Q     D+S  +E+T+HLF+      GLDL A+N+QR+R+HG+PGYN +RE     K   + D   +M NS++     IY+  DDID++  G +E+    S++GP   CI+G QF  L+ GDRY+Y+ G   + +FT EQL EIRK+  SRILCDNSD+I  +Q  A    D   N    C S  +P +  S + D
Sbjct:  212 EEVDHIAVDFVDTANKVKEDNNLSDAEAGIGLRSFDIDSSNEINNLCP-WSPPPKCEPNXRYRXADGTCNNLKNPNMGRAKTPYQRILLPEYSEGSLQLPRRSKVRNTELPSARDLSVQLTQSNDDIDPQFTVLVMQMGQFIDHDLTHT-----PNHGI--RCC--GPRGSFPDTFDGSKCFPIPISENDPFW-KGKKRCLSLARSLSAPGLKCELEFRQQMNQITHWLDASNIYRSTKEEMDHLRLFKEGKLSI--------------------------------------------STQSGTQKVWIREHNRIASFLGKLNSQWSEEKLFQESRRIVTAEYQHIILKEWLPSILGNEFMTTYGLWPLQNGHSTQYLDI-DSRITNEFATAAFRFGHSLIPSKFSMKTFSQGRSRSXATNLKDLFFKPHQIKSSEDIDGLIRGMVSQEGSPWDNSFVKEITDHLFEGRPGTGGLDLVAINVQRSRDHGIPGYNAYREICQFNKAKTFEDFSDVMGNSTIQKLKRIYQHVDDIDLFVGGFSEERHKDSILGPVFKCILGDQFARLKLGDRYFYDLGIDKNIAFTNEQLNEIRKVSMSRILCDNSDSITMIQPRAFRNMDRR-NKLTSCSSSSIPFVGLSVFED 798          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|229462993|sp|Q9VEG6.3|PERC_DROME (RecName: Full=Chorion peroxidase; AltName: Full=Peroxinectin-related protein; Short=Dpxt; Flags: Precursor)

HSP 1 Score: 384.415 bits (986), Expect = 6.566e-121
Identity = 232/638 (36.36%), Postives = 346/638 (54.23%), Query Frame = 0
Query:  108 IHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVER--YRSVNGMCNNVEHPH--WGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCE-EGQTAVHPN-----CLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDV--YCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYE--NGGWPSSFTLEQLEEIRKIKFSRILCDNSD--TIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWR 728
            +  T  +  K+    +D I+N +P I  T+T +  +C P    P C   R  YRS++G CNN E     WGAA     R L P + DGI  PRA S  G PL  AR +S  +  D         ++++ +GQ + HDI+ ++  +    G   +CC  EG+ A+ P      C+PI +   D FFS    RC+NFVR       +C+L       +V+  +DA  VY +SDE   SLR ++ G L+M+   N+F  ++LLPL  +   + C  PSE+    CF +GD   N+   L  +  L AREHNR+AG L ++NP  +DET+FQE R I+ A + HI YNEFLP+++G + M++  L+ L  GYS+ Y+   NP+ +  F  AA+R GHS +    +   +  R      + +++  P  + K  + D+ L  L +Q  Q +D S+SQ ++  LF+     FGLDLAA+NIQR R+ G+  YN + E  G PK+H +      ++       + +Y +PDDID+W  G+ EK + G ++G T A II  QF   + GDRY+YE  NG  P +F   QL+EIRK+  +R+LCDNSD  T++ + + A V  DH  N  + C    LP ++   WR
Sbjct:  189 VMTTQLFGKKEQVPVEDFITNNVP-IKFTETPLAHHCQP---PPVCGNIRSVYRSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGIWTPRAHSSDGTPLLGARKISRTLLSDVDRPHPKYNLMVMQFGQVLAHDISQTSSIR-LEDGSLVQCCSPEGKVALSPQQSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSSDEASRSLRAFRGGRLRMM---NDFG-RDLLPLTNDK--KAC--PSEEAGKSCFHSGDGRTNQIISLITLQILLAREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGPQQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSVDGKFQIRQEHGRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQPMQQVDSSISQGLSRFLFRG-DNPFGLDLAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQFPIEIAQK----LSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAEIIADQFARFKQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLLCDNSDRLTLQAVPLAAFVRADHPGNQMIGCDDPNLPSVNLEAWR 808          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|290457651|sp|Q01603.2|PERO_DROME (RecName: Full=Peroxidase; Short=DmPO; AltName: Full=Chorion peroxidase; Flags: Precursor)

HSP 1 Score: 353.599 bits (906), Expect = 1.843e-110
Identity = 204/586 (34.81%), Postives = 313/586 (53.41%), Query Frame = 0
Query:  153 CTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQ----TAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRL--GPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLE-SPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILL--KNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            C    YR+++G CN++E P  G A + + R L P +ADGISAP  S TG+ LPSAR+VS     ++   D   T+  + WGQ + HD+++ A     +   T  C ++G+       H  C  I +P HD  +S+    C+NFVR+      NC+   GP +    V+S LD   VY NS +    +R ++ G +    +  E    + LPL    + D   +  SE   C+ +GD  VN+   LA++ T+  REHNRIA  L  +NPH++D T+FQE R I  A    I+Y E+LP+ LG E M ++ LI       Y N +D   +PS      +AAFR+ HS +   ++  S+  + +GS  LS+   +P  +      D+   G   Q  +  D +  +++ + LF+     FG DL +L+IQR R+HG+  YN  RE+ GL + H W     L+S   +    S+Y S +D+D+      E  + G++ GPT  CI+ +QF+  R GDR+++ENG   + FT +QLEE+RK   +R+LCDN + I +MQ  A     H  NP +PC +  +P++D +KW D
Sbjct:  100 CEKTAYRTLDGSCNHLEQPGLGVANSKYGRLLTPKYADGISAPTRSVTGDELPSARLVSLVAFGEQDVPDPEFTLHNMQWGQIMTHDMSMQAGGTQSKKHPTRCCTDDGRLIGLDTAHKTCFAIIVPPHDPAYSQVGTECLNFVRTLTDRDSNCQYQGGPAEQLTVVTSYLDLSLVYGNSIQQNSDIREFQGGRM----IVEERNGAKWLPLSRNVTGDCDAVDASE--VCYRSGDVRVNQNPGLAILQTILLREHNRIADALSALNPHYDDRTLFQEARKINIAQYQQISYYEWLPIFLGGENMLKNRLIYKAPSGSYINDFDPNIDPSVLNEHATAAFRYFHSQIEGRLDLLSELRQVLGSLTLSDWFNRPGIIEVGDNFDSLTRGHATQPEELTDINFDRQIKHFLFRR-NMPFGSDLRSLDIQRNRDHGLASYNDMREFCGLRRAHSWEGYGDLISPPILEKLKSLYPSHEDVDLTVGASLEAHVAGALAGPTFLCILTEQFYRTRVGDRFFFENGDKLTGFTPDQLEELRKASMARLLCDNGNHISSMQPEAFRTVSHS-NPIIPCSN--IPQVDLTKWID 675          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|93140516|sp|Q7QH73.3|PERC_ANOGA (RecName: Full=Chorion peroxidase; Flags: Precursor)

HSP 1 Score: 337.035 bits (863), Expect = 2.690e-103
Identity = 213/590 (36.10%), Postives = 303/590 (51.36%), Query Frame = 0
Query:  157 RYRSVNGMCNNV--EHPHWGAAMNGHHRFLAPNFADGISAPR--ASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTP-KCCEEGQTAV------HPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEM-KELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKK-FGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLP-GSMIGPTLACIIGKQFHNLRHGDRYWYENGGW--PSSFTLEQLEEIRKIKFSRILCDNSDTIENMQV--YAMVLPDHEINPRVPCKSGVLPRIDFSKWR 728
            RYRS++G CNN       WGAA     R L P + DG+ APR  +S +G  L SAR +S  +  D    D    +LL+ +GQF+ HD T SA     R G+   +CC    +        H  C+PI +   D F+S+   RC+NFVR        CRLG     N V+  +D   VY +++    SLR ++ G L+     + F   +ELLP    +       P     CF AGD  VN+   L  +HTLF REHNR+A  L  +N HW+DE ++QETR I+ A++  I YNE+LP ++G    +Q+ L+      ++ Y     P+       AAFRFGHS +          HR      + E+   P  L +  + D++L  L++Q  Q LDDS++  +T  LF   G+  FG DLA+LNIQR R+H +  YN +R W GL ++  +     + +       AS+YE PDD+D+W  G+ E P   G++ G T A II +QF  L+ GDRY+Y NG    P  FT EQL E+ K+  + ++C N D  +       A   P  E NP VPC++  L  +D S WR
Sbjct:  199 RYRSLDGSCNNPVPARSSWGAAGYPFERLLPPAYEDGVWAPRVHSSVSGRLLASARDISVAVFPDVDRRDRKFNLLLMQFGQFMSHDFTRSASV---RIGQEEVQCCNAEHSGALRGEQAHFACMPIAVSPADPFYSRFGIRCLNFVRLALARDGKCRLGYGKQLNRVTHFIDGSAVYGSNEALAASLRTFEGGRLR-----SSFPTGEELLPF---ARTRAACEPWAKA-CFRAGDDRVNQIVSLTEMHTLFLREHNRVATALAALNRHWDDERLYQETRRIVGAVMQKIFYNEYLPSIVGHSKARQYGLLDSHGEQTDFYSPDVKPAVFNELSGAAFRFGHSTVDGAF-LIQHRHRRTELVPIQEVFLNPSRLLQRSFFDDFLFSLMDQPQQQLDDSITFGLTRLLFA--GRNPFGSDLASLNIQRGRDHALRPYNDYRSWAGLERLTSFEQFGPVGAR-----LASVYEFPDDVDLWVGGLLEPPTQDGALFGETFAAIISEQFARLKFGDRYYYTNGPRTNPGFFTGEQLRELSKVSLASVICANLDQADGFSAPRDAFRQPS-EHNPPVPCQT--LVGMDLSAWR 765          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|166208492|sp|P82600.3|PERC_AEDAE (RecName: Full=Chorion peroxidase; Flags: Precursor)

HSP 1 Score: 333.183 bits (853), Expect = 1.385e-101
Identity = 210/589 (35.65%), Postives = 303/589 (51.44%), Query Frame = 0
Query:  157 RYRSVNGMCNNV--EHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTA------VHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMK-ELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGW--PSSFTLEQLEEIRKIKFSRILCDNSDTIENM-QVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASY 732
            RYR+++G CNN   +   WG       R L P + DG+ APR  S TGN LPSAR++S  +  DE   D  + IL +  GQFI HD TLS      + G+  +CC    TA       H  C PIE+P +D F+S+   RC+N VR +      C+LG     + V+  LDA TVY ++++    LR ++ G LK     + F    ELLP         C+ P   V C+  GD   N+   L M+HTLF REHNR+A  L K+NPHW+DE ++QE R I+ A   ++ YNEFLP++LG E +QQ  L    + Y+N YD    P       +AA R+GHSL+     R+           + ++   P    +    D  +     Q  + +D  L+  +T  LF+E  K FG DLA+LNIQR R+  V  YN +REW GL +I   +D   L    ++   A +YESPDD+D+W  G+ E P  G+++G T   ++   +   +  DRY++ NG    P +FTL+QL EIR+   + I+C N+D  E+  Q    +      N  VPC       ++   WR+  +
Sbjct:  221 RYRTIDGSCNNPLPDRTSWGMEGYPFDRVLEPAYEDGVWAPRIHSVTGNLLPSARVISVALFPDEYRPDPRLNILFMQMGQFISHDFTLSRGFTT-KHGQAIECCTPNCTAPLFGPHRHFACFPIEVPPNDPFYSRFGVRCLNLVRIRLAQGPECQLGYAKQADLVTHFLDASTVYGSTNDVAAELRAFQQGRLK-----DSFPNGIELLPFARNR--TACV-PWARV-CYEGGDIRTNQLLGLTMVHTLFMREHNRLAVGLSKINPHWDDERLYQEARRILIAEYQNVVYNEFLPILLGHERVQQLGLADPFDTYTNYYDPNLRPMTLAEVGAAAHRYGHSLVEGFF-RFLTRESPPEDVFIKDIFNDPSKTLEPNSFDVMMFSFNQQPMEQMDRFLTYGLTRFLFKE-RKPFGSDLASLNIQRGRDFAVRPYNDYREWAGLGRI---TDFNQLGEVGAL--LAQVYESPDDVDLWPGGVLEPPAEGAVVGSTFVALLSAGYTRYKRADRYYFTNGPEVNPGAFTLQQLGEIRRTTLAGIICANADHKEDFYQAQEALRQSSADNVPVPCTR--YDTVNLGLWREEGF 790          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|129831|sp|P09933.1|PERT_PIG (RecName: Full=Thyroid peroxidase; Short=TPO; Flags: Precursor)

HSP 1 Score: 329.717 bits (844), Expect = 3.898e-99
Identity = 217/660 (32.88%), Postives = 324/660 (49.09%), Query Frame = 0
Query:  106 TVIHETSRYLAKQYG---LSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKC----TVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASK-----TGNPLPSARIVSSNM---HRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGL---RYNCRLG------PRDTFNEVSSLLDAGTVYSNSDETLESLRLY--KDGLLKMLPVFNEFEMKELLPLKLESPDEGCIR---PSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERW-SKTHRYIGSQR-LSEMLQQPYDLYKAGWADNYLMGLVNQVA--QALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHG-YASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIE-NMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            T + E  R + ++     L  D +S    L+ T   +    C P ++ P C       +YR + G CNN +HP WGA+     R+L P + DG++ PR         G PLP  R V+  +     +    D   + LL+AWGQ+IDHDI  + ++           C+       P C PI++P++ +        C+ F RS A     R    +G      PR   N ++S LDA TVY +S    + LR +   +GLL++     +     L      +P         P+    CFLAGD+  +E   L  +HTL+ REHNR+A   K +N HW+ +T++QE R ++ AL   +   +++P +LG E   QH       G    YD   +P+ S VF +AAFRFGH+ +   + R  ++   + GS   L     QP+ L + G  D  L GL+ + A  Q  D  +++E+T  LF        LDLA++N+QR R+HG+PGYN WRE+ GL ++  W+DL    +N  V      +Y+ PD+ID+W  G+ E  LPG+  GP  ACIIGKQ   LR GDR+W+EN   P  FT  Q  E+ +   SR++CDNS      +  + +     E     PC S  +  +D   WR+A
Sbjct:   96 TAVQEVKRRVCRRRDTDQLPTDVLSE--ELLSTIANL--SGCLPHMLPPSCPHTCLANKYRLITGACNNRDHPRWGASNTALARWLPPAYEDGVTEPRGWNPHFLYNGLPLPPVREVTRQVIHVSNEAVTEDGQYSDLLMAWGQYIDHDIAFTPQSTSKAAFAGGADCQLTCENRSP-CFPIQLPTNAS--GAAGATCLPFYRSSAACGSGRQGALVGNLSWAAPRQQMNGLTSFLDASTVYGSSPAQEQRLRNWTSAEGLLRVNTRHRDAGRAFLPFAPPPAPPACAPEPGTPAARAPCFLAGDSRASEVPGLTALHTLWLREHNRLAAAFKALNAHWSADTVYQEARKVVGALHQIVTLRDYVPKILGAEAFGQH------VGPYQGYDPAVDPTVSNVFSTAAFRFGHATIHPLVRRLDARFQEHPGSHLPLRAAFFQPWRLLREGGVDPVLRGLLARPAKLQVQDQLMNEELTERLFVLSNSGT-LDLASINLQRGRDHGLPGYNEWREFCGLSRLETWADLSAATANGRVADRILGLYQHPDNIDVWLGGLAESFLPGARTGPLFACIIGKQMRALRDGDRFWWEN---PGVFTEAQRRELSRHSMSRVICDNSGLSHVPLDAFRVGQWPQEFE---PCAS--IQGMDLGAWREA 733          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|408360185|sp|Q8HYB7.2|PERT_CANFA (RecName: Full=Thyroid peroxidase; Short=TPO; Flags: Precursor)

HSP 1 Score: 326.635 bits (836), Expect = 9.195e-98
Identity = 217/644 (33.70%), Postives = 321/644 (49.84%), Query Frame = 0
Query:  131 PLIDTTKTII------EGYCPPFLMTPKC----TVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASK-----TGNPLPSARIVSSNMHR---DEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCR---------LGPRDTFNEVSSLLDAGTVYSNSDETLESLRLY--KDGLLKMLPVFNEFEMKELL----PLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERW-SKTHRYIGSQRLSEMLQQ---PYDLYKAGWADNYLMGLVNQVAQ--ALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHG-YASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDN----SDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            PL DT    +         C P ++ P+C       +YR + G CNN +HP WGA+     R+L P + DGIS PR        +G PLP  R V+  + R   +    D   + LL  WGQ+IDHD+  + ++           C+       P C PI++P   +        C+ F RS A      +           PR   N ++S LDA TVY +S    + LR +   +GLL++     +     L     P  L    E   R +    CFLAGD+  +E   LA +HTL+ REHNR+A  LK +N HW+ +T +QE R ++ AL   I   +++P VLG E  QQH       G    YD   +P+ S VF +AAFR GH+ +   + R  ++   + G   L   LQ    P+ L K G  D  L GL+   A+    +  +++E+T  LF   G    LDLA++N+QR R+HG+PGYN WRE+ GL ++H  ++LR  ++N+++ G    +Y  PD+ID+W  G+ E  LP +  GP  AC+IG+Q   LR GDR+W+E+ G    FT EQ  E+ +   SR++CDN    S   +  QV +    D E     PC++  +P ++   WR+A
Sbjct:  126 PLTDTLPEAVLDTIANASGCRPHMLPPRCPDTCLARKYRLITGACNNRDHPRWGASNTALARWLPPAYEDGISEPRGWNPHVLYSGFPLPPVREVTRQVIRVPNEAVTEDDQYSDLLTVWGQYIDHDVAFTPQSASGAAFGAGADCQLTCENRSP-CFPIQLPPDAS-----GPACLPFSRSSAACGTGIQGAFFGNLSSANPRQQMNGLTSFLDASTVYGSSPALEKQLRNWTSAEGLLRVNTRHWDAGRAHLPFMRPPAPLACVPEPGTRGTAGAPCFLAGDSRASEVPTLAALHTLWLREHNRLASALKALNAHWSADTAYQEARKVVGALHQIITLRDYVPKVLGPEAFQQH------VGPYEGYDPTMDPTVSNVFSTAAFRLGHATVHPLVRRLDARFQEHPGLPPLG--LQDAFFPWRLLKEGGLDPLLRGLLASPAKLPVQEQLMNEELTERLFVL-GSSGSLDLASINLQRGRDHGLPGYNAWREFCGLGRLHTRAELRSAVANATLAGRIMDLYGHPDNIDVWLGGLAEPLLPRARTGPLFACLIGRQMKALRDGDRFWWESSG---VFTDEQRRELARHSLSRVICDNTGLPSVPADAFQV-SRFPQDFE-----PCEN--IPGLNLDVWREA 743          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|81901688|sp|Q8R481.1|PERL_MESAU (RecName: Full=Lactoperoxidase; Short=LPO; AltName: Full=Lacrimal gland peroxidase; Flags: Precursor)

HSP 1 Score: 318.931 bits (816), Expect = 4.570e-97
Identity = 218/658 (33.13%), Postives = 327/658 (49.70%), Query Frame = 0
Query:   76 VNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNG-------------LPL-------IDTTKTIIEGYCPPFLMTPKCTVER-YRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGIS-----APRASKTGNPLPSARIVSSNMH---RDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGP-----RDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFE--MKELLPLKLESPDE-GCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ---RLSEMLQQPYDLYKAGWADNYLMGLVNQVAQAL--DDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSV-HGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNS 690
            VN AF  + +R+            D+ NL   +   S YL +  G ++ AI  G             +PL       +D T    E  C     T  C +   YR++ G CNN ++P  G+A     R+L   + DG+S      P  ++ G PLP  R VS+ +     +E   D   ++L + WGQ +DHD+  + ET+      +   C+E       NC PI  P  D    K + +C+ F R  AG  + C   P     R+  N ++S +DA  VY +       LR     L  ++ V  E     + LLP     P     I  +  V CFLAGD+  +EQ +LA  HTLF REHNR+A EL ++NP W+ E ++QE R I+ ALI  I + ++LP++LG E+ +    I    GY  + D    P  S VF + AFRFGH  +PST+ R  + ++  GS+    L ++    + + K G  D  + GL+ + A+    D  ++ E+ N LFQ      G DLAA+NIQR R+HG PGYN WR + GL +     +L  ++ N  +      +Y +PD+IDIW   I E  +    +GP L C++G+QF  +R GDR+W+EN   P  FT +Q + ++K+ FSR++CDN+
Sbjct:   43 VNKAFLDSRDRL----------KTDMSNLAPTVRHLSGYLKQAKGRTRTAIRVGQVWEQSLKRLRRMVPLTNVTGQGLDLTSLSWEVGCGHPAPTVTCNISNPYRTITGDCNNRKNPELGSANRALARWLPAEYEDGLSLPFGWTPGKTRNGFPLPQPRDVSNQVLDYLNEEEILDQNRSLLFMQWGQIVDHDLDFAPETEMGSDNYSKAQCDE-LCIQGDNCFPIMFPKGDPKL-KTQGKCLPFFR--AG--FVCPTSPYQSLAREQINALTSFMDASMVYGSEPSLANRLRNLSSPL-GLMAVNEEVSDHGRPLLPFVNVKPSPCEVINRTAGVPCFLAGDSRASEQILLATSHTLFLREHNRLARELSRLNPQWDGEKLYQEARRIMGALIQIITFRDYLPILLGDELQK---WIPPYQGYKETVD----PRISNVF-TFAFRFGHLEVPSTVSRLDENYQPWGSEPELPLHKLFFNTWRVVKDGGIDPLVRGLLAKKAKLAHQDKMMTGELRNMLFQPNHTVHGFDLAAINIQRCRDHGQPGYNSWRAFCGLSQPKTLEELSAVLRNEVLAKKLMDLYGTPDNIDIWLGAIAEPLVRRGRVGPLLTCLLGQQFQRIRDGDRFWWEN---PGVFTEKQRDSLQKMSFSRLVCDNT 672          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|1352738|sp|P11678.2|PERE_HUMAN (RecName: Full=Eosinophil peroxidase; Short=EPO; Contains: RecName: Full=Eosinophil peroxidase light chain; Contains: RecName: Full=Eosinophil peroxidase heavy chain; Flags: Precursor)

HSP 1 Score: 318.546 bits (815), Expect = 7.657e-97
Identity = 205/598 (34.28%), Postives = 310/598 (51.84%), Query Frame = 0
Query:  152 KCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGIS-----APRASKTGNPLPSARIVSSNMHR---DEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLY-KDGLLKMLPVFNEFE--MKELLPLKLESPDEGCI--RPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQR---LSEMLQQPYDLYKAGWADNYLMGLVNQVAQ--ALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSV-HGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNS--DTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWR 728
            +C+ ++YR++ G CNN   P  GA+     R+L   + DG+S      P   + G  LP  R VS+ + R   +    D    ++ + WGQFIDHD+  S E+   R   T     E   A  P C PI+IP +D    K+++ C+ F RS      N +   R+  N ++S +DA  VY +  E   SLRL  +   L +L +   F+   + LLP      D+ C+    S  + CFLAGD    E   LA +HTLF REHNR+A EL+++NP WN + ++ E R I+ A++  I Y +FLP+VLGK   ++        G+   Y +  +P  + VF + AFRFGH++L   + R    +R         LS      + +   G  D  L GL+   A+    D  L  E+ + LF++  ++ GLDLAALN+QR+R+HG+PGYN WR + GL +    + L  ++ N  +   + ++Y +PD+IDIW   I E  LPG+ +GP LAC+   QF   R GDR+W++  G    FT  Q + + +I  SRI+CDN+   T+      A + P   +N    C    +PR++ S WR
Sbjct:  140 RCS-DKYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPLVRAVSNQIVRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPESP-ARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRI-KNQRDCIPFFRSAPSCPQN-KNRVRNQINALTSFVDASMVYGS--EVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFD-NLHDDPCLLTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDFLPLVLGKARARR------TLGHYRGYCSNVDPRVANVF-TLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQ-VRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRG---VFTKRQRKALSRISLSRIICDNTGITTVSRDIFRANIYPRGFVN----CSR--IPRLNLSAWR 713          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|172044151|sp|A4IGL7.1|PXDN_XENTR (RecName: Full=Peroxidasin; Flags: Precursor)

HSP 1 Score: 331.257 bits (848), Expect = 9.306e-97
Identity = 216/615 (35.12%), Postives = 313/615 (50.89%), Query Frame = 0
Query:  153 CTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASK----TGNPLPSARIVSSNMHRDEGFH----DHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQ-------AGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLR--LYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSED--VYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYI--GSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDS--LSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSV-HGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYSPF 743
            C  ++YR+ +G CNN++HP WGA++    R L   + +G + PR        G PLP  R+VS+ +    G H    D   T +L+ WGQF+DHD+  +            + C    T   P C PI +P +D    ++  RCM+ VRS          L  N  + PR+  N+++S +DA  VY +SD     +R      GLLK   V  +   K LLP     P E C+R   +  + CFLAGD   NEQ  L  +HTL+ REHNRIA EL ++NPHW+ +TI+ ETR I+ A + HI Y+ +LP + G       D+ +   G   SYD   N      F +AAFRFGH+L+   + R  +    I  G   L      P+ +   G  D  L GL+   A+    S  L+ E+T  LF        LDLAALN+QR R+HG+P Y+ +R +  L  +  + DLR  + N  V      +Y SP +ID++ A + E  +PGS +GPTL C++  QF N+R GDR+WYEN   P  FT  QL +I++   +R+LCDN D I  +Q     + +   +  V CK+  + ++D   W+D          +S F
Sbjct:  726 CFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRGISGRIYNGFPLPLPRLVSTTL---IGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAP-CFPIMVPPNDPRV-RNNARCMSMVRSSPVCGSGMTSLLMN-SVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIV--QRSGKPLLPFATGPPTE-CMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFG-------DVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSM-AHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYEN---PGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFP-HGYVSCKN--IAKMDLRVWQDCCEDCRTRGQFSTF 1317          
BLAST of EMLSAG00000001069 vs. SwissProt
Match: gi|74871953|sp|Q9VZZ4.1|PXDN_DROME (RecName: Full=Peroxidasin; Flags: Precursor)

HSP 1 Score: 331.257 bits (848), Expect = 1.217e-96
Identity = 200/585 (34.19%), Postives = 317/585 (54.19%), Query Frame = 0
Query:  150 TPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASK-----TGNPLPSARIVSSNM-HRDEGFHDHAVTILLVAWGQFIDHDI-----TLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQA-------GLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLR--LYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSED--VYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYI--GSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVA--QALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSV-HGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHE 707
            T  C   RYRS++G CNN++HP WGA++    R   P + +G S P         +G+  PSAR+VS+++    E   D  +T +++ WGQF+DHD+     ++S+E+ D    K  K CE     + P C PIE+P +D       +RC++ VRS A        L ++  +  R+  N+++S +DA  VY  S    + LR    ++GLL++   F     K++LP         C R  ++  + CF++GD  VNEQ  L  +HT++ REHNRIA +LK++N HW+ +T++QE R I+ A + HI + ++LP+++G+  M+         G    Y+   NPS +  F +AA RFGH+++   + R ++T + I  G   L +    P+ L   G  D  + G +   A  +  D +L+ E+T  LFQ       LDLAA+NIQR R+HG+PGYN +R+   L     + DL G +S++ +      +Y  PD++D+W  GI E  + G  +GP   C++ +QF  LR GDR +YEN   P  F+ EQL +I++  F R+LCD  D  + +     +L  H+
Sbjct:  769 TDMCFHSRYRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHAIPSVSSESWDGIDCK--KSCE-----MAPPCYPIEVPPNDPRV--RNRRCIDVVRSSAICGSGMTSLFFD-SVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPR--QKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMM-------GEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQT-AHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYEN---PGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQ 1330          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: EFX81606.1 (hypothetical protein DAPPUDRAFT_224067 [Daphnia pulex])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 374/666 (56.16%), Postives = 493/666 (74.02%), Query Frame = 0
Query:   66 GSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            G + C+TYEAVNAAF+   +R+ LP  +G+  TD DV +L  ++ ETSR L ++Y L  DA+   LPLIDT +T+I+ +CP +L  PKC+V+RYR  NGMCNN++HPHWGA ++   R L P++ADG+S PR S TG  LP+AR VS+  HRD GFHDHAVT+ L AWGQ IDHD+T+ AE+KDP T   PKCC++     HP C P+EIP+ D F+S   +RCM FVRS +GL  NC+LG R T N ++S LDA  VY +S ET + LR ++ GLLK     +   +K+LLP KLESPD GC+RP++DVYCFLAGD   N+Q +L   HT+  REHNRIA E   +NPHW+DE I+QETRHI+AA++ HI YNEFLPMVLGK++M ++ L+L K G  + YD   +P+    F +AA+RFGHSL+PSTIERWS +H+++ ++RLSEML  P D+Y  G  D YL G +NQV+QA+DDS+++E+TNHLFQE   ++GLDLA+LN+QR R++GVP YN +R + GLP    W DL G+ +N ++  Y +IY +PDDID+WSAGI+E+P PGSM+GP   CIIG+ F NLR+GDR+WYENGGWPSSFT  QL+EIRK+K SR++CDN D I++ QVY MVLPD ++NPRVPC+S VLPRI+   WRD+
Sbjct:   86 GDSACVTYEAVNAAFSATKQRMNLPGPKGRSMTDIDVDHLSQILVETSRNLIREYNLHPDAVHEALPLIDTQRTVIDDFCPAYLKRPKCSVKRYREYNGMCNNLDHPHWGATLSTMRRLLPPDYADGVSEPRISVTGKELPTARYVSAINHRDFGFHDHAVTVYLPAWGQLIDHDMTMGAESKDPETDAEPKCCDKTPNQRHPACWPVEIPTEDPFYSNFGRRCMEFVRSGSGLTENCKLGSRTTMNIITSTLDANFVYGSSKETADKLRRFQGGLLKTNSANHHLGLKDLLPPKLESPDAGCVRPNKDVYCFLAGDTRANQQVMLTTHHTIMMREHNRIAVEFGYINPHWDDEKIYQETRHIVAAMVQHITYNEFLPMVLGKDIMSRYGLLLDKKGMGSFYDPTVDPTIPVGFFAAAYRFGHSLIPSTIERWSVSHQFVSARRLSEMLLNPIDMYGPGICDQYLSGFMNQVSQAVDDSVTEELTNHLFQEGQNRWGLDLASLNMQRGRDNGVPSYNAFRRYCGLPPARHWDDLIGVFTNDTLQRYTNIYSTPDDIDLWSAGISERPAPGSMVGPVFGCIIGETFRNLRYGDRFWYENGGWPSSFTQAQLQEIRKVKLSRLVCDNGDHIDSAQVYVMVLPDPKLNPRVPCRSSVLPRINLELWRDS 751          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: EFX83452.1 (hypothetical protein DAPPUDRAFT_301956 [Daphnia pulex])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 389/672 (57.89%), Postives = 500/672 (74.40%), Query Frame = 0
Query:   61 SFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMT--PKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            S  Y    TCITYEAV+AAF+ A  ++ LP  + K  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KCT +RYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  ++  +  C P+EIPS D F++  ++RCM FVRS + L+  C+LGPR   N +SS+LDA  +Y +  ET ++LR  K GLLK  P+F +  +K+LLPLKL++PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++G+ N YD   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL K   W DL    +N ++  + SIY+SPDDID+W+AG++E+PL GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFTLEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D +KW+D
Sbjct:   30 SLKYVADETCITYEAVDAAFSAAKSKLRLPSTKSKTLTERDIDQLGKVIVETTRILANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCTAQRYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISLPRVSAKGKDLPTTRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPESKRNEECYPVEIPSGDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVLDANWIYGSDKETADNLRTLKGGLLKSTPMFRQHGLKDLLPLKLDNPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAEELSAINPHWEDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGHWNGYDDKVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYISGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFRERCGLKKADSWRDLADAFTNDTLKHFTSIYDSPDDIDLWTAGVSERPLTGSMVGPVFGCIIGESFRDLRAGDRFWHENPNQPSSFTLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLTKWKD 701          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: EFX81608.1 (hypothetical protein DAPPUDRAFT_317232 [Daphnia pulex])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 357/666 (53.60%), Postives = 486/666 (72.97%), Query Frame = 0
Query:   67 SNTCITYEAVNAAFTTA--LERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            ++TC++Y+A+N AF  A    R+G P  + K  +D ++  LG  I ETSR LAK++ L+ DAI  GLP+IDT  T I+ YCP     P+C V+RYR ++GMCNN+E+PHWGA M    R LAPNF DG+ APR S +G  LP+AR+VSS  H+D GFHDHAVTI L AWGQ IDHD+ + AE+KDP+T   PKCC       HP C PI+IP+ D F+   ++ C++FVRS  G++ +C+LG R + N VS+ LDA  VY +  E ++ LR++K G +K   +     MK+LLP ++E+PD  C RP++DV+CF+AGDA VN+Q +L  +HT+  REHNRIA EL ++N HW+DE IFQETRHIIAA++  I YNEFLPMVLGKEVM++++L+  + G  N Y+     S  T F +AAFRFGHSL+P+ +ERWS +H++I S+RLS+++ +P+D+Y     D YL G +NQ++QA+DDS+SQE+TNHLF++    FG DLA+LNIQR R+HGVP YN +RE+ GL +   W+DL G  +N ++H Y  +Y +PDDID+WSAG++E+PLPGSM+GP   CI+G+ F NLR GDR+W+EN G PSSF+ +Q+ EIRK+K SR++CDNSD IE +QVY MVLPD EINPRV CKSG+LPRI+ +KW++
Sbjct:    3 TSTCVSYDAINRAFNAAKATTRLGGPQSKSKELSDIEIDVLGRTIVETSRILAKEFNLAPDAIHMGLPMIDTRHTAIDAYCPVRYQRPQCKVQRYRELDGMCNNLENPHWGAVMAPFRRLLAPNFQDGVDAPRVSASGAELPTARLVSSLTHKDMGFHDHAVTIYLPAWGQLIDHDMAMGAESKDPKTNSEPKCCNVPANQRHPACWPIDIPNSDPFYKLFRRTCLDFVRSGNGVKDSCKLGTRISVNTVSAYLDASFVYGSDLEMMKKLRVFKGGQMKSNAMNRHKGMKDLLPPQMENPDANCKRPNKDVHCFMAGDARVNQQMMLVALHTIMMREHNRIALELSQINSHWDDEKIFQETRHIIAAIVQQITYNEFLPMVLGKEVMERYNLLGERQGMLNKYNPKLEASLPTSFFAAAFRFGHSLIPNALERWSTSHKFIQSRRLSDIINKPFDVYTGNTCDEYLTGFMNQISQAVDDSVSQELTNHLFRDETSGFGSDLASLNIQRGRDHGVPSYNAYREFCGLRRARHWNDLAGSFNNETLHKYMQVYSTPDDIDLWSAGVSERPLPGSMVGPVFGCIMGETFKNLRLGDRFWFENAGQPSSFSQDQVNEIRKVKLSRVICDNSDHIETVQVYVMVLPDAEINPRVACKSGILPRINLAKWKE 668          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: EEB19573.1 (Chorion peroxidase precursor, putative [Pediculus humanus corporis])

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 380/731 (51.98%), Postives = 506/731 (69.22%), Query Frame = 0
Query:   12 ILLLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPK-CCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYS 741
            ILL+  L  P+  + P    +    CALI+ GPGRSSAFD+      G+ F Y G +TCITYEAVN A+  A +R+ L   + ++  ++V  +G ++ + S  LAK YGLS + I  GLPLIDT+KT+I   CPP+L   +C   +YR  +G+C N++HP WGA      R + P +ADG++APR S  GN LP ARIVS  +H DEGFHDHA T+++VAWGQF+DHD TL+A   DP     P+ CC       +P CL I IPS D F+      C +FVR    +R  CRLG R  FN ++ +LD  TVY  ++     LR    GLL+M PVF+E+ +K+LLPLKL+ PDEGC RP+  +YCF AG+  VNEQ VL  +HTL AREHNR+A  L ++NPHW+DET++QE R I+ A I HI YNEFLP++LGKEVM++  L+  K GY + YD   NP+    F +AAFRFGHSLLP+ +ERWSK H++I S+RLS ++++PYDLY+AG  D Y MGL+NQVAQA+DDS++QEVTNHLF++ G +FGLDLA+ N+QR RE G+PGY  +R++ GLP    + +L G MSN ++  Y+SIYE P D+D+WS G++E+PLPGSM+GPT  CII  QF   R GDR+WYE G  PSSFT EQL+EIRK+K SR++CDN+D I+ +Q+Y MVLPDHEINPRVPCKSG++P +D +KW D       ++P++
Sbjct:    9 ILLVALLNCPSYQYQPLEIHTDGE-CALILDGPGRSSAFDYQYNALRGT-FGYDGPHTCITYEAVNQAYLQARKRIHLSQPKAEWKPEEVAEVGELLLDISINLAKTYGLSYEEIEKGLPLIDTSKTLIREVCPPYLSNVECRPGKYRRYDGLCTNLQHPTWGAINTPFTRLVGPLYADGMTAPRISVLGNQLPLARIVSRTVHPDEGFHDHAGTVMIVAWGQFMDHDYTLTATPLDPLNRNEPEECCHRPPHLKNPYCLEITIPSDDYFYGHTGMTCQDFVRGFVAVRPGCRLGSRTQFNTLTGVLDGNTVYGVTEHFARKLRAGYGGLLRMNPVFSEYGLKDLLPLKLDIPDEGCTRPNRSMYCFEAGEIRVNEQLVLTCMHTLMAREHNRLAHGLAQINPHWDDETLYQEARRIVIAEIQHITYNEFLPIILGKEVMEKFGLLTQKEGYWDGYDPNVNPNVIDAFAAAAFRFGHSLLPTAVERWSKAHKFIASKRLSNLIRRPYDLYRAGVLDEYFMGLMNQVAQAMDDSVTQEVTNHLFKKAGARFGLDLASFNMQRGREFGLPGYMEFRKFCGLPGADTFDELFGSMSNETIRRYSSIYEHPSDVDLWSGGVSERPLPGSMVGPTFGCIIATQFSYSRRGDRFWYELGDQPSSFTPEQLQEIRKVKLSRVICDNTDLIDTIQLYPMVLPDHEINPRVPCKSGIIPSLDLTKWADFGGAVGAAAPHT 737          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: gb|KYB25155.1| (Chorion peroxidase-like Protein [Tribolium castaneum])

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 374/729 (51.30%), Postives = 504/729 (69.14%), Query Frame = 0
Query:    1 MFHISMRFSSIILLLTTLLSPALSFGPQAPSSSSSG-CALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPK-CCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKW 727
            +F+  +  S  + +L   L   + + P   + +  G CAL++ GP RSS FD+   +  GS  +Y G +TCITY+AVNAA+  A +R+ +    G +  +DV  +G ++ + S  LA+ YGLS + I  GLPLIDT+KT+I   CPP+L   +C   +YR  +G+CNN+EHP WGA      R + P +ADG++APR S TG  LP +R+VS  MH DEGFHDHA T++++AWGQFIDHD TL+A   DP     P+ CC       HP C  I IP  D F+     +C++FVR+    R  CRLG R  +N ++ +LD  TVY  +++    LR    GLL+M P F E+ +K+LLPLKL+ PDEGC RP+  +YCF AG+  VNEQ VL  +HTL AREHNRIA  L +VNPHW+DET+FQE R I  A I HI YNEFLP++LGK+VM +  L+L K+GY + YD   NP+    F +AA+RFGHSLLP+ +ERWSK H++I S+RLS+++++PYDLY+AG  D YLMGL+NQVAQA+DDS++QEVTNHLF++ G +FG+DL +LN+QR RE G+PGY  +R++ GLP    + +L G M N +V  Y++I+E P D+D+WS G++E+PLPGSM+GPT ACII  QF   R GDR+WYE    PSSFT EQL E+RK + +RI+CDN+D I+ +Q+Y MVLPDHEINPRVPC+SGV+P IDFSKW
Sbjct:    2 IFNRGIPLSWWLTILQINLGLTIQYTPVDLTGNGDGECALLLSGPPRSSHFDYSLNLLRGSPLEYNGPHTCITYDAVNAAYLDARKRIHIAQPHGDWKPEDVATVGELLLDISINLARTYGLSYEDIEKGLPLIDTSKTLIREVCPPYLSNVECRAGKYRRFDGLCNNLEHPTWGATNTPFTRLIGPLYADGMTAPRISVTGRNLPLSRVVSRTMHPDEGFHDHAGTVMVIAWGQFIDHDYTLTATPLDPLNRNDPEECCHRPPHLKHPYCNEIIIPEDDYFYRLFNVKCLDFVRAFPAARPGCRLGSRVPYNTLTGVLDGNTVYGVTEKFARKLRTGYGGLLRMNPAFEEYGLKDLLPLKLDIPDEGCTRPNSTMYCFEAGEIRVNEQLVLTCMHTLMAREHNRIAKGLAQVNPHWDDETLFQEARRINIAEIQHITYNEFLPILLGKDVMAKFGLLLQKDGYWDGYDHNVNPNVIDAFAAAAYRFGHSLLPTAVERWSKAHKFIASKRLSDLIRRPYDLYRAGVFDEYLMGLMNQVAQAMDDSITQEVTNHLFKKVGARFGMDLVSLNMQRGREFGIPGYMEFRKFCGLPGASNFDELFGSMPNETVRKYSTIFEHPSDVDLWSGGVSERPLPGSMLGPTFACIIATQFSYSRRGDRFWYELPNQPSSFTPEQLHEVRKARLARIICDNTDLIDTIQLYPMVLPDHEINPRVPCRSGVIPSIDFSKW 730          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: EAA45172.5 (AGAP000051-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 367/698 (52.58%), Postives = 497/698 (71.20%), Query Frame = 0
Query:   34 SSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQG-SNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPK-CCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            ++ CAL + GPG+SSAFD+   +F G+       + TCITY+A+N A+  A +R+ +   +G + T+D+  +G ++ + S  LA+ YGLS + I  GLP IDT+KT+I   CP FL   +C   +YR V+G+CNN++HP WGAAM    R + P +ADGI+APR S TG+ LP +R+VS  +H DEG+HDHA T+ ++AWGQF+DHD TL+A   DP     P+ CC+      HP C  I +P  D F+     +C++FVR     R  CRLG R  FN ++S++D  T+Y  +++    LR   +GLL+M PVF E+ +K+LLPLKL+ PDEGC RP++ ++CF AG+  VNEQ VL  +HTL AREHNRIA EL K+NPHW+DET+FQE+R I  A+I HI YNEFLP++LGKEVM++  L+  K GY + YD   NP+    F SAAFRFGHSLLP+ +ERWSK H++I S+RLS+++++PYDLY+AG  D YLMGL+NQVAQA+DDS++QEVTNHLF++ G +FG+DL + N+QR RE GVPGY  +R++ GLP    + +L G M N +V  Y SI+E P D+D+WS G++E+ LPGSM+GPT ACII  QF  +R GDR+WYE    PSSFT EQL+EIRK K +R++CDN+D I+ +Q+Y MVLPDHEINPRVPCKSG+LP ID +KW D
Sbjct:   28 ATECALYVNGPGKSSAFDYNLNLFRGTIAPLHAEATTCITYDAINQAYLDARKRIRVSQPKGDWKTEDIATVGELLLDISIQLARTYGLSYEEIEKGLPSIDTSKTLIREVCPAFLSGVECRPGKYRRVDGLCNNLKHPTWGAAMTPFQRLIGPLYADGINAPRISITGHDLPLSRVVSRTIHPDEGYHDHAGTVFVIAWGQFMDHDFTLTATPLDPINRNDPEECCKRPPHLKHPYCNEIRVPDDDYFYRLFNVKCIDFVRGFPSPRAGCRLGSRQQFNTLTSVIDGNTIYGVNEKFTRKLRTGYNGLLRMNPVFAEYGLKDLLPLKLDIPDEGCTRPNKSMFCFEAGEIRVNEQLVLTCMHTLLAREHNRIATELGKINPHWDDETLFQESRRINIAIIQHITYNEFLPILLGKEVMEKFGLLTPKEGYWDGYDENINPAIIDSFASAAFRFGHSLLPTAVERWSKAHKFIASKRLSDLIRRPYDLYRAGVYDEYLMGLMNQVAQAMDDSITQEVTNHLFKKEGARFGMDLVSFNMQRGREFGVPGYMEFRKFCGLPTSDSFEELFGSMPNETVRRYESIFEHPADVDLWSGGVSERSLPGSMLGPTFACIIATQFSYVRRGDRFWYELPNQPSSFTPEQLQEIRKAKLARLICDNTDLIDTVQIYPMVLPDHEINPRVPCKSGILPSIDLTKWAD 725          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: AAF55422.2 (curly Su [Drosophila melanogaster])

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 363/720 (50.42%), Postives = 495/720 (68.75%), Query Frame = 0
Query:   24 SFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQ-GSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPK-CCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYS 741
             FG Q  ++  S CAL++ GPGRSS +D+   +F G+   Y  G  TCITY+A+NAA+  A +R+ +   +  +  +++  +G ++ + S  LA+ YGLS + I  GLP IDT+KT+I   CPPF    +C   +YR  +G+CNN+EHP WGAA     R + P ++DGI+APR S TG  LP +R+VS  MH D+GFHDHA T++++AWGQF+DHD TL+    DP     P+ CC+      HP C  I IP  D F+     +C++FVR     R  C+LG R  FN ++ ++DA TVY   +     LR    GL++M PVF E+ +K+LLPLKL+ PDEGC RP++ +YCF  G+  VNEQ VL  +HTL AREHNR+A  L ++N HW+DET+FQE R I  A++ H+ +NEFLP++LGKEVM++  L+L K+GY + YD+  NP     F  AAFRFGHSLLP+ +ERWSK H++I S+RLS+++++PYDLY+AG  D Y MGL+NQVAQA+DDS++QEVTNHLF++ G +FG+DL + N+QR RE G+PGY  +R++ GLP  + W ++ G M N +V  Y SI+E P DID+WS G++EK LPGSM+GPT AC+I  Q   LR GDR+WYE    PSSFT EQL+EIRK K SR++CDN+D I+ +Q+Y MVLPDHEINPRVPCKSG++P ID +KW D   H    S Y+
Sbjct:   20 QFGEQLQTAHGSDCALLLAGPGRSSVYDYNVNLFRGTLNPYNNGPGTCITYDAINAAYLDARKRIHVAQPKSDWKPEELATVGELLLDISIQLARTYGLSYEEIEKGLPTIDTSKTLIREVCPPFFAGVECRPGKYRRFDGLCNNIEHPTWGAANAPFQRLIGPLYSDGINAPRISVTGRDLPFSRVVSRTMHPDDGFHDHAGTVMVIAWGQFMDHDFTLTGTPLDPINRNDPEECCKRPLHLKHPYCNEIRIPDDDYFYRLFNVKCIDFVRGFPSPRPGCKLGSRQQFNTLTGVIDANTVYGVKESFARKLRTGYGGLMRMNPVFQEYGLKDLLPLKLDIPDEGCTRPNKSMYCFEGGEIRVNEQLVLTCMHTLMAREHNRLATALAQINKHWDDETLFQEARRINIAIVQHVTFNEFLPILLGKEVMEKFGLVLQKDGYWDGYDSTVNPGIIDSFAGAAFRFGHSLLPTAVERWSKAHKFIASKRLSDLIRRPYDLYRAGVLDEYFMGLMNQVAQAMDDSITQEVTNHLFKKEGARFGMDLVSFNMQRGREFGIPGYMEFRKFCGLPTSNTWDEMYGSMPNETVLRYGSIFEHPADIDLWSGGVSEKSLPGSMLGPTFACVIATQMSYLRRGDRFWYELPNQPSSFTPEQLQEIRKAKLSRLICDNTDLIDTVQIYPMVLPDHEINPRVPCKSGIIPSIDLTKWADFGGHGVDPSLYN 739          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: EFX81607.1 (hypothetical protein DAPPUDRAFT_317231 [Daphnia pulex])

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 338/619 (54.60%), Postives = 444/619 (71.73%), Query Frame = 0
Query:  121 LSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSP 739
            +  + I   LPLID  KT I  +C       KC V+R+RS +G CNN+++P+WGA      R + P++AD IS PR S TG  LP+AR +SS +HRD GFHDHAVT+ L A+GQ IDHD+   AETKDPRT   PKCC+      HP C PI+IP++D F+S   +RC+ FVRS  GL+  C+LG R TFN V+S LDA  VY  + ET   LR ++ G L          +KELLP + E+PD+ C RPS D++CF AGD  VN+Q +L  +HT+F REHNRIA +L K+NPHW+DE +FQETRHIIAA +  I YNEFLPMVLGK++M+ + L+L ++G S+ Y+  TNP+    F +AAFRFGHS++PS IE+WS TH++IGS+RLSE+  +P+D Y+ G  D Y+ G +NQVAQA+DD++++E+TNHLF EP K FG DLAALN+QR R+HGVP YN +R + GL +   W+DL G  +N ++  Y+  Y +PDDID+WSAGI+E+PLPGSM+GP   CI+G+ F NLR+GDR+WYENGG P+SFTL+Q+ EIRKIK SR+LCDN D IE  QVYAMVLPD +INPRVPCKS VLPR++   WR++   P+  +P
Sbjct:    1 MESNEIHEALPLIDVFKTSIGRFCS---KPQKCEVKRFRSYDGTCNNLDNPNWGAISAPFRRLIPPDYADDISLPRISVTGEQLPTARYISSTIHRDLGFHDHAVTVFLPAFGQLIDHDMASGAETKDPRTNAEPKCCDVSPDRRHPACWPIDIPANDPFYSLFGRRCLEFVRSATGLKDKCKLGSRSTFNTVTSFLDASFVYGTAKETSHKLRTFRGGWLNSNTALRNLGLKELLPSRTENPDDNCKRPSRDLFCFEAGDGRVNQQVMLVTLHTIFLREHNRIAAQLGKINPHWDDERLFQETRHIIAAYVQQITYNEFLPMVLGKDIMEDYGLLLDRDGLSSDYNPKTNPNLPVSFFAAAFRFGHSVIPSQIEQWSVTHKHIGSRRLSELFNRPFDTYQGGVIDRYIAGFMNQVAQAVDDAVTEELTNHLFAEPLKSFGTDLAALNMQRGRDHGVPSYNAYRGFCGLRRARHWNDLAGSFTNETLQKYSKTYATPDDIDLWSAGISERPLPGSMVGPIFGCIMGETFKNLRYGDRFWYENGGLPNSFTLDQVNEIRKIKLSRLLCDNGDRIETAQVYAMVLPDPQINPRVPCKSSVLPRLNLELWRESKGKPNVKNP 616          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: XP_016767454.1 (PREDICTED: chorion peroxidase isoform X1 [Apis mellifera])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 334/630 (53.02%), Postives = 450/630 (71.43%), Query Frame = 0
Query:   99 DDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPK-CCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKW 727
            +D+  +G ++ + S  L + YGL+ + I   LPLIDT+KT+I   CP FL   +C   +YR  +G+C N+++P WGA +    R L+P FADG++APR S T + LP +RIVS  MH DEG+HDHA T++++AWGQF+DHD TL+    DP     P+ CC       +P C  I IP  D F+     +CM+FVR+   +R  CRLG R  FN ++ +LD  TVY  ++     LR    GLL+M PVF+E+ +K+LLPLKL+ PDEGC RP+  +YCF AG+  VNEQ VL  +HTL AREHNRIA  L ++NPHW+DET++QE R I+ A I HI YNEFLP++LGK+VM++  L+L KN Y + YD   NPS    F SAAFRFGHSLLP+ +ERWSK H++I S+RLS+++++P+DLY+AG  D Y+MGL+NQVAQA+DDS++QEVTNHLF++ G KFGLDL + N+QR RE G+P Y  +R++ GLP +  + +L G M N ++  Y+SI+E P D+D+WS G++E+PLPGSM+GPT ACII  QF   R GDR+WYE    PSSFTL+QL EIRKIK +R++CDN+D I+ +Q+Y MVLPDHEINPRVPC+SGVLP +D +KW
Sbjct:    5 EDLATVGELLLDISANLVQTYGLTFEEIEKSLPLIDTSKTLIREVCPAFLSNVECRAGKYRRNDGLCTNLQNPTWGATLAPFQRVLSPRFADGLTAPRISVTSHDLPLSRIVSRTMHPDEGYHDHAGTVMVIAWGQFMDHDYTLTGTPLDPLNRNDPEECCHRPPHLKNPYCNEILIPEDDYFYRLFNVKCMDFVRAFPAVRPGCRLGSRVPFNLLTGVLDGNTVYGITESFARKLRAGYGGLLRMNPVFSEYGLKDLLPLKLDIPDEGCTRPNRSMYCFEAGEIRVNEQLVLTCMHTLMAREHNRIAKTLIQINPHWDDETLYQEARRIVIAEIQHITYNEFLPILLGKDVMEKFGLLLEKNSYWDGYDESVNPSVIDAFASAAFRFGHSLLPTAVERWSKAHKFIASKRLSDLIRRPFDLYRAGVFDEYIMGLMNQVAQAMDDSITQEVTNHLFKKVGAKFGLDLVSFNMQRGREFGIPSYMEFRKFCGLPWVDTFDELHGSMPNETIRRYSSIFEHPADVDLWSGGVSERPLPGSMLGPTFACIIATQFSYSRRGDRFWYELPNQPSSFTLDQLNEIRKIKLARVICDNTDLIDTIQIYPMVLPDHEINPRVPCRSGVLPSMDLTKW 634          
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Match: XP_006557393.1 (PREDICTED: chorion peroxidase isoform X2 [Apis mellifera])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 334/630 (53.02%), Postives = 450/630 (71.43%), Query Frame = 0
Query:   99 DDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPK-CCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKW 727
            +D+  +G ++ + S  L + YGL+ + I   LPLIDT+KT+I   CP FL   +C   +YR  +G+C N+++P WGA +    R L+P FADG++APR S T + LP +RIVS  MH DEG+HDHA T++++AWGQF+DHD TL+    DP     P+ CC       +P C  I IP  D F+     +CM+FVR+   +R  CRLG R  FN ++ +LD  TVY  ++     LR    GLL+M PVF+E+ +K+LLPLKL+ PDEGC RP+  +YCF AG+  VNEQ VL  +HTL AREHNRIA  L ++NPHW+DET++QE R I+ A I HI YNEFLP++LGK+VM++  L+L KN Y + YD   NPS    F SAAFRFGHSLLP+ +ERWSK H++I S+RLS+++++P+DLY+AG  D Y+MGL+NQVAQA+DDS++QEVTNHLF++ G KFGLDL + N+QR RE G+P Y  +R++ GLP +  + +L G M N ++  Y+SI+E P D+D+WS G++E+PLPGSM+GPT ACII  QF   R GDR+WYE    PSSFTL+QL EIRKIK +R++CDN+D I+ +Q+Y MVLPDHEINPRVPC+SGVLP +D +KW
Sbjct:    5 EDLATVGELLLDISANLVQTYGLTFEEIEKSLPLIDTSKTLIREVCPAFLSNVECRAGKYRRNDGLCTNLQNPTWGATLAPFQRVLSPRFADGLTAPRISVTSHDLPLSRIVSRTMHPDEGYHDHAGTVMVIAWGQFMDHDYTLTGTPLDPLNRNDPEECCHRPPHLKNPYCNEILIPEDDYFYRLFNVKCMDFVRAFPAVRPGCRLGSRVPFNLLTGVLDGNTVYGITESFARKLRAGYGGLLRMNPVFSEYGLKDLLPLKLDIPDEGCTRPNRSMYCFEAGEIRVNEQLVLTCMHTLMAREHNRIAKTLIQINPHWDDETLYQEARRIVIAEIQHITYNEFLPILLGKDVMEKFGLLLEKNSYWDGYDESVNPSVIDAFASAAFRFGHSLLPTAVERWSKAHKFIASKRLSDLIRRPFDLYRAGVFDEYIMGLMNQVAQAMDDSITQEVTNHLFKKVGAKFGLDLVSFNMQRGREFGIPSYMEFRKFCGLPWVDTFDELHGSMPNETIRRYSSIFEHPADVDLWSGGVSERPLPGSMLGPTFACIIATQFSYSRRGDRFWYELPNQPSSFTLDQLNEIRKIKLARVICDNTDLIDTIQIYPMVLPDHEINPRVPCRSGVLPSMDLTKW 634          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942407783|gb|JAN85821.1| (Chorion peroxidase precursor, partial [Daphnia magna])

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 399/717 (55.65%), Postives = 521/717 (72.66%), Query Frame = 0
Query:   28 QAPSSSSSGCALIIPG-PGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMT--PKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA-SYHPSPSSP 739
            Q      + CAL++PG PG+S+A D  +      +  Y    TCITYEAV+AAF+ A  ++ LP  + +  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KC  ERYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  +   +  C P+EIP+ D F++  ++RCM FVRS + L+  C+LGPR   N +SS++DA  +Y +  ET + LR  K GLLK  P+F E  +K+LLPLKLE+PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW+DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++GY N Y+   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL + + W DL    +N ++  + SIY+SPDDID+W+AG++E+ L GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFTLEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D SKW+D  + +P+ + P
Sbjct:   53 QEEEHHEAQCALVVPGLPGKSAAGDRYA------NLKYVPDETCITYEAVDAAFSAAKSKLRLPSTKSRTLTERDIDLLGKVIVETTRNLANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCMAERYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISKPRISANGKDLPTTRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPENKRNEECYPVEIPAKDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVIDANFIYGSDKETADGLRTLKGGLLKSTPMFREHGLKDLLPLKLENPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAQELSVINPHWDDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGYWNGYNDQVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYVSGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFREHCGLKRANSWRDLSDAFTNDTLKHFTSIYDSPDDIDLWTAGVSERALTGSMVGPVFGCIIGQSFRDLRAGDRFWHENPKQPSSFTLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLSKWKDKETKYPAAAQP 763          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|1022763824|gb|KZS09370.1| (Chorion peroxidase [Daphnia magna])

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 400/717 (55.79%), Postives = 522/717 (72.80%), Query Frame = 0
Query:   28 QAPSSSSSGCALIIPG-PGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTP--KCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA-SYHPSPSSP 739
            Q      + CAL++PG PG+S+A D  +      +  Y    TCITYEAV+AAF+ A  ++ LP  + +  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KCT ERYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  +   +  C P+EIP+ D F++  ++RCM FVRS + L+  C+LGPR   N +SS++DA  +Y +  ET + LR  K GLLK  P+F E  +K+LLPLKLE+PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW+DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++GY N Y+   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL + + W DL    +N ++  + SIY+SPDDID+W+AG++E+ L GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFTLEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D SKW+D  + +P+ + P
Sbjct:   55 QEEEHHEAQCALVVPGLPGKSAAGDRYA------NLKYVPDETCITYEAVDAAFSAAKSKLRLPSTKSRTLTERDIDLLGKVIVETTRNLANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCTAERYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISKPRISANGKDLPTTRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPENKRNEECYPVEIPAKDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVIDANFIYGSDKETADGLRTLKGGLLKSTPMFREHGLKDLLPLKLENPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAQELSVINPHWDDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGYWNGYNDQVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYVSGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFREHCGLKRANSWRDLSDAFTNDTLKHFTSIYDSPDDIDLWTAGVSERALTGSMVGPVFGCIIGQSFRDLRAGDRFWHENPKQPSSFTLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLSKWKDKETKYPAAAQP 765          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942326575|gb|JAN45220.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 399/717 (55.65%), Postives = 521/717 (72.66%), Query Frame = 0
Query:   28 QAPSSSSSGCALIIPG-PGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTP--KCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA-SYHPSPSSP 739
            Q      + CAL++PG PG+S+A D  +      +  Y    TCITYEAV+AAF+ A  ++ LP  + +  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KC  ERYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  +   +  C P+EIP+ D F++  ++RCM FVRS + L+  C+LGPR   N +SS++DA  +Y +  ET + LR  K GLLK  P+F E  +K+LLPLKLE+PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW+DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++GY N Y+   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL + + W DL    +N ++  + SIY+SPDDID+W+AG++E+ L GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFTLEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D SKW+D  + +P+ + P
Sbjct:   53 QEEEHHEAQCALVVPGLPGKSAAGDRYA------NLKYVPDETCITYEAVDAAFSAAKSKLRLPSTKSRTLTERDIDLLGKVIVETTRNLANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCMAERYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISKPRISANGKDLPTTRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPENKRNEECYPVEIPAKDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVIDANFIYGSDKETADGLRTLKGGLLKSTPMFREHGLKDLLPLKLENPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAQELSVINPHWDDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGYWNGYNDQVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYVSGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFREHCGLKRANSWRDLSDAFTNDTLKHFTSIYDSPDDIDLWTAGVSERALTGSMVGPVFGCIIGQSFRDLRAGDRFWHENPKQPSSFTLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLSKWKDKETKYPAAAQP 763          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942313225|gb|JAN38545.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 399/717 (55.65%), Postives = 521/717 (72.66%), Query Frame = 0
Query:   28 QAPSSSSSGCALIIPG-PGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTP--KCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA-SYHPSPSSP 739
            Q      + CAL++PG PG+S+A D  +      +  Y    TCITYEAV+AAF+ A  ++ LP  + +  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KC  ERYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  +   +  C P+EIP+ D F++  ++RCM FVRS + L+  C+LGPR   N +SS++DA  +Y +  ET + LR  K GLLK  P+F E  +K+LLPLKLE+PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW+DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++GY N Y+   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL + + W DL    +N ++  + SIY+SPDDID+W+AG++E+ L GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFTLEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D SKW+D  + +P+ + P
Sbjct:   53 QEEEHHEAQCALVVPGLPGKSAAGDRYA------NLKYVPDETCITYEAVDAAFSAAKSKLRLPSTKSRTLTERDIDLLGKVIVETTRNLANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCMAERYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISKPRISANGKDLPTTRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPENKRNEECYPVEIPAKDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVIDANFIYGSDKETADGLRTLKGGLLKSTPMFREHGLKDLLPLKLENPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAQELSVINPHWDDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGYWNGYNDQVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYVSGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFREHCGLKRANSWRDLSDAFTNDTLKHFTSIYDSPDDIDLWTAGVSERALTGSMVGPVFGCIIGQSFRDLRAGDRFWHENPKQPSSFTLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLSKWKDKETKYPAAAQP 763          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942332705|gb|JAN48285.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 399/717 (55.65%), Postives = 521/717 (72.66%), Query Frame = 0
Query:   28 QAPSSSSSGCALIIPG-PGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTP--KCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA-SYHPSPSSP 739
            Q      + CAL++PG PG+S+A D  +      +  Y    TCITYEAV+AAF+ A  ++ LP  + +  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KC  ERYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  +   +  C P+EIP+ D F++  ++RCM FVRS + L+  C+LGPR   N +SS++DA  +Y +  ET + LR  K GLLK  P+F E  +K+LLPLKLE+PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW+DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++GY N Y+   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL + + W DL    +N ++  + SIY+SPDDID+W+AG++E+ L GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFTLEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D SKW+D  + +P+ + P
Sbjct:   53 QEEEHHEAQCALVVPGLPGKSAAGDRYA------NLKYVPDETCITYEAVDAAFSAAKSKLRLPSTKSRTLTERDIDLLGKVIVETTRNLANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCMAERYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISKPRISANGKDLPTPRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPENKRNEECYPVEIPAKDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVIDANFIYGSDKETADGLRTLKGGLLKSTPMFREHGLKDLLPLKLENPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAQELSVINPHWDDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGYWNGYNDQVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYVSGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFREHCGLKRANSWRDLSDAFTNDTLKHFTSIYDSPDDIDLWTAGVSERALTGSMVGPVFGCIIGQSFRDLRAGDRFWHENPKQPSSFTLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLSKWKDKETKYPAAAQP 763          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942299817|gb|JAN31841.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 399/717 (55.65%), Postives = 521/717 (72.66%), Query Frame = 0
Query:   28 QAPSSSSSGCALIIPG-PGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTP--KCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA-SYHPSPSSP 739
            Q      + CAL++PG PG+S+A D  +      +  Y    TCITYEAV+AAF+ A  ++ LP  + +  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KC  ERYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  +   +  C P+EIP+ D F++  ++RCM FVRS + L+  C+LGPR   N +SS++DA  +Y +  ET + LR  K GLLK  P+F E  +K+LLPLKLE+PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW+DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++GY N Y+   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL + + W DL    +N ++  + SIY+SPDDID+W+AG++E+ L GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFTLEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D SKW+D  + +P+ + P
Sbjct:  100 QEEEHHEAQCALVVPGLPGKSAAGDRYA------NLKYVPDETCITYEAVDAAFSAAKSKLRLPSTKSRTLTERDIDLLGKVIVETTRNLANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCMAERYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISKPRISANGKDLPTTRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPENKRNEECYPVEIPAKDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVIDANFIYGSDKETADGLRTLKGGLLKSTPMFREHGLKDLLPLKLENPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAQELSVINPHWDDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGYWNGYNDQVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYVSGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFREHCGLKRANSWRDLSDAFTNDTLKHFTSIYDSPDDIDLWTAGVSERALTGSMVGPVFGCIIGQSFRDLRAGDRFWHENPKQPSSFTLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLSKWKDKETKYPAAAQP 810          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942356709|gb|JAN60284.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 380/666 (57.06%), Postives = 497/666 (74.62%), Query Frame = 0
Query:   66 GSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            G  +C+TYE+VN AF +A +R+ L   +G+  TD DV +LG ++ ETSR LA +Y L+ DAI N LPLIDT +T+I+G+CP +L  PKCT++RYR  NGMCNN++HPHWGA ++ + R L  ++ADGIS PR S TG  LP+AR VS+  HRD GFHDHAVT+ L AWGQ +DHD+TL AE+K+P T   PKCC++     HP C PIEIP+ D F+S   +RCM FVRS  GL  NC+LGPR+T N ++S LDA  +Y +S ET + LR ++ GLLK     +   +K+LLP KLESPD GC+RP+ D YCFLAGD+  N+Q +L  +HT+  REHNRIA EL  +NPHWNDE I+QETRHI+AA++ HI YNEFLPMVLGK++M ++ L+L K G  + YD   +P+    F +AA+RFGHSL+PSTIERWS TH+Y+G++RLSEML  P+D+Y  G  D YL G +NQV+QA+DDS+++E+TNHLFQE   ++G DLA+LN+QR R+HGVP YN +R + GL     W DL  + +N ++  Y + Y++PDDID+W+AGI+E+P PGSM+GP   CIIG+ F NLR+GDR+WYENGGWPSSF   QL+EIRK+K SRI+CDNSD IE+ QVY MVLPD ++NPRVPC+S VLPRI+   WRDA
Sbjct:   86 GRTSCVTYESVNVAFNSAKQRMNLAGPKGRSMTDIDVDHLGQLLVETSRSLATEYNLNADAIHNALPLIDTQRTVIDGFCPAYLKRPKCTIKRYREYNGMCNNLDHPHWGATLSSYRRLLPADYADGISEPRISATGKELPTARYVSALNHRDYGFHDHAVTVYLPAWGQLMDHDMTLGAESKEPETDAEPKCCDKAPGQRHPACWPIEIPNDDPFYSNFGRRCMEFVRSATGLSENCKLGPRNTMNIITSTLDANFIYGSSKETADKLRRFQGGLLKSNSANHHLGLKDLLPPKLESPDAGCVRPNRDSYCFLAGDSRANQQVMLIALHTIMMREHNRIAVELGYINPHWNDERIYQETRHIMAAIVQHITYNEFLPMVLGKDIMNRYGLLLSKQGMGSFYDPAVDPTIPVSFFAAAYRFGHSLIPSTIERWSVTHQYVGARRLSEMLLNPFDMYGPGTCDQYLAGFMNQVSQAVDDSVTEELTNHLFQEGQNRWGADLASLNMQRGRDHGVPSYNAYRRYCGLSPARHWHDLADVFTNDTLRRYITTYDTPDDIDLWTAGISERPSPGSMVGPVFGCIIGESFRNLRYGDRFWYENGGWPSSFKQAQLQEIRKVKLSRIVCDNSDNIESAQVYVMVLPDPKVNPRVPCRSSVLPRINLEHWRDA 751          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942377301|gb|JAN70580.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 380/666 (57.06%), Postives = 497/666 (74.62%), Query Frame = 0
Query:   66 GSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            G  +C+TYE+VN AF +A +R+ L   +G+  TD DV +LG ++ ETSR LA +Y L+ DAI N LPLIDT +T+I+G+CP +L  PKCT++RYR  NGMCNN++HPHWGA ++ + R L  ++ADGIS PR S TG  LP+AR VS+  HRD GFHDHAVT+ L AWGQ +DHD+TL AE+K+P T   PKCC++     HP C PIEIP+ D F+S   +RCM FVRS  GL  NC+LGPR+T N ++S LDA  +Y +S ET + LR ++ GLLK     +   +K+LLP KLESPD GC+RP+ D YCFLAGD+  N+Q +L  +HT+  REHNRIA EL  +NPHWNDE I+QETRHI+AA++ HI YNEFLPMVLGK++M ++ L+L K G  + YD   +P+    F +AA+RFGHSL+PSTIERWS TH+Y+G++RLSEML  P+D+Y  G  D YL G +NQV+QA+DDS+++E+TNHLFQE   ++G DLA+LN+QR R+HGVP YN +R + GL     W DL  + +N ++  Y + Y++PDDID+W+AGI+E+P PGSM+GP   CIIG+ F NLR+GDR+WYENGGWPSSF   QL+EIRK+K SRI+CDNSD IE+ QVY MVLPD ++NPRVPC+S VLPRI+   WRDA
Sbjct:   86 GRTSCVTYESVNVAFNSAKQRMNLAGPKGRSMTDIDVDHLGQLLVETSRSLATEYNLNADAIHNALPLIDTQRTVIDGFCPAYLKRPKCTIKRYREYNGMCNNLDHPHWGATLSSYRRLLPADYADGISEPRISATGKELPTARYVSALNHRDYGFHDHAVTVYLPAWGQLMDHDMTLGAESKEPETDAEPKCCDKAPGQRHPACWPIEIPNDDPFYSNFGRRCMEFVRSATGLSENCKLGPRNTMNIITSTLDANFIYGSSKETADKLRRFQGGLLKSNSANHHLGLKDLLPPKLESPDAGCVRPNRDSYCFLAGDSRANQQVMLIALHTIMMREHNRIAVELGYINPHWNDERIYQETRHIMAAIVQHITYNEFLPMVLGKDIMNRYGLLLSKQGMGSFYDPAVDPTIPVSFFAAAYRFGHSLIPSTIERWSVTHQYVGARRLSEMLLNPFDMYGPGTCDQYLAGFMNQVSQAVDDSVTEELTNHLFQEGQNRWGADLASLNMQRGRDHGVPSYNAYRRYCGLSPARHWHDLADVFTNDTLRRYITTYDTPDDIDLWTAGISERPSPGSMVGPVFGCIIGESFRNLRYGDRFWYENGGWPSSFKQAQLQEIRKVKLSRIVCDNSDNIESAQVYVMVLPDPKVNPRVPCRSSVLPRINLEHWRDA 751          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942367297|gb|JAN65578.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 380/666 (57.06%), Postives = 497/666 (74.62%), Query Frame = 0
Query:   66 GSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA 730
            G  +C+TYE+VN AF +A +R+ L   +G+  TD DV +LG ++ ETSR LA +Y L+ DAI N LPLIDT +T+I+G+CP +L  PKCT++RYR  NGMCNN++HPHWGA ++ + R L  ++ADGIS PR S TG  LP+AR VS+  HRD GFHDHAVT+ L AWGQ +DHD+TL AE+K+P T   PKCC++     HP C PIEIP+ D F+S   +RCM FVRS  GL  NC+LGPR+T N ++S LDA  +Y +S ET + LR ++ GLLK     +   +K+LLP KLESPD GC+RP+ D YCFLAGD+  N+Q +L  +HT+  REHNRIA EL  +NPHWNDE I+QETRHI+AA++ HI YNEFLPMVLGK++M ++ L+L K G  + YD   +P+    F +AA+RFGHSL+PSTIERWS TH+Y+G++RLSEML  P+D+Y  G  D YL G +NQV+QA+DDS+++E+TNHLFQE   ++G DLA+LN+QR R+HGVP YN +R + GL     W DL  + +N ++  Y + Y++PDDID+W+AGI+E+P PGSM+GP   CIIG+ F NLR+GDR+WYENGGWPSSF   QL+EIRK+K SRI+CDNSD IE+ QVY MVLPD ++NPRVPC+S VLPRI+   WRDA
Sbjct:   86 GRTSCVTYESVNVAFNSAKQRMNLAGPKGRSMTDIDVDHLGQLLVETSRSLATEYNLNADAIHNALPLIDTQRTVIDGFCPAYLKRPKCTIKRYREYNGMCNNLDHPHWGATLSSYRRLLPADYADGISEPRISATGKELPTARYVSALNHRDYGFHDHAVTVYLPAWGQLMDHDMTLGAESKEPETDAEPKCCDKAPGQRHPACWPIEIPNDDPFYSNFGRRCMEFVRSATGLSENCKLGPRNTMNIITSTLDANFIYGSSKETADKLRRFQGGLLKSNSANHHLGLKDLLPPKLESPDAGCVRPNRDSYCFLAGDSRANQQVMLIALHTIMMREHNRIAVELGYINPHWNDERIYQETRHIMAAIVQHITYNEFLPMVLGKDIMNRYGLLLSKQGMGSFYDPAVDPTIPVSFFAAAYRFGHSLIPSTIERWSVTHQYVGARRLSEMLLNPFDMYGPGTCDQYLAGFMNQVSQAVDDSVTEELTNHLFQEGQNRWGADLASLNMQRGRDHGVPSYNAYRRYCGLSPARHWHDLADVFTNDTLRRYITTYDTPDDIDLWTAGISERPSPGSMVGPVFGCIIGESFRNLRYGDRFWYENGGWPSSFKQAQLQEIRKVKLSRIVCDNSDNIESAQVYVMVLPDPKVNPRVPCRSSVLPRINLEHWRDA 751          
BLAST of EMLSAG00000001069 vs. nr
Match: gi|942346896|gb|JAN55379.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 399/745 (53.56%), Postives = 521/745 (69.93%), Query Frame = 0
Query:   28 QAPSSSSSGCALIIPG-PGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTD-DVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTP--KCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFT----------------------------LEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDA-SYHPSPSSP 739
            Q      + CAL++PG PG+S+A D  +      +  Y    TCITYEAV+AAF+ A  ++ LP  + +  T+ D+  LG VI ET+R LA QYGL  D ISNGLPLIDT+KT I+ +CP FL     KC  ERYR  NG+CNN+EHP+WGAA+    R +  ++ADGIS PR S  G  LP+ R +S+  H D G+HDHAVT+ L++WGQ IDHD+T +A+TKDP T   P CC+  +   +  C P+EIP+ D F++  ++RCM FVRS + L+  C+LGPR   N +SS++DA  +Y +  ET + LR  K GLLK  P+F E  +K+LLPLKLE+PD+GCIR + D YCF+AGD  VNEQ VL++ HTL  REHNRIA EL  +NPHW+DE I+QETRHI+AALI  I YNEFLPMVLGK++M+ + LIL ++GY N Y+   +PS    F +AAFRFGHSLLPS +ERWS TH+YIG+QRLS+ML+QPYDLYK G+ D Y+ GL+NQV+QA+D S+SQEVTNHLFQ+ GK +GLDLAALN+QR R+HG+P YN +RE  GL + + W DL    +N ++  + SIY+SPDDID+W+AG++E+ L GSM+GP   CIIG+ F +LR GDR+W+EN   PSSFT                            LEQL+EIRK++ +RI+CDNSD IE+ QVY MVLPD EINPRV CKS VLPR+D SKW+D  + +P+ + P
Sbjct:   53 QEEEHHEAQCALVVPGLPGKSAAGDRYA------NLKYVPDETCITYEAVDAAFSAAKSKLRLPSTKSRTLTERDIDLLGKVIVETTRNLANQYGLPADVISNGLPLIDTSKTAIDQFCPSFLKKEESKCMAERYRQYNGLCNNLEHPYWGAALTAFRRMIPADYADGISKPRISANGKDLPTTRHISAVHHHDMGYHDHAVTVFLISWGQAIDHDMTFTADTKDPVTDTDPLCCDVPENKRNEECYPVEIPAKDPFYALFRRRCMEFVRSASSLKGECKLGPRSHLNLISSVIDANFIYGSDKETADGLRTLKGGLLKSTPMFREHGLKDLLPLKLENPDDGCIRATPDTYCFMAGDPRVNEQLVLSVTHTLLMREHNRIAQELSVINPHWDDEIIYQETRHIMAALIQQITYNEFLPMVLGKDLMESNKLILERDGYWNGYNDQVDPSLPASFGAAAFRFGHSLLPSAVERWSTTHKYIGAQRLSQMLRQPYDLYKGGYCDQYVSGLMNQVSQAMDGSMSQEVTNHLFQDSGKNWGLDLAALNMQRGRDHGIPSYNAFREHCGLKRANSWRDLSDAFTNDTLKHFTSIYDSPDDIDLWTAGVSERALTGSMVGPVFGCIIGQSFRDLRAGDRFWHENPKQPSSFTLGRFLKIKIKKDVIAKMADVVDDQFLWRLEQLQEIRKVRLARIVCDNSDDIESAQVYVMVLPDPEINPRVSCKSSVLPRMDLSKWKDKETKYPAAAQP 791          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold801_size95070-processed-gene-0.1 (protein:Tk01646 transcript:snap_masked-scaffold801_size95070-processed-gene-0.1-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_224067")

HSP 1 Score: 1072.77 bits (2773), Expect = 0.000e+0
Identity = 500/726 (68.87%), Postives = 584/726 (80.44%), Query Frame = 0
Query:   11 IILLLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSP 736
            ++ L   L      FG Q   + ++GCALI+ GP RSS+FD+ +  FG  S  +  S TCITYEAVN AF  A       PVRGKFT  DVG LG VIHE SRYLAKQYGLSKDA++NGLPLIDTTKT++E YCPPFLMTPKC VERYR++ G+CNN+  PHWGAAM+GHHRFL P+FADGISAPR S +G PLPSAR+VS+N H  +  HDHAVT+LLVAWGQ+IDHDITLSAE KDP T K+P+CC+ G T VH  CLPIEIP +D F+ +H Q+CMNFVRS AGLR+NCRLGPR++FN V+S LDAGT YSNS   L+ LR ++ G LKMLP+F +F MK LLPL LE PDEGCIRPSEDVYCFL+GD  VNEQTVLAM+HT+FAREHNR+A EL KVNPHW+DET+FQET+ II AL   I +NEFLPMVLG+EVM++HDL+L+K+GY + YD   NPS +T F SAAFRFGHSLLPS IERWSK+HRY+ SQ LS ML QPYDLYK GWAD YLMGL NQVA ALDDS++ E+ NHLFQEPG+K+GLDLAALNIQRAR+HG+P YN +REW  LP I  + DL G M N +V  YA  Y SP+DID+WSAGI+E+P+PGSMIGPT ACIIGKQFHN R GDR+WYENGGWPSSFTLEQL EIRK+K SR+LCDN D ++++QVYAMVLPDHEINPRVPCKSG+L  IDFS W+DASYH  P
Sbjct:    7 VVGLALGLAGQIQGFG-QPAVAPATGCALIVSGPPRSSSFDNAAYAFGAPSTPHDPSTTCITYEAVNVAFERARASENYKPVRGKFTAADVGALGVVIHEASRYLAKQYGLSKDAVANGLPLIDTTKTVVENYCPPFLMTPKCKVERYRTIEGLCNNLNMPHWGAAMHGHHRFLPPDFADGISAPRISVSGYPLPSARLVSTNTHAGDEKHDHAVTLLLVAWGQYIDHDITLSAEVKDPHTQKSPQCCK-GSTNVH--CLPIEIPDNDAFYRQHSQKCMNFVRSHAGLRFNCRLGPRESFNLVASFLDAGTTYSNSPHKLQELRSFEGGELKMLPLFEKFRMKHLLPLNLEEPDEGCIRPSEDVYCFLSGDPRVNEQTVLAMVHTIFAREHNRVAKELSKVNPHWSDETLFQETKLIIGALQQQITFNEFLPMVLGREVMEKHDLMLVKDGYLDGYDENINPSVATGFTSAAFRFGHSLLPSKIERWSKSHRYVASQELSGMLLQPYDLYKEGWADAYLMGLTNQVAHALDDSITPEIQNHLFQEPGRKWGLDLAALNIQRARDHGIPSYNKYREWCNLPSIRTFDDLLGYMPNKTVAAYAKTYASPEDIDLWSAGISERPVPGSMIGPTFACIIGKQFHNFRFGDRFWYENGGWPSSFTLEQLNEIRKVKLSRMLCDNGDDVDSVQVYAMVLPDHEINPRVPCKSGILKGIDFSAWKDASYHAQP 728          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold181_size278858-processed-gene-1.25 (protein:Tk08516 transcript:snap_masked-scaffold181_size278858-processed-gene-1.25-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_301956")

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 467/723 (64.59%), Postives = 566/723 (78.28%), Query Frame = 0
Query:   14 LLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSP 736
            LL  LL   +   P A + S+  CALII  P RSS FD  +  FGGS        TC+T++AVN AF  A    GL PVRG++T   +G LGT+IHET+RYLA+ YGLS+DA+ NGLPLIDTT+T+I  YCPPFLMTPKC VERYRSV G+CNN+++PHWGA+M+GH+R L PNFADGISAPR S TGN LPSAR+VS++ H DE  HD AVT+LLVAWGQ+IDHDITLSAE KDP T K PKCC+  +   H  CLPIEIP  D F+SK+KQ+CMNFVR  AGLR+NCRLGPR++FN V+S LDAGT YSNS   L  LR ++ G LKMLP F  F M+ LLPL LE+P+EGCIRPSED+YCFL+GD  VNEQT+LAM+HT+FAREHNRI  EL KVNPHWNDET+FQE RHI+AAL    +YNEFLPM+LG E M++++L LL  GY N YD   NPS +T F +A FRFGHSLLPS IERWSKTHR++  Q+LS ML QPYDLYK GW D+YL+G++NQVAQA+DDS++ EV NHLFQ PG KFG+DL ALN+QR REHG+P Y  +R++ GLP+I  + DLRG M N +V+ Y  +Y SP DID++SAG+ E P+ GSM+GPT ACI+GKQF + R GDR+WYENGG PSSFTLEQL+EIRKI+ SR++CDNSD I+++QVYAMVLPDH+INPRVPC SG+L  +DF+KWRDAS+H  P
Sbjct:    3 LLPILLCLGVGLSPNA-AQSTQNCALIISAPPRSSRFDQANHAFGGSPVSQDLVTTCVTFDAVNTAFERAKAVEGLSPVRGRYTAQAIGELGTIIHETTRYLAQTYGLSQDAVDNGLPLIDTTRTVINNYCPPFLMTPKCKVERYRSVEGLCNNIDNPHWGASMHGHNRLLPPNFADGISAPRVSVTGNALPSARLVSTSAHVDETRHDRAVTMLLVAWGQYIDHDITLSAEVKDPVTQKVPKCCDGVR---HKLCLPIEIPEGDPFYSKYKQKCMNFVRFSAGLRHNCRLGPRESFNLVTSTLDAGTTYSNSAHKLRELRTFEGGKLKMLPFFGNFGMEPLLPLNLENPNEGCIRPSEDIYCFLSGDPRVNEQTILAMLHTIFAREHNRIVIELSKVNPHWNDETLFQEARHIVAALQQQFSYNEFLPMILGSEEMKRYELELLSTGYFNGYDPKVNPSVTTAFTTAVFRFGHSLLPSKIERWSKTHRFVDDQKLSSMLLQPYDLYKQGWGDSYLLGMINQVAQAMDDSITTEVQNHLFQAPGTKFGMDLLALNLQRGREHGLPAYTAFRDFCGLPRIVTFDDLRGSMPNETVNAYQRVYASPADIDLFSAGVAEWPVQGSMLGPTFACIMGKQFRSFRFGDRFWYENGGLPSSFTLEQLQEIRKIRLSRLICDNSDDIDSVQVYAMVLPDHDINPRVPCNSGILRSMDFTKWRDASFHSRP 721          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold181_size278858-processed-gene-1.12 (protein:Tk08509 transcript:snap_masked-scaffold181_size278858-processed-gene-1.12-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_301956")

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 467/723 (64.59%), Postives = 566/723 (78.28%), Query Frame = 0
Query:   14 LLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAFDHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSP 736
            LL  LL   +   P A + S+  CALII  P RSS FD  +  FGGS        TC+T++AVN AF  A    GL PVRG++T   +G LGT+IHET+RYLA+ YGLS+DA+ NGLPLIDTT+T+I  YCPPFLMTPKC VERYRSV G+CNN+++PHWGA+M+GH+R L PNFADGISAPR S TGN LPSAR+VS++ H DE  HD AVT+LLVAWGQ+IDHDITLSAE KDP T K PKCC+  +   H  CLPIEIP  D F+SK+KQ+CMNFVR  AGLR+NCRLGPR++FN V+S LDAGT YSNS   L  LR ++ G LKMLP F  F M+ LLPL LE+P+EGCIRPSED+YCFL+GD  VNEQT+LAM+HT+FAREHNRI  EL KVNPHWNDET+FQE RHI+AAL    +YNEFLPM+LG E M++++L LL  GY N YD   NPS +T F +A FRFGHSLLPS IERWSKTHR++  Q+LS ML QPYDLYK GW D+YL+G++NQVAQA+DDS++ EV NHLFQ PG KFG+DL ALN+QR REHG+P Y  +R++ GLP+I  + DLRG M N +V+ Y  +Y SP DID++SAG+ E P+ GSM+GPT ACI+GKQF + R GDR+WYENGG PSSFTLEQL+EIRKI+ SR++CDNSD I+++QVYAMVLPDH+INPRVPC SG+L  +DF+KWRDAS+H  P
Sbjct:    3 LLPILLCLGVGLSPNA-AQSTQNCALIISAPPRSSRFDQANHAFGGSPVSQDLVTTCVTFDAVNTAFERAKAVEGLSPVRGRYTAQAIGELGTIIHETTRYLAQTYGLSQDAVDNGLPLIDTTRTVINNYCPPFLMTPKCKVERYRSVEGLCNNIDNPHWGASMHGHNRLLPPNFADGISAPRVSVTGNALPSARLVSTSAHVDETRHDRAVTMLLVAWGQYIDHDITLSAEVKDPVTQKVPKCCDGVR---HKLCLPIEIPEGDPFYSKYKQKCMNFVRFSAGLRHNCRLGPRESFNLVTSTLDAGTTYSNSAHKLRELRTFEGGKLKMLPFFGNFGMEPLLPLNLENPNEGCIRPSEDIYCFLSGDPRVNEQTILAMLHTIFAREHNRIVIELSKVNPHWNDETLFQEARHIVAALQQQFSYNEFLPMILGSEEMKRYELELLSTGYFNGYDPKVNPSVTTAFTTAVFRFGHSLLPSKIERWSKTHRFVDDQKLSSMLLQPYDLYKQGWGDSYLLGMINQVAQAMDDSITTEVQNHLFQAPGTKFGMDLLALNLQRGREHGLPAYTAFRDFCGLPRIVTFDDLRGSMPNETVNAYQRVYASPADIDLFSAGVAEWPVQGSMLGPTFACIMGKQFRSFRFGDRFWYENGGLPSSFTLEQLQEIRKIRLSRLICDNSDDIDSVQVYAMVLPDHDINPRVPCNSGILRSMDFTKWRDASFHSRP 721          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold491_size156641-processed-gene-0.8 (protein:Tk05480 transcript:snap_masked-scaffold491_size156641-processed-gene-0.8-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_301956")

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 298/384 (77.60%), Postives = 341/384 (88.80%), Query Frame = 0
Query:  360 LESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYSPF 743
            LESPDEGCIRPSEDVYCFLAGD  VNEQTVLA+IHT+  REHN IA E+ +VNPHWNDETIFQETRHI+AA++ HI YNEFLPMVLGK+VM Q +L+LLK+GYS++YD + NPSAS  F +AAFRFGH+LLPSTIERWSK+HRY+GSQRLSEMLQQPYDLYK GWAD YL+GL+NQVAQA DDS++QEVTNHLFQEPGKKFG+DLAALNIQR REHG+PGYN WRE+ GLPK+  + +L GLM+N +V GY+ +Y+SPDDID+WSAGI+EKPLPGSM+GPT ACIIGKQF  LRHGDRYWYENGGWPSSFTLEQL EIRK+K SR+LCD SD I+N+QVYAMVLPDHEINPRV CKS VLP++D SKWRDASYH S SS + PF
Sbjct:  141 LESPDEGCIRPSEDVYCFLAGDGRVNEQTVLAIIHTMLVREHNEIATEMSQVNPHWNDETIFQETRHIMAAIMQHITYNEFLPMVLGKDVMGQLELVLLKDGYSDTYDPYVNPSASNAFSTAAFRFGHTLLPSTIERWSKSHRYVGSQRLSEMLQQPYDLYKGGWADTYLLGLINQVAQAYDDSVTQEVTNHLFQEPGKKFGMDLAALNIQRGREHGIPGYNKWREFCGLPKVRSFDELLGLMTNFTVAGYSRVYDSPDDIDLWSAGISEKPLPGSMLGPTFACIIGKQFQTLRHGDRYWYENGGWPSSFTLEQLNEIRKMKLSRMLCDTSDDIDNLQVYAMVLPDHEINPRVSCKSAVLPKMDMSKWRDASYH-SASSEFQPF 523          

HSP 2 Score: 253.832 bits (647), Expect = 5.849e-76
Identity = 114/146 (78.08%), Postives = 126/146 (86.30%), Query Frame = 0
Query:  149 MTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRS 294
            MTPKC VERYRSV G+CNN++HPHWG+AMN HHRFLAP+FADGISAPR S TG PLPSAR VS+  HRD GFHDHAVTILLVAWGQ +DHDITL+ ETKDPRTGKTPKCCE    + HPNCLPIEIPS+D F+SKH QRCMNF+ S
Sbjct:    1 MTPKCKVERYRSVTGLCNNLDHPHWGSAMNAHHRFLAPDFADGISAPRISVTGRPLPSARAVSTAGHRDTGFHDHAVTILLVAWGQLMDHDITLTGETKDPRTGKTPKCCE---GSTHPNCLPIEIPSNDKFYSKHNQRCMNFLES 143          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold370_size193435-snap-gene-0.40 (protein:Tk07792 transcript:maker-scaffold370_size193435-snap-gene-0.40-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_320790")

HSP 1 Score: 495.352 bits (1274), Expect = 6.540e-162
Identity = 254/653 (38.90%), Postives = 382/653 (58.50%), Query Frame = 0
Query:  101 VGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVER-------YRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGIS-------APRASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEG----QTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELL--PLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIG-SQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPS---SFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            +  +G    + S  LA+Q+ L++  +  GL  ++   T +   CP F   P+   +R       YRS +G CNN+  P WG++ +   RFL P ++D +          R  +    LPSAR VS+ +H+         T++++ WGQF+DHD+T +   +  +      C ++G    +  +H  C PIE+P+ D FFS+    CM FVRS A  + +C LGPRD  N+V+S +DA  VY ++ E  + LRL ++G L+    + +  +++ L  PL  E   E C   + +++CF AGD  VNEQ  L  +HT++ REHNR+A EL+K NPHW DE I+ ETR I+ A+  HI +NE+LP+VLG  V+   +L L   G+ + Y+   NP+ +  F  AAFRFGHSL+   + R +K  R +    +L + L  P +L+  G  D   +GL ++     D+ ++ E+TNHLFQ P  K+G+DLA+LNIQR R+HG+P YN WRE  GL K   +SD+   M   +V G+ S+Y+S DDID++  G+ E P+ G ++GPT ACI+G+QF NLR GDR+WYENG   +   +F+ +QL+EIRK   +R +CDN D IE +Q YA +  D   N R  C+   +P++D S WR+
Sbjct:  109 LATIGYASLQASSLLARQFRLTRQQVVYGLERVELRSTDLFRRCP-FGDGPQPRQDRCRGLDLLYRSADGSCNNLLKPEWGSSFSPSLRFLPPVYSDTVGLRGEFRLPKRVRRNNRILPSARAVSTAIHKKLDTDTLTFTMMVMQWGQFLDHDLTFTPMRRGFQNSLIRCCTDDGKPLPENLMHEECRPIEVPTTDPFFSQFNVTCMEFVRSLAAPKRDCSLGPRDQMNQVTSFIDASNVYGSTQEEQDRLRLLRNGKLR----YTDLHIRKPLLPPLDQEIAQEECRISTPNLHCFEAGDERVNEQPGLTSMHTMWLREHNRLARELQKENPHWEDERIYHETRKIVGAMHQHITFNEWLPIVLGPRVLSIFELTLKPTGFFDGYNNTVNPTVANAFGGAAFRFGHSLVKGNLSRHNKEFREVPFYVKLRKELNNPANLHNFGSVDRITLGLCSKALSRRDEFITDELTNHLFQNPRTKYGMDLASLNIQRGRDHGLPPYNKWREQCGLEKFKEFSDMAKFMRPETVIGFQSVYDSVDDIDLFPGGLAELPVVGGLVGPTFACILGQQFLNLRKGDRFWYENGEDANPGGAFSAQQLQEIRKTSLARTICDNLDDIEMIQPYAFLTVDSFHNQRTACRGTGIPKLDTSAWRE 756          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold292_size219010-snap-gene-1.41 (protein:Tk00329 transcript:maker-scaffold292_size219010-snap-gene-1.41-mRNA-1 annotation:"conserved hypothetical protein")

HSP 1 Score: 487.649 bits (1254), Expect = 1.718e-155
Identity = 246/641 (38.38%), Postives = 378/641 (58.97%), Query Frame = 0
Query:   95 KFTTDDVGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNPLPSARIVSSNMHRDEGFHDHA-VTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCI--RPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSG-VLPRIDFSKWRDAS 731
            K    ++  +  V  E ++Y+AK++ L+K+ I+ GLPL D   T +   CP  +  P C   +YR+ NG CNNV++P+WG +   + R++  ++ADGIS PR  + G  LPS R VS  +H D  F++H+ + ++   WG+FI HD+  + +      G+  KCC+      HP C PI+I ++D F+ K    C  + RS    R  C LGPR+  N+V+S +D  T+Y +S E  ESLR +  G LK+    N     ELLP     PD+  +  R S+   CF +GD  VNE   +  +HTL+ R+HNR+A  + ++NPHWNDE IFQETR I+ A I HI +NE+LP +LGKE M ++ L  LK G+ + YD  TNP  +    +AA RF  SLLP+  + + ++   +  ++LSE   +P+ LY+    DN L G+    +Q+ D  ++ E+TN +F       GLDL +  IQ+ R+HG+PGY  WR++ GLP++ ++  L  +M+  ++      Y S +DID+++ G+ E P  G+++GPT AC+IG+Q    + GDRYWYEN   PSSFT +QL E+RKI  +RI+CDN+ T++ +Q    +  D  +N  +PC    V+ +++ + W  AS
Sbjct:  121 KILAKNITKVALVSEEATKYIAKKHNLTKNEITFGLPLADVRGTSLGEQCPIKVDYP-CQPGKYRAYNGYCNNVQNPNWGVSNRRYLRYIQSDYADGISIPRQREDGQFLPSPRSVSVAVHTDT-FNEHSHLMVIAPIWGEFIYHDVAHTPQMAG-YLGQRLKCCDVEFDHFHPECYPIKISTNDPFYGKFAVTCQEYARSATASRTGCTLGPREQINQVTSFVDGSTIYGSSKEEAESLRTFSLGQLKVQLNANR---DELLP-----PDQNSLDCRDSDGRKCFKSGDVRVNEHPGMVAMHTLWVRQHNRVAASMAELNPHWNDEQIFQETRRIVGAQIQHITFNEYLPTILGKETMDKYSLSPLKMGFFSGYDINTNPGTANSVTTAALRFTTSLLPAVFQYYEQSGTKVKLEKLSESFYKPFSLYEPQMVDNILRGITKSHSQSEDIHVNSEMTNKMFMNASTGMGLDLVSQIIQQGRDHGLPGYVKWRKFCGLPEVTKFGQLSDIMTVDTIQILKKTYSSIEDIDLFTGGLAEVPSKGAVVGPTFACLIGRQMFYYKTGDRYWYENDIPPSSFTKDQLNEVRKITLARIICDNTKTVDFIQPNVFLESDPFLNALMPCSGNTVVQKMNLNGWATAS 750          

HSP 2 Score: 233.032 bits (593), Expect = 1.499e-64
Identity = 127/325 (39.08%), Postives = 193/325 (59.38%), Query Frame = 0
Query:  157 RYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEE--GQTAVHPNCLPIEIPSHDTFFSK-----HKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPS 473
            +YR++ G CNN+  P +G ++    R LAP + DG+ +PR+ S +G PLPS R+VS N+H D        +++++ WGQF+DHDIT +   +    G +   C++   +T +HP CLPI +P  D +F K      K  C+ F RS  G      LG R+  N+++S LD+  VY +    +  LR +K G L     F+    ++LLPL +E+ +  C   ++  +CF AGDA  +EQ VL  IHTLF R+HN++A EL ++NP W+DET++QE R I +A++ HI +NEFLP VLG   ++ ++L L   GY + YD   NP+
Sbjct:  890 KYRTLTGWCNNLNFPEYGKSIRAFTRLLAPAYDDGLMSPRSRSVSGRPLPSPRLVSVNIHNDVSAPHVRYSLMMMQWGQFVDHDITHTPVNRG--FGDSILECKDCDAKTRIHPECLPIPVPDGDPYFPKVNITSGKPFCLAFTRSMPG---QLTLGFREQMNQITSFLDSSNVYGSDLCEMRELREFKGGRLNTTRQFHG--GRDLLPLTVENAE--C--KAKSGFCFEAGDARNSEQPVLTAIHTLFMRQHNQLADELSRLNPQWSDETLYQEGRRIASAILQHITWNEFLPRVLGWNAIKLYELNLQSEGYFHGYDEKCNPT 1203          

HSP 3 Score: 162.925 bits (411), Expect = 1.538e-41
Identity = 79/169 (46.75%), Postives = 106/169 (62.72%), Query Frame = 0
Query:  561 GLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            GLDLA+LNIQR R+HG+PGYN +R    L +   +SDLR  ++   V      Y+  DDID+++ G+ E PL G ++GPT ACIIG QF NLR  DR+WYE G     FT  QL +IRKI  S+++CD SD +  +Q     +PD  +NPRV C +  LP ID   W++
Sbjct: 1211 GLDLASLNIQRGRDHGIPGYNLYRGICNLTRADDFSDLRREIALPVVERLKRTYDHVDDIDLFTGGLAETPLHGGLVGPTFACIIGIQFRNLRKCDRFWYETGNPLIRFTDSQLAQIRKITLSKVICDTSDHVSAVQRANFDIPDPFLNPRVNCDA--LPGIDLELWKE 1377          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold274_size229011-snap-gene-1.21 (protein:Tk02572 transcript:maker-scaffold274_size229011-snap-gene-1.21-mRNA-1 annotation:"chorion peroxidase-like")

HSP 1 Score: 442.965 bits (1138), Expect = 1.026e-144
Identity = 251/684 (36.70%), Postives = 370/684 (54.09%), Query Frame = 0
Query:   83 ALERVGLPPV----RGKFTTDDVGNLG---TVIHETSRYLAKQYGLSKDAISNGLPLIDTTKT--------------IIEGYCPPFLMTPKCTVE--RYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKTGNP----LPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLS--AETKDPRTGKTPKCCEEGQTA----VHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSS-VHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHE-INPRVPCKSGVLPRIDFSKWRDAS 731
             + R  L PV    R + TT    +LG     + E S  L + + LS    ++ LP+     T               I+G     L   +C      +RSV+G CNN +H  WG A     R L P + DGIS PR   + +P    LPS R VS  +  D        T+LL+ WGQF+DHD+T +   E +D        CC  G        HP C+PI I S D+F+ +  Q+CM FVRS       C LGPR+  N++++ LDA  VY +  ET E+  L      +      ++   ELLPL    PDE C   S+  YCF AGDA  NEQ  L ++HTL+ REHNRI  +L  +N  W+DE ++QE R I+ A + HI +NE+LP++LG   M  ++L   K+G++  YD    PS +  F +AAFRFGHSL+   IE +      + + +L     +P+++Y+    D++L GL  Q +Q LD S S E+T+HLFQE     G+DL ALN+QR R+HG+PGY  +R+  GLP++  W ++  ++++   V     +Y S ++ID++  G+ E+   GS++GPT  CIIG QF  L+ GDR+W+E G  P+SF+L+QL  +R+   +RI+CDN D ++  QV  +V      +N +  C    +PR++   WR+A+
Sbjct:  138 VISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDD---SAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGS--ETSEARLLRL--GRRGRLRVTQYGGSELLPL---DPDE-CADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQ--QVQPLVFKKASGMNQKASCSGKGIPRVNLEAWRNAN 808          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold473_size162088-snap-gene-0.25 (protein:Tk03939 transcript:maker-scaffold473_size162088-snap-gene-0.25-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_42141")

HSP 1 Score: 409.068 bits (1050), Expect = 1.926e-126
Identity = 240/628 (38.22%), Postives = 346/628 (55.10%), Query Frame = 0
Query:  124 DAISNGLPLIDTTKTIIEGYCPPFLMTPK------CT-VERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPR-ASKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKD-PRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFF-----SKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLK-MLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIER----WSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPG-KKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRDAS 731
            D  ++GL  ID T+ +      PF    +      C    +YR+ NG CNN+ +  +G ++    RFL+  + D IS PR  S  G PLPS R+VS  +H D        T++L+ +GQF+DHDITL+   K  P      + C+  QT VHP C PI +P +D +F     +  +  C+ F RS  G +   RLGPR+  N+ ++ +DA  +Y N       L+   DG L    P+      K LLP      D+     +   +CF  GD+ V+EQ  LA +HT+F REHNRI   LK+VNPHW DE ++QE R I++A+I HI +NEFLP ++G   M  ++L     GY++ YD+  NPS    F ++AFRFGHSL+   + R    W + H +I   RL +    P  LY+A   D  + GL     +  D  +S E+TNHLF+E      GLDLAALNIQR R+HG+  YN +R    L +   + DL   +S   +     +Y+S +DID+++ G++E PL G+++GPT ACIIG QF  L+  DR+WYE       F+  QL +IRK+  ++I+C N D + ++Q      P   +NPRVPC S  +P IDFS WR+ +
Sbjct:  739 DDFADGLTNIDVTRVV---STVPFQTCARDENALPCDHTNKYRTFNGWCNNLNNAQYGKSVTPLIRFLSAKYDDAISRPRFRSVGGKPLPSPRLVSVVVHADVSHLHGRYTLMLMQFGQFLDHDITLTPVNKGFPDAILDCRACDSSQT-VHPECWPIPVPKNDPYFPALNTTSGRANCIAFTRSLPGQQ---RLGPREQLNQNTAYIDASMIYGNDICDAFKLKEGTDGRLNSTRPILGR--GKHLLP----KTDKNHECKAASGFCFYGGDSRVSEQPGLAAMHTIFLREHNRIVEGLKRVNPHWIDEKLYQEGRRIVSAVIQHIAFNEFLPRIIGWNYMNLYNLRARTEGYNDDYDSTCNPSIFNEFATSAFRFGHSLIRPMLTRMSPDWREMHSHI---RLRDGFFNPDMLYEATMIDEVMRGLGATPMENQDQFISGEITNHLFEERRIPHSGLDLAALNIQRGRDHGLRPYNEYRVACNLDRASSFDDLSKEISFDVIKRLQQVYDSVEDIDLFTGGLSETPLQGALVGPTFACIIGIQFQKLKKCDRFWYETSDAAIRFSEAQLTQIRKMTLAKIICANCDIVGDVQRSIFDQPHEFLNPRVPCPS--VPDIDFSHWREEA 1348          

HSP 2 Score: 319.701 bits (818), Expect = 3.353e-94
Identity = 209/683 (30.60%), Postives = 309/683 (45.24%), Query Frame = 0
Query:  107 VIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMTPKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKT-GNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDIT----------------------LSAET-----------KDPRTGKTPK---CCEEGQTAVHPN------------------------CLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWR 728
            +I E +R LAK + L++  + + +  +    T++   CP  +    C  ++YR+ NG CNNV++P WG     + R LAP + DG+  PR   T G PLP A  +SS +   +      +T L   WGQF+ HDI+                      LS +            K PR G  P    C E G+  +  N                        C PI    ++         C  +VRS  GL+  C LGPR+  N  ++ LD   +Y ++ ++ E LRL + G LK+       +   +LPL   +P+  C        CF +GD  VN    LA +HTL  REHNRIA  L+ VNPHW++ET++QE R II A I HI YNEFLP +LG+++M    L    NGY   Y+     +      +A   F  SLLP  +                    Q + +    W  N    L        D    Q  T +   E       DL +  I R R+HGVP Y   R   G      + DL   +    +    ++Y   DDID++  G+ E+PL G+++GPT  C++G+QF  L+ GDR+WYEN   PS+ T +QL++IRK+  + ++C N + I ++Q  A +  D  +N  V C   V   ++   W+
Sbjct:    5 LIEEVTRQLAKDFALNRGEVGSKVETVPIKDTMLSEICPD-IEAAFCFPQKYRTPNGECNNVKNPMWGVTGAAYLRLLAPQYDDGVGTPRIKGTRGQPLPDALTLSSKLLWSQDKPHEHLTALAAIWGQFVAHDISYTLPLSGYEQVCGQRYLLGSDILSVKAITAILVFTRLDKGPREGNLPTRCVCTEGGRVEITFNGHWCGHQFSTICCDAIFRKENAMECFPIVDVENEAI-------CQEYVRSAIGLKPGCLLGPREQMNFATAFLDGSAIYGSTPKSAEELRLLEGGRLKL-------DYGRVLPLDEHNPN--CRSDKLGNKCFRSGDERVNHNAGLAALHTLMVREHNRIAANLEAVNPHWDEETLYQEARRIIGAEIQHITYNEFLPAILGEKLMDTFRLESKSNGYHMDYNDELPITTLNSVGNAILPFFMSLLPPIL-----------------YFSQGFSV----WQTNGSQAL----GTCRDRERPQVGTRNDRNE-------DLLSSIIHRGRDHGVPTYTEVRSSCGFGPPKTFQDLNNTIDQDVISKLQAVYADVDDIDLFVGGLAERPLSGAVVGPTFGCLLGQQFQILKKGDRFWYENNIPPSALTKDQLQDIRKVSLASLICTNMEEIFSVQPEAFIRNDPYLNSPVLCD--VFATVNLQLWK 636          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold342_size201858-snap-gene-0.19 (protein:Tk00004 transcript:maker-scaffold342_size201858-snap-gene-0.19-mRNA-1 annotation:"PREDICTED: myeloperoxidase-like")

HSP 1 Score: 391.349 bits (1004), Expect = 2.085e-124
Identity = 223/596 (37.42%), Postives = 324/596 (54.36%), Query Frame = 0
Query:  158 YRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFF-----SKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYIGSQ--RLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWR----------EWXGLPK-----IHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            YR ++G CNN+  P+ G  +    R+  P + DG++ P+  S TG+PLP+ R +S+ +H +    D   T++L+ WGQF+DHDIT +   +    G    C        HP C PI +P  D +F        +++C+ F RS  G     +LGPR+  N+ ++ +DA  +Y +    LE LRL++ G L++L        K+L+P   E  ++ C  P     CF  GD   NEQ  L  +HTL  REHNR+A +L  +NP WNDE  FQE R I+ A+  HI+YNEFLP VLG  +     L L  +GY   YD          F +AAFRFGHSL+       S T + +  +  RL      P  +Y + + D+ L G+V    +  D+++S+E+TNHLFQE G+ F G+DLAALNIQR R+HG+PGY  +R           +   P+     I    DL+ + S +  +  + +Y   DDID+++ G+ EKPL G+++GPT AC+I  QF  LR  DR+WYE+      FT EQL+EIRK+  S ++C N D    M   A  + D   NP + C +   P ID +KW+D
Sbjct:  188 YRPLSGRCNNLARPNQGKHLIPLRRYFGPMYDDGVARPKIRSVTGSPLPNVRSISALVHHNASNLDSRYTLVLMQWGQFLDHDITSTPMIRG-LNGSILDCRGCDANGRHPGCYPILVPKGDKYFPLREPRTGRRKCIPFTRSLPG---QTKLGPREQINQNTAYVDASHLYGSHPCRLEDLRLHRRGHLRVLEHPKSRVFKDLMPRHNE--NDECRSPLG--LCFHTGDDRSNEQPGLTSMHTLLLREHNRLADQLLALNPLWNDEKTFQEARKILVAINQHISYNEFLPRVLGSRMTGALGLTLESSGYYRGYDPTCTADVHNEFATAAFRFGHSLIRPLFSMVSSTMKAMRDEGVRLRNHFNNPDVVYGSYFIDHILRGMVLSPMEQFDNTISEELTNHLFQERGRAFSGMDLAALNIQRGRDHGLPGYTKYRRLCLGKLEQSRFDQQPEDMFQPIQELEDLKEIFSPTVANIVSRLYRHVDDIDLFTGGLAEKPLSGAVVGPTFACLIADQFQKLRQCDRFWYESPDENFRFTPEQLDEIRKVTLSGLVCRNCDIFTPMPRQAFDMTDPLRNPLIDCTNH--PSIDITKWKD 773          
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold356_size197960-processed-gene-0.10 (protein:Tk00525 transcript:snap_masked-scaffold356_size197960-processed-gene-0.10-mRNA-1 annotation:"Peroxidasin")

HSP 1 Score: 389.808 bits (1000), Expect = 8.929e-124
Identity = 225/596 (37.75%), Postives = 314/596 (52.68%), Query Frame = 0
Query:  158 YRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRA-SKTGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQR-----CMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKTHRYI--GSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKF-GLDLAALNIQRAREHGVPGYNGWREW---------------XGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYAMVLPDHEINPRVPCKSGVLPRIDFSKWRD 729
            YRS++G CNN+  P+WG  +    R+  P + DG++ P+  S TG PLP+ R VS+ +H D    D   T++L+ WGQF+DHDIT +   +    G    C        HP C PI +P  D +F   + R     C+ F RS  G     +LGPR+  N+ ++ LDA  +Y +    L+ LRL++ G L++L        K+L+P   E  +E C   S    CF  GD   NEQ  L  +HTLF REHNR+A  L  VNP WNDE  FQE R I+ A+  HI+Y EFLP VLG  +     L L   GY  +YD   +      F +AAFRFGHSL+      +S T + +      L      P  +Y + + D  + G+V    +  D S+++E+TNHLFQE GK F G+DLAALN+QR R+HG+PGY  +RE                     I  W+DL+   S       +S+Y   DDID+++ G+ E PL G+++GPT AC+I  QF  +R  DR+WYE       F  EQL+EIRK+  S ++C N D    M   A  + D   N    C+    P ID ++W+D
Sbjct:  192 YRSLSGRCNNLARPNWGKHLVPLRRYFGPVYDDGVARPKIRSVTGPPLPNVRSVSTRVHHDASNLDTRFTLMLMQWGQFLDHDITSTPSIRG-LNGSVLDCSGCEANGRHPGCYPILVPRADKYFPVREPRSGARKCIPFTRSLPG---QTKLGPREQLNQNTAYLDASHLYGSHPCRLDDLRLHQKGHLRVLEHPKSKVFKDLMPRNKE--NEEC--RSLLGLCFHTGDDRSNEQPGLTSMHTLFLREHNRLADRLLAVNPLWNDEKTFQEARKILMAINQHISYKEFLPRVLGSGITSAFGLDLESQGYYQNYDPSCSADIHNEFATAAFRFGHSLIRPMFSMFSSTMKAMKDAGVSLRHHFNNPDVVYGSHFIDQVIRGMVMTPMEQFDSSITEELTNHLFQERGKAFSGMDLAALNLQRGRDHGLPGYTKYRELCLEKFKSNGFNQTPAEMFQPIREWTDLKDAFSPDVAAILSSLYRHVDDIDLFTGGLAELPLNGAVVGPTFACLIADQFQKVRQCDRFWYETPDENLRFAPEQLQEIRKVTLSSLICRNCDIFSPMPSNAFDIVD-ATNALRECEDH--PEIDIAQWQD 776          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000001069 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-0.000e+050.42symbol:CG5873 species:7227 "Drosophila melanogaste... [more]
-1.237e-12740.00symbol:CG42331 species:7227 "Drosophila melanogast... [more]
-2.008e-12037.63symbol:C46A5.4 species:6239 "Caenorhabditis elegan... [more]
-2.008e-12037.63symbol:C46A5.4 "Protein C46A5.4" species:6239 "Cae... [more]
-1.109e-11938.71symbol:CG10211 species:7227 "Drosophila melanogast... [more]
-2.363e-11936.36symbol:Pxt "Peroxinectin-like" species:7227 "Droso... [more]
-1.414e-11837.02symbol:cd "cardinal" species:7227 "Drosophila mela... [more]
-1.444e-11734.18symbol:CELE_T06D8.10 "Protein T06D8.10" species:62... [more]
-6.059e-10934.81symbol:Pxd "Peroxidase" species:7227 "Drosophila m... [more]
-2.680e-10133.94symbol:CELE_K10B4.1 "Protein K10B4.1" species:6239... [more]

Pages

back to top
BLAST of EMLSAG00000001069 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592832441|gb|GAXK01125103.1|0.000e+079.86TSA: Calanus finmarchicus comp24549_c0_seq1 transc... [more]
gi|592862032|gb|GAXK01095530.1|0.000e+061.23TSA: Calanus finmarchicus comp200197_c0_seq1 trans... [more]
gi|592819638|gb|GAXK01134930.1|3.892e-17742.36TSA: Calanus finmarchicus comp370050_c1_seq1 trans... [more]
gi|592871447|gb|GAXK01086115.1|6.851e-17757.80TSA: Calanus finmarchicus comp1343749_c0_seq1 tran... [more]
gi|592862031|gb|GAXK01095531.1|1.808e-17143.09TSA: Calanus finmarchicus comp200197_c0_seq2 trans... [more]
gi|592955738|gb|GAXK01002818.1|3.472e-15539.27TSA: Calanus finmarchicus comp834324_c0_seq1 trans... [more]
gi|592812399|gb|GAXK01142169.1|1.797e-15439.49TSA: Calanus finmarchicus comp101137_c1_seq2 trans... [more]
gi|592803350|gb|GAXK01151218.1|2.404e-15345.97TSA: Calanus finmarchicus comp1014998_c0_seq1 tran... [more]
gi|592812400|gb|GAXK01142168.1|4.703e-15339.49TSA: Calanus finmarchicus comp101137_c1_seq1 trans... [more]
gi|592771644|gb|GAXK01182924.1|7.795e-15239.41TSA: Calanus finmarchicus comp288209_c2_seq3 trans... [more]

Pages

back to top
BLAST of EMLSAG00000001069 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 23
Match NameE-valueIdentityDescription
EMLSAP000000010690.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s117:10710... [more]
EMLSAP000000006482.059e-14237.29pep:novel supercontig:LSalAtl2s:LSalAtl2s10:912782... [more]
EMLSAP000000032469.640e-13639.70pep:novel supercontig:LSalAtl2s:LSalAtl2s178:29948... [more]
EMLSAP000000098391.148e-12936.71pep:novel supercontig:LSalAtl2s:LSalAtl2s63:110605... [more]
EMLSAP000000011167.604e-12836.71pep:novel supercontig:LSalAtl2s:LSalAtl2s1186:3242... [more]
EMLSAP000000029391.121e-11639.23pep:novel supercontig:LSalAtl2s:LSalAtl2s168:43092... [more]
EMLSAP000000051206.448e-11635.50pep:novel supercontig:LSalAtl2s:LSalAtl2s270:28570... [more]
EMLSAP000000069202.862e-10437.99pep:novel supercontig:LSalAtl2s:LSalAtl2s391:54098... [more]
EMLSAP000000130358.837e-10437.16pep:novel supercontig:LSalAtl2s:LSalAtl2s99:469219... [more]
EMLSAP000000112199.916e-10433.23pep:novel supercontig:LSalAtl2s:LSalAtl2s769:20521... [more]

Pages

back to top
BLAST of EMLSAG00000001069 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|229462993|sp|Q9VEG6.3|PERC_DROME6.566e-12136.36RecName: Full=Chorion peroxidase; AltName: Full=Pe... [more]
gi|290457651|sp|Q01603.2|PERO_DROME1.843e-11034.81RecName: Full=Peroxidase; Short=DmPO; AltName: Ful... [more]
gi|93140516|sp|Q7QH73.3|PERC_ANOGA2.690e-10336.10RecName: Full=Chorion peroxidase; Flags: Precursor[more]
gi|166208492|sp|P82600.3|PERC_AEDAE1.385e-10135.65RecName: Full=Chorion peroxidase; Flags: Precursor[more]
gi|129831|sp|P09933.1|PERT_PIG3.898e-9932.88RecName: Full=Thyroid peroxidase; Short=TPO; Flags... [more]
gi|408360185|sp|Q8HYB7.2|PERT_CANFA9.195e-9833.70RecName: Full=Thyroid peroxidase; Short=TPO; Flags... [more]
gi|81901688|sp|Q8R481.1|PERL_MESAU4.570e-9733.13RecName: Full=Lactoperoxidase; Short=LPO; AltName:... [more]
gi|1352738|sp|P11678.2|PERE_HUMAN7.657e-9734.28RecName: Full=Eosinophil peroxidase; Short=EPO; Co... [more]
gi|172044151|sp|A4IGL7.1|PXDN_XENTR9.306e-9735.12RecName: Full=Peroxidasin; Flags: Precursor[more]
gi|74871953|sp|Q9VZZ4.1|PXDN_DROME1.217e-9634.19RecName: Full=Peroxidasin; Flags: Precursor[more]

Pages

back to top
BLAST of EMLSAG00000001069 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EFX81606.10.000e+056.16hypothetical protein DAPPUDRAFT_224067 [Daphnia pu... [more]
EFX83452.10.000e+057.89hypothetical protein DAPPUDRAFT_301956 [Daphnia pu... [more]
EFX81608.10.000e+053.60hypothetical protein DAPPUDRAFT_317232 [Daphnia pu... [more]
EEB19573.10.000e+051.98Chorion peroxidase precursor, putative [Pediculus ... [more]
gb|KYB25155.1|0.000e+051.30Chorion peroxidase-like Protein [Tribolium castane... [more]
EAA45172.50.000e+052.58AGAP000051-PA [Anopheles gambiae str. PEST][more]
AAF55422.20.000e+050.42curly Su [Drosophila melanogaster][more]
EFX81607.10.000e+054.60hypothetical protein DAPPUDRAFT_317231 [Daphnia pu... [more]
XP_016767454.10.000e+053.02PREDICTED: chorion peroxidase isoform X1 [Apis mel... [more]
XP_006557393.10.000e+053.02PREDICTED: chorion peroxidase isoform X2 [Apis mel... [more]

Pages

back to top
BLAST of EMLSAG00000001069 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|942407783|gb|JAN85821.1|0.000e+055.65Chorion peroxidase precursor, partial [Daphnia mag... [more]
gi|1022763824|gb|KZS09370.1|0.000e+055.79Chorion peroxidase [Daphnia magna][more]
gi|942326575|gb|JAN45220.1|0.000e+055.65Chorion peroxidase precursor [Daphnia magna][more]
gi|942313225|gb|JAN38545.1|0.000e+055.65Chorion peroxidase precursor [Daphnia magna][more]
gi|942332705|gb|JAN48285.1|0.000e+055.65Chorion peroxidase precursor [Daphnia magna][more]
gi|942299817|gb|JAN31841.1|0.000e+055.65Chorion peroxidase precursor [Daphnia magna][more]
gi|942356709|gb|JAN60284.1|0.000e+057.06Chorion peroxidase precursor [Daphnia magna][more]
gi|942377301|gb|JAN70580.1|0.000e+057.06Chorion peroxidase precursor [Daphnia magna][more]
gi|942367297|gb|JAN65578.1|0.000e+057.06Chorion peroxidase precursor [Daphnia magna][more]
gi|942346896|gb|JAN55379.1|0.000e+053.56Chorion peroxidase precursor [Daphnia magna][more]

Pages

back to top
BLAST of EMLSAG00000001069 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 22
Match NameE-valueIdentityDescription
snap_masked-scaffold801_size95070-processed-gene-0.10.000e+068.87protein:Tk01646 transcript:snap_masked-scaffold801... [more]
snap_masked-scaffold181_size278858-processed-gene-1.250.000e+064.59protein:Tk08516 transcript:snap_masked-scaffold181... [more]
snap_masked-scaffold181_size278858-processed-gene-1.120.000e+064.59protein:Tk08509 transcript:snap_masked-scaffold181... [more]
snap_masked-scaffold491_size156641-processed-gene-0.85.849e-7677.60protein:Tk05480 transcript:snap_masked-scaffold491... [more]
maker-scaffold370_size193435-snap-gene-0.406.540e-16238.90protein:Tk07792 transcript:maker-scaffold370_size1... [more]
maker-scaffold292_size219010-snap-gene-1.411.718e-15538.38protein:Tk00329 transcript:maker-scaffold292_size2... [more]
maker-scaffold274_size229011-snap-gene-1.211.026e-14436.70protein:Tk02572 transcript:maker-scaffold274_size2... [more]
maker-scaffold473_size162088-snap-gene-0.251.926e-12638.22protein:Tk03939 transcript:maker-scaffold473_size1... [more]
maker-scaffold342_size201858-snap-gene-0.192.085e-12437.42protein:Tk00004 transcript:maker-scaffold342_size2... [more]
snap_masked-scaffold356_size197960-processed-gene-0.108.929e-12437.75protein:Tk00525 transcript:snap_masked-scaffold356... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s117supercontigLSalAtl2s117:1071016..1073247 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionaugustus_masked-LSalAtl2s117-processed-gene-10.0
Biotypeprotein_coding
EvidenceIEA
NoteChorion peroxidase
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000001069 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000001069EMLSAT00000001069-696916Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s117:1071016..1073247+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000001069-683835 ID=EMLSAG00000001069-683835|Name=EMLSAG00000001069|organism=Lepeophtheirus salmonis|type=gene|length=2232bp|location=Sequence derived from alignment at LSalAtl2s117:1071016..1073247+ (Lepeophtheirus salmonis)
ATGTTCCATATCAGCATGCGATTCTCATCTATTATCCTTTTATTAACAAC ACTTCTCTCACCGGCTCTCTCCTTCGGTCCACAGGCTCCTTCCTCTTCTT CATCAGGATGTGCTCTCATTATCCCAGGGCCTGGAAGATCCTCTGCCTTT GATCATGGATCTCGCGTCTTTGGCGGATCATCCTTTGATTATCAAGGATC TAATACTTGCATTACCTATGAGGCAGTCAATGCTGCATTTACCACTGCCT TAGAAAGAGTAGGACTTCCACCTGTAAGGGGAAAGTTCACTACTGATGAT GTGGGTAATCTTGGAACTGTGATTCATGAAACGAGTCGTTACCTTGCCAA ACAGTATGGCCTATCTAAAGATGCTATTTCTAATGGACTACCTCTCATTG ATACTACTAAGACCATCATTGAAGGCTACTGTCCACCCTTTTTGATGACT CCAAAGTGCACAGTGGAGCGTTACAGAAGTGTTAACGGAATGTGTAACAA CGTAGAGCACCCTCATTGGGGAGCGGCTATGAATGGACATCACAGATTCC TTGCACCTAATTTTGCAGATGGAATCTCTGCTCCAAGGGCCTCCAAAACT GGAAATCCTCTTCCTTCTGCTCGTATTGTTTCATCTAATATGCACAGAGA TGAAGGATTCCACGATCATGCTGTGACTATTCTTCTCGTAGCCTGGGGAC AGTTTATTGATCACGATATCACTCTTAGTGCTGAAACAAAGGATCCTCGT ACAGGGAAAACACCCAAGTGTTGTGAAGAGGGACAAACTGCTGTTCATCC CAATTGCTTGCCAATCGAAATCCCATCTCATGATACATTCTTCTCAAAAC ACAAGCAACGTTGTATGAACTTTGTTCGTTCTCAAGCCGGTCTTCGTTAC AATTGCAGACTAGGACCCCGTGATACCTTCAATGAAGTATCATCCCTCCT AGATGCTGGAACCGTGTACTCCAACTCTGATGAGACTCTTGAGAGTTTGA GACTCTACAAGGACGGACTCCTTAAAATGTTGCCCGTTTTTAATGAATTT GAAATGAAGGAACTCCTTCCTCTTAAATTGGAATCTCCTGATGAGGGTTG CATTAGACCTTCAGAAGATGTGTATTGTTTCTTGGCTGGAGATGCTCSTG TAAACGAACAAACTGTTTTGGCCATGATACACACGCTTTTTGCCCGTGAA CACAACCGTATTGCCGGGGAATTGAAAAAAGTAAATCCTCATTGGAATGA CGAAACTATTTTCCAAGAGACTCGTCACATCATTGCAGCCCTTATTTCCC ACATCAATTACAACGAGTTTCTTCCCATGGTCCTTGGAAAGGAAGTTATG CAACAACATGACCTCATCCTTCTCAAAAATGGATATTCCAACAGCTATGA CACATTCACCAACCCTTCTGCTTCCACTGTTTTCGTCTCGGCTGCGTTCA GATTCGGACATTCCCTCCTCCCATCCACCATCGAAAGATGGAGCAAGACC CATCGCTATATTGGATCCCAAAGACTCAGCGAGATGTTGCAACAACCCTA CGATTTATACAAAGCTGGATGGGCTGATAATTACCTTATGGGTCTTGTTA ACCAAGTGGCTCAAGCCCTCGATGATTCCCTCTCTCAAGAAGTCACTAAC CACTTGTTCCAAGAGCCAGGAAAGAAATTTGGTCTCGACTTGGCTGCTTT GAACATTCAAAGAGCTCGTGAGCATGGTGTTCCCGGATACAACGGATGGA GAGAATGGMGTGGACTCCCCAAGATCCACAGATGGTCAGACCTTCGCGGA CTCATGTCTAACTCCAGTGTACATGGCTATGCCAGCATTTACGAATCCCC CGATGACATCGATATCTGGTCCGCAGGGATCACTGAAAAACCTCTACCCG GCTCTATGATTGGACCTACACTCGCCTGTATCATTGGTAAACAATTCCAC AATTTAAGACATGGAGATCGTTATTGGTATGAAAACGGAGGATGGCCCTC AAGCTTCACTCTCGAACAACTGGAAGAGATCCGTAAGATTAAGTTCTCTC GAATCTTGTGTGATAACAGCGATACAATTGAAAACATGCAAGTCTATGCC ATGGTCCTTCCAGATCATGAAATCAATCCGCGTGTTCCTTGCAAAAGCGG AGTTCTTCCTAGAATCGACTTTTCCAAATGGAGAGATGCATCTTATCATC CTTCTCCATCATCTCCTTATAGTCCGTTTTAA
back to top
Add to Basket