EMLSAT00000001069, EMLSAT00000001069-696916 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000001069
Unique NameEMLSAT00000001069-696916
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: survival, reduced
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
Functional characterization of a heme Peroxidase (male) F159 HPX1 Male
  1. padII/ad
  2. Adult
Fall off the fish
survival, reduced
30.05.2014 - 12:30
10.06.2014 - 12:33
Molecular characterization and functional... more
Functional characterization of a heme Peroxidase (female) F159 HPX1 Female
  1. PreAdult1
  2. PreAdult2/Adult
Fall off the fish
survival, reduced
30.05.2014 - 12:30
10.06.2014 - 12:33
Molecular characterization and functional... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: Motility, reduced
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
Functional characterization of a heme Peroxidase (Nauplia) F159 HPX1 both
  1. Nauplius1
  2. Copepodid
Decreased swimming activity
Motility, reduced
07.06.2016 - 12:30
17.06.2016 - 12:33
Molecular characterization and functional... more
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s117supercontigLSalAtl2s117:1071016..1073247 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000001069 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000001069EMLSAG00000001069-683835Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000004710EMLSAE00000004710-713638Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto780370auto780370Lepeophtheirus salmonispolypeptide
EMLSAP00000001069EMLSAP00000001069Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000001069

>EMLSAP00000001069 ID=EMLSAP00000001069|Name=EMLSAP00000001069|organism=Lepeophtheirus salmonis|type=polypeptide|length=743bp
MFHISMRFSSIILLLTTLLSPALSFGPQAPSSSSSGCALIIPGPGRSSAF
DHGSRVFGGSSFDYQGSNTCITYEAVNAAFTTALERVGLPPVRGKFTTDD
VGNLGTVIHETSRYLAKQYGLSKDAISNGLPLIDTTKTIIEGYCPPFLMT
PKCTVERYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASKT
GNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPR
TGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRY
NCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEF
EMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFARE
HNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVM
QQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWSKT
HRYIGSQRLSEMLQQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTN
HLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRG
LMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFH
NLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNSDTIENMQVYA
MVLPDHEINPRVPCKSGVLPRIDFSKWRDASYHPSPSSPYSPF
back to top

mRNA from alignment at LSalAtl2s117:1071016..1073247+

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000001069-696916 ID=EMLSAT00000001069-696916|Name=EMLSAT00000001069|organism=Lepeophtheirus salmonis|type=mRNA|length=2232bp|location=Sequence derived from alignment at LSalAtl2s117:1071016..1073247+ (Lepeophtheirus salmonis)
ATGTTCCATATCAGCATGCGATTCTCATCTATTATCCTTTTATTAACAAC ACTTCTCTCACCGGCTCTCTCCTTCGGTCCACAGGCTCCTTCCTCTTCTT CATCAGGATGTGCTCTCATTATCCCAGGGCCTGGAAGATCCTCTGCCTTT GATCATGGATCTCGCGTCTTTGGCGGATCATCCTTTGATTATCAAGGATC TAATACTTGCATTACCTATGAGGCAGTCAATGCTGCATTTACCACTGCCT TAGAAAGAGTAGGACTTCCACCTGTAAGGGGAAAGTTCACTACTGATGAT GTGGGTAATCTTGGAACTGTGATTCATGAAACGAGTCGTTACCTTGCCAA ACAGTATGGCCTATCTAAAGATGCTATTTCTAATGGACTACCTCTCATTG ATACTACTAAGACCATCATTGAAGGCTACTGTCCACCCTTTTTGATGACT CCAAAGTGCACAGTGGAGCGTTACAGAAGTGTTAACGGAATGTGTAACAA CGTAGAGCACCCTCATTGGGGAGCGGCTATGAATGGACATCACAGATTCC TTGCACCTAATTTTGCAGATGGAATCTCTGCTCCAAGGGCCTCCAAAACT GGAAATCCTCTTCCTTCTGCTCGTATTGTTTCATCTAATATGCACAGAGA TGAAGGATTCCACGATCATGCTGTGACTATTCTTCTCGTAGCCTGGGGAC AGTTTATTGATCACGATATCACTCTTAGTGCTGAAACAAAGGATCCTCGT ACAGGGAAAACACCCAAGTGTTGTGAAGAGGGACAAACTGCTGTTCATCC CAATTGCTTGCCAATCGAAATCCCATCTCATGATACATTCTTCTCAAAAC ACAAGCAACGTTGTATGAACTTTGTTCGTTCTCAAGCCGGTCTTCGTTAC AATTGCAGACTAGGACCCCGTGATACCTTCAATGAAGTATCATCCCTCCT AGATGCTGGAACCGTGTACTCCAACTCTGATGAGACTCTTGAGAGTTTGA GACTCTACAAGGACGGACTCCTTAAAATGTTGCCCGTTTTTAATGAATTT GAAATGAAGGAACTCCTTCCTCTTAAATTGGAATCTCCTGATGAGGGTTG CATTAGACCTTCAGAAGATGTGTATTGTTTCTTGGCTGGAGATGCTCSTG TAAACGAACAAACTGTTTTGGCCATGATACACACGCTTTTTGCCCGTGAA CACAACCGTATTGCCGGGGAATTGAAAAAAGTAAATCCTCATTGGAATGA CGAAACTATTTTCCAAGAGACTCGTCACATCATTGCAGCCCTTATTTCCC ACATCAATTACAACGAGTTTCTTCCCATGGTCCTTGGAAAGGAAGTTATG CAACAACATGACCTCATCCTTCTCAAAAATGGATATTCCAACAGCTATGA CACATTCACCAACCCTTCTGCTTCCACTGTTTTCGTCTCGGCTGCGTTCA GATTCGGACATTCCCTCCTCCCATCCACCATCGAAAGATGGAGCAAGACC CATCGCTATATTGGATCCCAAAGACTCAGCGAGATGTTGCAACAACCCTA CGATTTATACAAAGCTGGATGGGCTGATAATTACCTTATGGGTCTTGTTA ACCAAGTGGCTCAAGCCCTCGATGATTCCCTCTCTCAAGAAGTCACTAAC CACTTGTTCCAAGAGCCAGGAAAGAAATTTGGTCTCGACTTGGCTGCTTT GAACATTCAAAGAGCTCGTGAGCATGGTGTTCCCGGATACAACGGATGGA GAGAATGGMGTGGACTCCCCAAGATCCACAGATGGTCAGACCTTCGCGGA CTCATGTCTAACTCCAGTGTACATGGCTATGCCAGCATTTACGAATCCCC CGATGACATCGATATCTGGTCCGCAGGGATCACTGAAAAACCTCTACCCG GCTCTATGATTGGACCTACACTCGCCTGTATCATTGGTAAACAATTCCAC AATTTAAGACATGGAGATCGTTATTGGTATGAAAACGGAGGATGGCCCTC AAGCTTCACTCTCGAACAACTGGAAGAGATCCGTAAGATTAAGTTCTCTC GAATCTTGTGTGATAACAGCGATACAATTGAAAACATGCAAGTCTATGCC ATGGTCCTTCCAGATCATGAAATCAATCCGCGTGTTCCTTGCAAAAGCGG AGTTCTTCCTAGAATCGACTTTTCCAAATGGAGAGATGCATCTTATCATC CTTCTCCATCATCTCCTTATAGTCCGTTTTAA
back to top
Add to Basket