EMLSAG00000001118, EMLSAG00000001118-683884 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:CALM2 "Calmodulin" species:9606 "Homo sapiens" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR002048 InterPro:IPR011992 Pfam:PF13405 PROSITE:PS50222 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 EMBL:AC073283 HGNC:HGNC:1445 ProteinModelPortal:F8WBR5 SMR:F8WBR5 PRIDE:F8WBR5 Ensembl:ENST00000432899 NextBio:35513496 ArrayExpress:F8WBR5 Bgee:F8WBR5 Uniprot:F8WBR5) HSP 1 Score: 54.299 bits (129), Expect = 1.202e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:cal-3 "Protein CAL-3, isoform a" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR002048 InterPro:IPR011992 Pfam:PF00036 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 eggNOG:COG5126 HOGENOM:HOG000233018 GeneTree:ENSGT00690000101871 EMBL:FO081251 EMBL:FO081249 RefSeq:NP_500421.2 UniGene:Cel.12583 ProteinModelPortal:Q94288 SMR:Q94288 STRING:6239.M02B7.6 PRIDE:Q94288 EnsemblMetazoa:M02B7.6 GeneID:177143 KEGG:cel:CELE_M02B7.6 UCSC:M02B7.6 CTD:177143 WormBase:M02B7.6a InParanoid:Q94288 OMA:MIREAFK OrthoDB:EOG7PGDVN NextBio:895532 Uniprot:Q94288) HSP 1 Score: 56.225 bits (134), Expect = 1.207e-9 Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 0 Query: 5 HPTIIYGINLTTTTLNPKLMNNPKNPLYK---------KQICKXCR----QPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 HPT+ I T PKL PK+ K I R Q + ++ +L S+++++E+ EF E F +FDKDG+GTI +KELG +R+LG+ Sbjct: 33 HPTVPETIKFNITHGFPKL---PKSFWLSFEATMSRNTKVIMSIMRTRTLQEVFEESKLVISQLTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQ 130
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:cal-3 "Protein CAL-3, isoform b" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR002048 InterPro:IPR011992 Pfam:PF13499 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 EMBL:FO081251 WormBase:M02B7.6b Uniprot:U4PQW9) HSP 1 Score: 55.4546 bits (132), Expect = 1.390e-9 Identity = 23/51 (45.10%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 42 QPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 Q + ++ +L S+++++E+ EF E F +FDKDG+GTI +KELG +R+LG+ Sbjct: 10 QEVFEESKLVISQLTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQ 60
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:CALM1 "Calmodulin" species:9606 "Homo sapiens" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR002048 InterPro:IPR011992 Pfam:PF13405 PROSITE:PS50222 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 HGNC:HGNC:1442 ChiTaRS:CALM1 EMBL:AL512791 ProteinModelPortal:G3V479 SMR:G3V479 PRIDE:G3V479 Ensembl:ENST00000553630 NextBio:35517313 ArrayExpress:G3V479 Bgee:G3V479 Uniprot:G3V479) HSP 1 Score: 54.299 bits (129), Expect = 1.535e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:PF14_0323 "Calmodulin" species:36329 "Plasmodium falciparum 3D7" [GO:0005575 "cellular_component" evidence=ND] [GO:0008150 "biological_process" evidence=ND] InterPro:IPR001125 InterPro:IPR002048 InterPro:IPR011992 Pfam:PF00036 Pfam:PF13499 PRINTS:PR00450 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 EMBL:AE014187 HOGENOM:HOG000233018 KO:K02183 OMA:NEVDEMI ProtClustDB:PTZ00184 RefSeq:XP_001348497.1 ProteinModelPortal:P62203 SMR:P62203 BioGrid:1207263 IntAct:P62203 MINT:MINT-1546362 STRING:5833.PF14_0323-1 EnsemblProtists:PF14_0323:mRNA GeneID:811905 KEGG:pfa:PF14_0323 EuPathDB:PlasmoDB:PF3D7_1434200 Uniprot:P62203) HSP 1 Score: 55.0694 bits (131), Expect = 1.672e-9 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 K++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 KLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:PF14_0323 "calmodulin" species:5833 "Plasmodium falciparum" [GO:0005575 "cellular_component" evidence=ND] [GO:0008150 "biological_process" evidence=ND] InterPro:IPR001125 InterPro:IPR002048 InterPro:IPR011992 Pfam:PF00036 Pfam:PF13499 PRINTS:PR00450 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 EMBL:AE014187 HOGENOM:HOG000233018 KO:K02183 OMA:NEVDEMI ProtClustDB:PTZ00184 RefSeq:XP_001348497.1 ProteinModelPortal:P62203 SMR:P62203 BioGrid:1207263 IntAct:P62203 MINT:MINT-1546362 STRING:5833.PF14_0323-1 EnsemblProtists:PF14_0323:mRNA GeneID:811905 KEGG:pfa:PF14_0323 EuPathDB:PlasmoDB:PF3D7_1434200 Uniprot:P62203) HSP 1 Score: 55.0694 bits (131), Expect = 1.672e-9 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 K++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 KLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:cal-1 species:6239 "Caenorhabditis elegans" [GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP] InterPro:IPR002048 InterPro:IPR011992 Pfam:PF13499 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 GeneTree:ENSGT00690000101871 EMBL:Z77653 UniGene:Cel.4340 GeneID:179715 KEGG:cel:CELE_C13C12.1 CTD:179715 RefSeq:NP_001256428.1 ProteinModelPortal:H9G2Z0 SMR:H9G2Z0 EnsemblMetazoa:C13C12.1b WormBase:C13C12.1b ArrayExpress:H9G2Z0 Uniprot:H9G2Z0) HSP 1 Score: 55.0694 bits (131), Expect = 1.940e-9 Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 0 Query: 31 LYKKQICKXCRQPLPKQL-ELAKSKVSQ---KELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 L + + R +P L + ++ + Q +E+DEF E F MFDKDG+GTI KELG +RSLG+ Sbjct: 9 LARDMAIRAERMAIPSNLMQFSEDIIKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQ 74
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:cal-1 "Protein CAL-1, isoform b" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR002048 InterPro:IPR011992 Pfam:PF13499 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 GeneTree:ENSGT00690000101871 EMBL:Z77653 UniGene:Cel.4340 GeneID:179715 KEGG:cel:CELE_C13C12.1 CTD:179715 RefSeq:NP_001256428.1 ProteinModelPortal:H9G2Z0 SMR:H9G2Z0 EnsemblMetazoa:C13C12.1b WormBase:C13C12.1b ArrayExpress:H9G2Z0 Uniprot:H9G2Z0) HSP 1 Score: 55.0694 bits (131), Expect = 1.940e-9 Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 0 Query: 31 LYKKQICKXCRQPLPKQL-ELAKSKVSQ---KELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 L + + R +P L + ++ + Q +E+DEF E F MFDKDG+GTI KELG +RSLG+ Sbjct: 9 LARDMAIRAERMAIPSNLMQFSEDIIKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQ 74
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:CALM3 "Calmodulin" species:9606 "Homo sapiens" [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0016301 "kinase activity" evidence=IEA] InterPro:IPR002048 InterPro:IPR011992 Pfam:PF13499 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 EMBL:CH471126 GO:GO:0016301 OrthoDB:EOG7F7WBV UniGene:Hs.515487 HGNC:HGNC:1449 EMBL:AC093503 ProteinModelPortal:M0QZ52 SMR:M0QZ52 PRIDE:M0QZ52 Ensembl:ENST00000597743 ArrayExpress:M0QZ52 Uniprot:M0QZ52) HSP 1 Score: 54.299 bits (129), Expect = 2.018e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. GO
Match: - (symbol:CALM1 "Calmodulin" species:9606 "Homo sapiens" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR001125 InterPro:IPR002048 InterPro:IPR011992 Pfam:PF13499 PRINTS:PR00450 PROSITE:PS50222 SMART:SM00054 Prosite:PS00018 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247 KO:K02183 OMA:YQEFVKM CTD:801 UniGene:Hs.282410 GeneID:801 KEGG:hsa:801 HGNC:HGNC:1442 ChiTaRS:CALM1 EMBL:AL512791 RefSeq:XP_005268147.1 RefSeq:XP_005268148.1 ProteinModelPortal:E7ETZ0 SMR:E7ETZ0 IntAct:E7ETZ0 PRIDE:E7ETZ0 Ensembl:ENST00000447653 UCSC:uc010atq.2 NextBio:35500416 ArrayExpress:E7ETZ0 Bgee:E7ETZ0 Uniprot:E7ETZ0) HSP 1 Score: 53.9138 bits (128), Expect = 4.124e-9 Identity = 22/43 (51.16%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 50 LAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 + +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 1 MQADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 43
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592789710|gb|GAXK01164858.1| (TSA: Calanus finmarchicus comp674789_c0_seq1 transcribed RNA sequence) HSP 1 Score: 58.151 bits (139), Expect = 1.417e-10 Identity = 32/56 (57.14%), Postives = 36/56 (64.29%), Query Frame = 0 Query: 37 CKXCR-QPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLG 91 CK C Q P Q K+S ELD + E F MFDKDGDGT+ KELGAV+RSLG Sbjct: 232 CKTCSAQMAPGQK--YSVKLSDAELDSYKETFMMFDKDGDGTVSTKELGAVMRSLG 393 HSP 2 Score: 33.113 bits (74), Expect = 8.003e-2 Identity = 16/45 (35.56%), Postives = 28/45 (62.22%), Query Frame = 0 Query: 48 LELAKSKVSQKEL-DEFSECFRMFDKDGDGTIDVKELGAVLRSLG 91 +EL + ++KE ++ + FR+FDKDG+G + E+ VL +G Sbjct: 478 VELMIKREAEKETPEDLKQAFRVFDKDGNGYVSTSEIKYVLSRIG 612
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592815656|gb|GAXK01138912.1| (TSA: Calanus finmarchicus comp2208990_c0_seq1 transcribed RNA sequence) HSP 1 Score: 55.8398 bits (133), Expect = 4.389e-10 Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 0 Query: 37 CKXCRQPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLG 91 C C Q K++ + +++ +++ + E F+MFDKDGDGTI KELGAVLRSLG Sbjct: 404 CPRCEQS--KKMRDFATSLTEDKVNNYKEMFQMFDKDGDGTISTKELGAVLRSLG 562 HSP 2 Score: 31.187 bits (69), Expect = 3.185e-1 Identity = 13/42 (30.95%), Postives = 24/42 (57.14%), Query Frame = 0 Query: 50 LAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLG 91 + K + ++ ++ + FR+FDKDG+G + EL V+ L Sbjct: 185 MVKREREKETTEDIKQAFRVFDKDGNGYVSTSELKFVMNKLN 310
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592779066|gb|GAXK01175502.1| (TSA: Calanus finmarchicus comp2010_c4_seq1 transcribed RNA sequence) HSP 1 Score: 53.9138 bits (128), Expect = 2.321e-9 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 0 Query: 40 CRQPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 R L L +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 12 TRDSLYLYLLTMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 170 HSP 2 Score: 36.1946 bits (82), Expect = 5.237e-3 Identity = 16/32 (50.00%), Postives = 22/32 (68.75%), Query Frame = 0 Query: 61 DEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +E E FR+FDKDG+G I EL V+ +LG+ Sbjct: 294 EEIREAFRVFDKDGNGFISAAELRHVMTNLGE 389
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592791700|gb|GAXK01162868.1| (TSA: Calanus finmarchicus comp784995_c0_seq1 transcribed RNA sequence) HSP 1 Score: 52.7582 bits (125), Expect = 3.481e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 25 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 141 HSP 2 Score: 33.113 bits (74), Expect = 5.647e-2 Identity = 14/32 (43.75%), Postives = 22/32 (68.75%), Query Frame = 0 Query: 61 DEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +E E F++FDKDG+G I EL ++ +LG+ Sbjct: 265 EEILEAFKVFDKDGNGFISAAELRHIMTNLGE 360
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592802444|gb|GAXK01152124.1| (TSA: Calanus finmarchicus comp4974722_c0_seq1 transcribed RNA sequence) HSP 1 Score: 51.9878 bits (123), Expect = 5.603e-9 Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = 0 Query: 44 LPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 L K ++ +++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 194 LKKNFITMADALTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 340 HSP 2 Score: 28.4906 bits (62), Expect = 2.421e+0 Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 0 Query: 61 DEFSECFRMFDKDGDGTIDVKEL 83 +E E F++FDKDG+G I EL Sbjct: 2 EEIIEAFKVFDKDGNGFISAAEL 70
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592943403|gb|GAXK01015150.1| (TSA: Calanus finmarchicus comp1556889_c0_seq1 transcribed RNA sequence) HSP 1 Score: 53.5286 bits (127), Expect = 7.970e-9 Identity = 23/38 (60.53%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 55 VSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +S++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 552 LSEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 665 HSP 2 Score: 36.1946 bits (82), Expect = 6.267e-3 Identity = 16/32 (50.00%), Postives = 22/32 (68.75%), Query Frame = 0 Query: 61 DEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 DE E F++FD DG+G I V EL V+ +LG+ Sbjct: 333 DELREAFKVFDDDGNGFISVSELRQVMTNLGE 428
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592823636|gb|GAXK01130932.1| (TSA: Calanus finmarchicus comp178313_c2_seq1 transcribed RNA sequence) HSP 1 Score: 50.8322 bits (120), Expect = 1.250e-8 Identity = 21/39 (53.85%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++++++ EF E F +FDKDGDGTI KELG V+ SLG+ Sbjct: 58 QLTEEQTAEFREAFALFDKDGDGTISTKELGTVMNSLGQ 174
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592833698|gb|GAXK01123846.1| (TSA: Calanus finmarchicus comp3615050_c0_seq1 transcribed RNA sequence) HSP 1 Score: 50.8322 bits (120), Expect = 1.773e-8 Identity = 22/39 (56.41%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++ K++ E ECF +FD+DGDGTI EL AVLRS+GK Sbjct: 100 ELTDKKILEMQECFSLFDRDGDGTITTHELAAVLRSIGK 216
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592784785|gb|GAXK01169783.1| (TSA: Calanus finmarchicus comp484_c0_seq1 transcribed RNA sequence) HSP 1 Score: 52.7582 bits (125), Expect = 2.601e-8 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 267 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 383 HSP 2 Score: 35.039 bits (79), Expect = 2.105e-2 Identity = 16/32 (50.00%), Postives = 22/32 (68.75%), Query Frame = 0 Query: 61 DEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +E E FR+FDKDG+G I EL V+ +LG+ Sbjct: 507 EEIREAFRVFDKDGNGFISAAELRHVMTNLGE 602
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Match: gi|592819915|gb|GAXK01134653.1| (TSA: Calanus finmarchicus comp93585_c0_seq1 transcribed RNA sequence) HSP 1 Score: 48.9062 bits (115), Expect = 7.659e-8 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 0 Query: 62 EFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 EF E F +FDKDGDGTI KELG V++SLG+ Sbjct: 198 EFREAFALFDKDGDGTISTKELGTVMKSLGQ 290
BLAST of EMLSAG00000001118 vs. L. salmonis peptides
Match: EMLSAP00000001118 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1187:84720:84998:1 gene:EMLSAG00000001118 transcript:EMLSAT00000001118 description:"augustus_masked-LSalAtl2s1187-processed-gene-0.0") HSP 1 Score: 187.193 bits (474), Expect = 1.320e-62 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0 Query: 1 MPKDHPTIIYGINLTTTTLNPKLMNNPKNPLYKKQICKXCRQPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 MPKDHPTIIYGINLTTTTLNPKLMNNPKNPLYKKQICKXCRQPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK Sbjct: 1 MPKDHPTIIYGINLTTTTLNPKLMNNPKNPLYKKQICKXCRQPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92
BLAST of EMLSAG00000001118 vs. L. salmonis peptides
Match: EMLSAP00000002767 (pep:novel supercontig:LSalAtl2s:LSalAtl2s15:378667:382347:1 gene:EMLSAG00000002767 transcript:EMLSAT00000002767 description:"maker-LSalAtl2s15-augustus-gene-3.6") HSP 1 Score: 53.9138 bits (128), Expect = 1.507e-10 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 41
BLAST of EMLSAG00000001118 vs. L. salmonis peptides
Match: EMLSAP00000006985 (pep:novel supercontig:LSalAtl2s:LSalAtl2s397:377196:491552:1 gene:EMLSAG00000006985 transcript:EMLSAT00000006985 description:"maker-LSalAtl2s397-snap-gene-5.15") HSP 1 Score: 52.373 bits (124), Expect = 3.799e-10 Identity = 22/43 (51.16%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 50 LAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +A +++++++ EF E F +FDKDGDGTI KEL V+RSLG+ Sbjct: 1 MATEELTEEQIAEFKEAFLLFDKDGDGTITTKELATVMRSLGQ 43
BLAST of EMLSAG00000001118 vs. L. salmonis peptides
Match: EMLSAP00000011139 (pep:novel supercontig:LSalAtl2s:LSalAtl2s757:131231:140176:-1 gene:EMLSAG00000011139 transcript:EMLSAT00000011139 description:"maker-LSalAtl2s757-augustus-gene-1.16") HSP 1 Score: 45.8246 bits (107), Expect = 3.084e-7 Identity = 20/38 (52.63%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLG 91 +++ ++L+EF E F +FDK+GDGTID EL AV+R +G Sbjct: 152 RLTPEKLEEFKEAFALFDKNGDGTIDSHELVAVMRMMG 189
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|49035528|sp|Q8STF0.3|CALM_STRIE (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 56.6102 bits (135), Expect = 1.822e-10 Identity = 23/49 (46.94%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 44 LPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 + ++L + +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 1 MSQELTINADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 49
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|122063214|sp|P11120.2|CALM_PLECO (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 55.0694 bits (131), Expect = 6.164e-10 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++S++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|20137620|sp|O94739.3|CALM_PLEOS (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 55.0694 bits (131), Expect = 6.296e-10 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++S++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|122063211|sp|P84339.2|CALM_AGABI (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 55.0694 bits (131), Expect = 6.296e-10 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++S++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|115520|sp|P24044.4|CALM_PLAFA (RecName: Full=Calmodulin; Short=CaM >gi|49035519|sp|P62203.2|CALM_PLAF7 RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 55.0694 bits (131), Expect = 6.928e-10 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 K++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 KLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|49035529|sp|Q8X187.3|CALM_PAXIN (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 55.0694 bits (131), Expect = 7.153e-10 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++S++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|49035530|sp|Q95NI4.3|CALM_HALOK (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 54.299 bits (129), Expect = 1.339e-9 Identity = 23/38 (60.53%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 55 VSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +S++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 5 LSEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|59799173|sp|P69097.2|CALM_TRYBB (RecName: Full=Calmodulin; Short=CaM >gi|59799174|sp|P69098.2|CALM_TRYBG RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 54.299 bits (129), Expect = 1.427e-9 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++S +++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|115531|sp|P18061.2|CALM_TRYCR (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 54.299 bits (129), Expect = 1.505e-9 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++S +++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. SwissProt
Match: gi|49035756|sp|Q9U6D3.3|CALM_MYXGL (RecName: Full=Calmodulin; Short=CaM) HSP 1 Score: 53.9138 bits (128), Expect = 2.182e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: gb|EFA05282.2| (Calmodulin-like Protein [Tribolium castaneum]) HSP 1 Score: 58.5362 bits (140), Expect = 8.263e-11 Identity = 26/48 (54.17%), Postives = 36/48 (75.00%), Query Frame = 0 Query: 45 PKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 P +L S+VS+ ++ EF E FR+FDKDGDG+I +ELG V+RSLG+ Sbjct: 100 PTRLSARHSEVSKSQMKEFREAFRLFDKDGDGSITKEELGRVMRSLGQ 147
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: EEB12921.1 (calmodulin, putative [Pediculus humanus corporis]) HSP 1 Score: 55.4546 bits (132), Expect = 6.592e-10 Identity = 23/43 (53.49%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 50 LAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 + K+ +S+ ++ EF E FR+FDKDGDG+I +ELG V+RSLG+ Sbjct: 44 MTKNNISKSQMKEFREAFRLFDKDGDGSITQEELGRVMRSLGQ 86
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: EEB15542.1 (calmodulin-A [Pediculus humanus corporis]) HSP 1 Score: 54.299 bits (129), Expect = 8.529e-10 Identity = 23/43 (53.49%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 50 LAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 L +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 6 LRADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 48
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: XP_006568277.1 (PREDICTED: probable calcium-binding protein CML11 isoform X2 [Apis mellifera]) HSP 1 Score: 55.0694 bits (131), Expect = 1.290e-9 Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 53 SKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 S +S+ ++ EF E FR+FDKDGDG+I +ELG V+RSLG+ Sbjct: 164 SNISKSQMKEFREAFRLFDKDGDGSITKEELGRVMRSLGQ 203
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: XP_006565317.1 (PREDICTED: calmodulin [Apis mellifera]) HSP 1 Score: 53.5286 bits (127), Expect = 1.336e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: gb|KFM82866.1| (Calmodulin, partial [Stegodyphus mimosarum]) HSP 1 Score: 53.5286 bits (127), Expect = 1.336e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: gb|KFM63817.1| (Calmodulin, partial [Stegodyphus mimosarum]) HSP 1 Score: 53.5286 bits (127), Expect = 1.336e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: EFX72807.1 (calmodulin [Daphnia pulex]) HSP 1 Score: 53.5286 bits (127), Expect = 1.336e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: gb|EEZ98710.1| (Calmodulin-like Protein [Tribolium castaneum]) HSP 1 Score: 53.5286 bits (127), Expect = 1.336e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Match: AHN56135.1 (calmodulin, isoform E [Drosophila melanogaster]) HSP 1 Score: 53.5286 bits (127), Expect = 1.336e-9 Identity = 22/39 (56.41%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 42
BLAST of EMLSAG00000001118 vs. nr
Match: gi|1058229832|gb|JAT18432.1| (hypothetical protein g.8534, partial [Graphocephala atropunctata]) HSP 1 Score: 63.1586 bits (152), Expect = 5.259e-10 Identity = 31/72 (43.06%), Postives = 46/72 (63.89%), Query Frame = 0 Query: 27 PKNPLYKKQICKXCRQPLPKQLELA------KSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 P+NP++ K+ RQ +E K +VS+ +++EF E FR+FDKDGDG+I +ELG V+RSLG+ Sbjct: 91 PQNPIHTKEPSTTPRQRSVDHMERPPPTPSNKPQVSKTQMNEFREAFRLFDKDGDGSITQEELGRVMRSLGQ 162
BLAST of EMLSAG00000001118 vs. nr
Match: gi|558254899|gb|AHA51357.1| (EF-hand_1 domain-containing protein [Euplokamis dunlapae]) HSP 1 Score: 61.2326 bits (147), Expect = 1.747e-9 Identity = 35/79 (44.30%), Postives = 48/79 (60.76%), Query Frame = 0 Query: 23 LMNNP--------KNPLYKKQICKXCRQPLPKQLELAKS-KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++NNP KNP K K R P+ +E+A + +S+ ++ EF E F MFDKDGDG+I V ELG V+RSLG+ Sbjct: 9 VLNNPITKDKGGFKNPAKVKAAEKNGR---PRAVEMANAPHLSEAQIVEFREAFAMFDKDGDGSISVSELGTVMRSLGQ 84
BLAST of EMLSAG00000001118 vs. nr
Match: gi|676271182|gb|KFO26283.1| (Calmodulin [Fukomys damarensis]) HSP 1 Score: 58.9214 bits (141), Expect = 8.665e-9 Identity = 24/50 (48.00%), Postives = 37/50 (74.00%), Query Frame = 0 Query: 43 PLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 P+P+ + +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 13 PIPQPITHGADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 62
BLAST of EMLSAG00000001118 vs. nr
Match: gi|627800213|ref|XP_007673454.1| (hypothetical protein BAUCODRAFT_22484 [Baudoinia panamericana UAMH 10762] >gi|449303208|gb|EMC99216.1| hypothetical protein BAUCODRAFT_22484 [Baudoinia panamericana UAMH 10762]) HSP 1 Score: 58.151 bits (139), Expect = 1.451e-8 Identity = 25/43 (58.14%), Postives = 35/43 (81.40%), Query Frame = 0 Query: 50 LAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 LAK+++S++++ EF E F +FDKDGDG I KELG V+RSLG+ Sbjct: 6 LAKNELSEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQ 48
BLAST of EMLSAG00000001118 vs. nr
Match: gi|1131327057|gb|JAV13885.1| (putative myosin regulatory light chain ef-hand protein, partial [Nyssomyia neivai]) HSP 1 Score: 58.151 bits (139), Expect = 1.853e-8 Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 0 Query: 21 PKLMNNPKNPL-----YKKQICKXCRQPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 P L N P + ++K +CK +E +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 2 PHLANTPSSGTNSHHQHRKLVCK--------WVEKMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 70
BLAST of EMLSAG00000001118 vs. nr
Match: gi|1012979987|gb|KYQ53931.1| (Calmodulin [Trachymyrmex zeteki]) HSP 1 Score: 57.3806 bits (137), Expect = 2.390e-8 Identity = 24/41 (58.54%), Postives = 33/41 (80.49%), Query Frame = 0 Query: 52 KSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 K+ +S+ ++ EF E FR+FDKDGDGTI +ELG V+RSLG+ Sbjct: 92 KTPISKSQMKEFREAFRLFDKDGDGTITKEELGRVMRSLGQ 132
BLAST of EMLSAG00000001118 vs. nr
Match: gi|332024575|gb|EGI64773.1| (Calmodulin [Acromyrmex echinatior]) HSP 1 Score: 57.3806 bits (137), Expect = 2.446e-8 Identity = 24/41 (58.54%), Postives = 33/41 (80.49%), Query Frame = 0 Query: 52 KSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 K+ +S+ ++ EF E FR+FDKDGDGTI +ELG V+RSLG+ Sbjct: 94 KTPISKSQMKEFREAFRLFDKDGDGTITKEELGRVMRSLGQ 134
BLAST of EMLSAG00000001118 vs. nr
Match: gi|474406638|gb|EMS66519.1| (Calmodulin-like protein 1 [Triticum urartu]) HSP 1 Score: 56.9954 bits (136), Expect = 2.526e-8 Identity = 24/39 (61.54%), Postives = 33/39 (84.62%), Query Frame = 0 Query: 54 KVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++SQ+++ EF E F++FDKDGDGTI KELG V+RSLG+ Sbjct: 3 ELSQEQIQEFREAFKLFDKDGDGTITTKELGTVMRSLGQ 41
BLAST of EMLSAG00000001118 vs. nr
Match: gi|930675814|gb|KPJ16060.1| (Calmodulin [Papilio machaon]) HSP 1 Score: 58.5362 bits (140), Expect = 2.572e-8 Identity = 24/45 (53.33%), Postives = 35/45 (77.78%), Query Frame = 0 Query: 48 LELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 LE+ +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 24 LEMGADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 68
BLAST of EMLSAG00000001118 vs. nr
Match: gi|1009364416|gb|KYM89457.1| (Calmodulin [Atta colombica]) HSP 1 Score: 57.3806 bits (137), Expect = 2.580e-8 Identity = 24/41 (58.54%), Postives = 33/41 (80.49%), Query Frame = 0 Query: 52 KSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 K+ +S+ ++ EF E FR+FDKDGDGTI +ELG V+RSLG+ Sbjct: 94 KTPISKSQMKEFREAFRLFDKDGDGTITKEELGRVMRSLGQ 134
BLAST of EMLSAG00000001118 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold324_size206069-processed-gene-1.14 (protein:Tk12297 transcript:snap_masked-scaffold324_size206069-processed-gene-1.14-mRNA-1 annotation:"PREDICTED: calmodulin-like") HSP 1 Score: 70.8626 bits (172), Expect = 4.369e-17 Identity = 31/61 (50.82%), Postives = 45/61 (73.77%), Query Frame = 0 Query: 32 YKKQICKXCRQPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 +K +IC C+QP+ + + K ++ +++ EF ECF+MFDKDGDGTID ELG V+RSLG+ Sbjct: 27 FKPEICGSCKQPVFVRKPMMKFNLTDEQILEFKECFQMFDKDGDGTIDTTELGTVMRSLGQ 87
BLAST of EMLSAG00000001118 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1746_size29152-snap-gene-0.4 (protein:Tk04496 transcript:maker-scaffold1746_size29152-snap-gene-0.4-mRNA-1 annotation:"AT15141p") HSP 1 Score: 55.4546 bits (132), Expect = 4.854e-11 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 42 QPLPKQLELAKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 Q LP + +A +++++++ EF E F +FDKDGDGTI KELG V+RSLG+ Sbjct: 69 QLLPFTITMA-DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ 118
BLAST of EMLSAG00000001118 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold415_size178368-snap-gene-0.27 (protein:Tk01168 transcript:maker-scaffold415_size178368-snap-gene-0.27-mRNA-1 annotation:"Calmodulin") HSP 1 Score: 51.2174 bits (121), Expect = 9.474e-10 Identity = 21/38 (55.26%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 55 VSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++++++ EF E F++FDKDGDGTI KEL V+RSLG+ Sbjct: 6 LTEEQVGEFKEAFQLFDKDGDGTITTKELATVMRSLGQ 43
BLAST of EMLSAG00000001118 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold624_size122968-snap-gene-0.21 (protein:Tk09517 transcript:maker-scaffold624_size122968-snap-gene-0.21-mRNA-1 annotation:"PREDICTED: calmodulin") HSP 1 Score: 50.0618 bits (118), Expect = 2.040e-9 Identity = 21/41 (51.22%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 51 AKSKVSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLG 91 +++++QK + E E F +FDK+GDGTI +ELG V+RSLG Sbjct: 6 VRARLNQKRVKEIREAFAIFDKNGDGTISAQELGYVMRSLG 46
BLAST of EMLSAG00000001118 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1202_size55818-snap-gene-0.13 (protein:Tk09187 transcript:maker-scaffold1202_size55818-snap-gene-0.13-mRNA-1 annotation:"hypothetical protein EMIHUDRAFT_373343") HSP 1 Score: 44.2838 bits (103), Expect = 4.186e-7 Identity = 20/38 (52.63%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 55 VSQKELDEFSECFRMFDKDGDGTIDVKELGAVLRSLGK 92 ++ +EL F E F +FDK+ DGTI KEL V+RSLG+ Sbjct: 25 LTSEELATFKEAFTVFDKNQDGTITTKELSTVMRSLGQ 62 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001118 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001118 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001118 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 4
BLAST of EMLSAG00000001118 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001118 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001118 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001118 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 5
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1187:84720..84998+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001118-683884 ID=EMLSAG00000001118-683884|Name=EMLSAG00000001118|organism=Lepeophtheirus salmonis|type=gene|length=279bp|location=Sequence derived from alignment at LSalAtl2s1187:84720..84998+ (Lepeophtheirus salmonis)back to top Add to Basket
|