EMLSAG00000001346, EMLSAG00000001346-684112 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001346 vs. C. finmarchicus
Match: gi|592791902|gb|GAXK01162666.1| (TSA: Calanus finmarchicus comp3559059_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.437e+0 Identity = 20/65 (30.77%), Postives = 31/65 (47.69%), Query Frame = 0 Query: 10 DGERDESHPTTFDNFKESSTFESLPGRIPKRRVGGSKKYRILLADVWEMEASLSATRINKKNYGI 74 D E D+ H +DN +E + + R+P +R G K RIL M+ + + N+ N GI Sbjct: 77 DNEYDDEHDNEYDNQEEMNKRSWMRMRLPTKRSWG--KIRILK----RMDGKIRLLKKNRGNIGI 253
BLAST of EMLSAG00000001346 vs. C. finmarchicus
Match: gi|592882736|gb|GAXK01075639.1| (TSA: Calanus finmarchicus comp1835721_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.319e+0 Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 0 Query: 55 VWEMEASLSATRINKKNYG 73 +WEME + + TR+NK YG Sbjct: 884 MWEMEKARNITRLNKLKYG 940
BLAST of EMLSAG00000001346 vs. C. finmarchicus
Match: gi|592938777|gb|GAXK01019776.1| (TSA: Calanus finmarchicus comp433730_c1_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 5.686e+0 Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 0 Query: 19 TTFDNFKESSTFESLPGRIP 38 T FDNF+ SST S P IP Sbjct: 902 TWFDNFRASSTLSSFPLDIP 961
BLAST of EMLSAG00000001346 vs. C. finmarchicus
Match: gi|592801139|gb|GAXK01153429.1| (TSA: Calanus finmarchicus comp544365_c1_seq6 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.857e+0 Identity = 13/52 (25.00%), Postives = 25/52 (48.08%), Query Frame = 0 Query: 8 NIDGERDESHPTTFDNFKESSTFESLPGRI-------PKRRVGGSKKYRILL 52 N+ ++ HP T D +E + LPG I P+ ++ S +Y +++ Sbjct: 408 NLHSQQQLHHPLTID*DEEHHHLQLLPGHIVALHSLSPQSKIADSLRYSVII 563
BLAST of EMLSAG00000001346 vs. C. finmarchicus
Match: gi|592784949|gb|GAXK01169619.1| (TSA: Calanus finmarchicus comp27_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.744e+0 Identity = 20/52 (38.46%), Postives = 26/52 (50.00%), Query Frame = 0 Query: 21 FDNFKESSTFESLPGRIPKRRV-GGSKKYRILLADV----WEMEASLSATRI 67 F+ + ++ + P RI RV GG+KKYR L D W EA TRI Sbjct: 498 FELARPAAMTKLAPQRIHTLRVRGGNKKYRALRLDTGNFSWGSEAVARKTRI 653
BLAST of EMLSAG00000001346 vs. C. finmarchicus
Match: gi|592882735|gb|GAXK01075640.1| (TSA: Calanus finmarchicus comp1835721_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.917e+0 Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 0 Query: 55 VWEMEASLSATRINKKNYG 73 +WEME + + TR+NK YG Sbjct: 227 MWEMEKARNITRLNKLKYG 283
BLAST of EMLSAG00000001346 vs. L. salmonis peptides
Match: EMLSAP00000001346 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1228:17504:18509:1 gene:EMLSAG00000001346 transcript:EMLSAT00000001346 description:"snap_masked-LSalAtl2s1228-processed-gene-0.8") HSP 1 Score: 156.377 bits (394), Expect = 6.012e-51 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 0 Query: 1 MRLMRTANIDGERDESHPTTFDNFKESSTFESLPGRIPKRRVGGSKKYRILLADVWEMEASLSATRINKKNYGIS 75 MRLMRTANIDGERDESHPTTFDNFKESSTFESLPGRIPKRRVGGSKKYRILLADVWEMEASLSATRINKKNYGIS Sbjct: 1 MRLMRTANIDGERDESHPTTFDNFKESSTFESLPGRIPKRRVGGSKKYRILLADVWEMEASLSATRINKKNYGIS 75 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001346 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001346 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000001346 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001346 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001346 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001346 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001346 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1228:17504..18509+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001346-684112 ID=EMLSAG00000001346-684112|Name=EMLSAG00000001346|organism=Lepeophtheirus salmonis|type=gene|length=1006bp|location=Sequence derived from alignment at LSalAtl2s1228:17504..18509+ (Lepeophtheirus salmonis)back to top Add to Basket
|